3GK7A

Crystal structure of 4-hydroxybutyrate coa-transferase from clostridium aminobutyricum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
447
structure length
447
Chain Sequence
MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAYKNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPVFFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKIVLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGKHCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEAGVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVVAQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDGKGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIAEMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAFSAWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-Hydroxybutyrate CoA-transferase
publication title Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
pubmed doi rcsb
source organism Clostridium aminobutyricum
molecule tags Transferase
total genus 160
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 2.8.3.-:
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 3gk7A02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A03
1OOZA 3DLXA 3EH7A 2AHUA 2OASA 2AHWA 1OOYA 1K6DA 2NRBA 1O9LA 3QDQA 1XR4A 3OXOA 4KGBA 1POIB 2AHVA 2HJ0A 1POIA 3RRLA 1OPEA 3RRLB 3CDKA 3K6MA 3CDKB 3D3UA 2NRCA 5DBNA 1M3EA 3GK7A 5DBNB
chains in the Genus database with same CATH superfamily
1OOZA 3DLXA 3IH9A 3DJAA 3F43A 3DUPA 3IH8A 1AUZA 1BUZA 1OOYA 4GHNA 2KLNA 2RRLA 1K32A 3IF5A 3K50A 3JU4A 3ZTBA 3GHFA 2NRCA 1N6EA 2AS0A 2ZOAA 3LKLA 3OIRA 2DXLA 3AGDA 4L8KA 2ZO9B 5EUWA 3GMFA 1BPLA 1H4ZA 2AHUA 1WXXA 5EUZA 4DGHA 2NRBA 1TH8B 3ZXNA 2KA5A 1FC9A 1XR4A 3OXOA 1TIDB 4KGBA 1J7XA 1V0EA 2DXNA 2VY9A 1POIB 5EUSA 3K6MA 3LLOA 1H4XA 3D3UA 3IHAA 4L1CA 4AEJA 5EUUA 1H4YA 1V0FA 3GVJA 3V97A 4DMGA 3MOGA 2CWWA 1K6DA 1O9LA 5EUXA 3NY7A 5EZBA 3QDQA 4QTPA 4JC0A 2AHVA 3IHBA 4AE2A 1POIA 3DORA 1OPEA 1FCFA 1N6DA 2B78A 1THNB 4HIZA 3GK7A 1T6RA 1N6FA 3T6OA 3VSEA 3MGLA 3EH7A 3C0KA 3AGEA 2OASA 2AHWA 1VC1A 1FC7A 1HF2A 4HYLA 4DGFA 3GVKA 1FC6A 3V8VA 3GVLA 1WXWA 3D03A 4XS5A 2HJ0A 3RRLA 3RRLB 1SBOA 3CDKA 3LDFA 3OIZA 3CDKB 1TILB 5DBNA 1M3EA 5DBNB
chains in the Genus database with same CATH topology
1OOZA 3DLXA 3EH7A 2AHUA 2OASA 2AHWA 1OOYA 1K6DA 2NRBA 1O9LA 3QDQA 1XR4A 3OXOA 4KGBA 1POIB 2AHVA 2HJ0A 1POIA 3RRLA 1OPEA 3RRLB 3CDKA 3K6MA 3CDKB 3D3UA 2NRCA 5DBNA 1M3EA 3GK7A 5DBNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OOZ A;  3DLX A;  3EH7 A;  2AHU A;  2OAS A;  2AHW A;  1OOY A;  1K6D A;  2NRB A;  1O9L A;  3QDQ A;  1XR4 A;  3OXO A;  4KGB A;  1POI B;  2AHV A;  2HJ0 A;  1POI A;  3RRL A;  1OPE A;  3RRL B;  3CDK A;  3K6M A;  3CDK B;  3D3U A;  2NRC A;  5DBN A;  1M3E A;  3GK7 A;  5DBN B; 
#chains in the Genus database with same CATH topology
 1OOZ A;  3DLX A;  3IH9 A;  3DJA A;  3F43 A;  3DUP A;  3IH8 A;  1AUZ A;  1BUZ A;  1OOY A;  4GHN A;  2KLN A;  2RRL A;  1K32 A;  3IF5 A;  3K50 A;  3JU4 A;  3ZTB A;  3GHF A;  2NRC A;  1N6E A;  2AS0 A;  2ZOA A;  3LKL A;  3OIR A;  2DXL A;  3AGD A;  4L8K A;  2ZO9 B;  5EUW A;  3GMF A;  1BPL A;  1H4Z A;  2AHU A;  1WXX A;  5EUZ A;  4DGH A;  2NRB A;  1TH8 B;  3ZXN A;  2KA5 A;  1FC9 A;  1XR4 A;  3OXO A;  1TID B;  4KGB A;  1J7X A;  1V0E A;  2DXN A;  2VY9 A;  1POI B;  5EUS A;  3K6M A;  3LLO A;  1H4X A;  3D3U A;  3IHA A;  4L1C A;  4AEJ A;  5EUU A;  1H4Y A;  1V0F A;  3GVJ A;  3V97 A;  4DMG A;  3MOG A;  2CWW A;  1K6D A;  1O9L A;  5EUX A;  3NY7 A;  5EZB A;  3QDQ A;  4QTP A;  4JC0 A;  2AHV A;  3IHB A;  4AE2 A;  1POI A;  3DOR A;  1OPE A;  1FCF A;  1N6D A;  2B78 A;  1THN B;  4HIZ A;  3GK7 A;  1T6R A;  1N6F A;  3T6O A;  3VSE A;  3MGL A;  3EH7 A;  3C0K A;  3AGE A;  2OAS A;  2AHW A;  1VC1 A;  1FC7 A;  1HF2 A;  4HYL A;  4DGF A;  3GVK A;  1FC6 A;  3V8V A;  3GVL A;  1WXW A;  3D03 A;  4XS5 A;  2HJ0 A;  3RRL A;  3RRL B;  1SBO A;  3CDK A;  3LDF A;  3OIZ A;  3CDK B;  1TIL B;  5DBN A;  1M3E A;  5DBN B; 
#chains in the Genus database with same CATH homology
 1OOZ A;  3DLX A;  3EH7 A;  2AHU A;  2OAS A;  2AHW A;  1OOY A;  1K6D A;  2NRB A;  1O9L A;  3QDQ A;  1XR4 A;  3OXO A;  4KGB A;  1POI B;  2AHV A;  2HJ0 A;  1POI A;  3RRL A;  1OPE A;  3RRL B;  3CDK A;  3K6M A;  3CDK B;  3D3U A;  2NRC A;  5DBN A;  1M3E A;  3GK7 A;  5DBN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...