3GK7A

Crystal structure of 4-hydroxybutyrate coa-transferase from clostridium aminobutyricum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
447
structure length
447
Chain Sequence
MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAYKNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPVFFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKIVLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGKHCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEAGVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVVAQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDGKGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIAEMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAFSAWSHPQFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords 4-Hydroxybutyrate CoA-transferase
publication title Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
pubmed doi rcsb
source organism Clostridium aminobutyricum
total genus 160
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 2.8.3.-:
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 3gk7A02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A03
1K6DA 4KGBA 5DBNB 1OOYA 1OOZA 3EH7A 2NRBA 2AHWA 2AHVA 3CDKA 5DBNA 3RRLB 1OPEA 3OXOA 2NRCA 1POIB 3K6MA 3RRLA 1XR4A 3D3UA 3QDQA 3GK7A 1O9LA 2AHUA 2HJ0A 3DLXA 1M3EA 1POIA 2OASA 3CDKB
chains in the Genus database with same CATH superfamily
2ZO9B 2B78A 1OOYA 1OOZA 1FC6A 3EH7A 3IHAA 4XS5A 2AHWA 3CDKA 3DUPA 4AE2A 1H4ZA 5EZBA 5EUXA 1TH8B 3LLOA 1WXXA 3OXOA 1H4YA 1AUZA 1J7XA 4HYLA 3QDQA 1O9LA 2ZOAA 1M3EA 2OASA 3LDFA 5EUWA 3C0KA 5EUUA 1V0FA 1V0EA 3MGLA 2NRBA 2DXLA 2AHVA 1WXWA 4L1CA 5EUSA 1OPEA 4DGFA 3LKLA 3GVKA 1TILB 3JU4A 4DMGA 3D3UA 4AEJA 2HJ0A 4HIZA 3IHBA 2KLNA 3V97A 3IF5A 3OIZA 3VSEA 3ZXNA 1K6DA 4KGBA 5DBNB 1FC7A 3GMFA 2AS0A 3GVJA 4QTPA 1VC1A 3AGDA 5EUZA 5DBNA 3IH9A 1THNB 2VY9A 3GVLA 3V8VA 1H4XA 1TIDB 2DXNA 1N6DA 3GHFA 3K6MA 3K50A 4L8KA 1HF2A 1K32A 4GHNA 1FC9A 3D03A 1SBOA 3NY7A 1BUZA 3OIRA 3T6OA 3F43A 2CWWA 3DJAA 3RRLB 3IH8A 1T6RA 1N6FA 3ZTBA 1FCFA 2NRCA 1POIB 3RRLA 1N6EA 4DGHA 2KA5A 1XR4A 2RRLA 1BPLA 4JC0A 3GK7A 2AHUA 3MOGA 3DLXA 1POIA 3AGEA 3DORA 3CDKB
chains in the Genus database with same CATH topology
1K6DA 4KGBA 5DBNB 1OOYA 1OOZA 3EH7A 2NRBA 2AHWA 2AHVA 3CDKA 5DBNA 3RRLB 1OPEA 3OXOA 2NRCA 1POIB 3K6MA 3RRLA 1XR4A 3D3UA 3QDQA 3GK7A 1O9LA 2AHUA 2HJ0A 3DLXA 1M3EA 1POIA 2OASA 3CDKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K6D A;  4KGB A;  5DBN B;  1OOY A;  1OOZ A;  3EH7 A;  2NRB A;  2AHW A;  2AHV A;  3CDK A;  5DBN A;  3RRL B;  1OPE A;  3OXO A;  2NRC A;  1POI B;  3K6M A;  3RRL A;  1XR4 A;  3D3U A;  3QDQ A;  3GK7 A;  1O9L A;  2AHU A;  2HJ0 A;  3DLX A;  1M3E A;  1POI A;  2OAS A;  3CDK B; 
#chains in the Genus database with same CATH topology
 2ZO9 B;  2B78 A;  1OOY A;  1OOZ A;  1FC6 A;  3EH7 A;  3IHA A;  4XS5 A;  2AHW A;  3CDK A;  3DUP A;  4AE2 A;  1H4Z A;  5EZB A;  5EUX A;  1TH8 B;  3LLO A;  1WXX A;  3OXO A;  1H4Y A;  1AUZ A;  1J7X A;  4HYL A;  3QDQ A;  1O9L A;  2ZOA A;  1M3E A;  2OAS A;  3LDF A;  5EUW A;  3C0K A;  5EUU A;  1V0F A;  1V0E A;  3MGL A;  2NRB A;  2DXL A;  2AHV A;  1WXW A;  4L1C A;  5EUS A;  1OPE A;  4DGF A;  3LKL A;  3GVK A;  1TIL B;  3JU4 A;  4DMG A;  3D3U A;  4AEJ A;  2HJ0 A;  4HIZ A;  3IHB A;  2KLN A;  3V97 A;  3IF5 A;  3OIZ A;  3VSE A;  3ZXN A;  1K6D A;  4KGB A;  5DBN B;  1FC7 A;  3GMF A;  2AS0 A;  3GVJ A;  4QTP A;  1VC1 A;  3AGD A;  5EUZ A;  5DBN A;  3IH9 A;  1THN B;  2VY9 A;  3GVL A;  3V8V A;  1H4X A;  1TID B;  2DXN A;  1N6D A;  3GHF A;  3K6M A;  3K50 A;  4L8K A;  1HF2 A;  1K32 A;  4GHN A;  1FC9 A;  3D03 A;  1SBO A;  3NY7 A;  1BUZ A;  3OIR A;  3T6O A;  3F43 A;  2CWW A;  3DJA A;  3RRL B;  3IH8 A;  1T6R A;  1N6F A;  3ZTB A;  1FCF A;  2NRC A;  1POI B;  3RRL A;  1N6E A;  4DGH A;  2KA5 A;  1XR4 A;  2RRL A;  1BPL A;  4JC0 A;  3GK7 A;  2AHU A;  3MOG A;  3DLX A;  1POI A;  3AGE A;  3DOR A;  3CDK B; 
#chains in the Genus database with same CATH homology
 1K6D A;  4KGB A;  5DBN B;  1OOY A;  1OOZ A;  3EH7 A;  2NRB A;  2AHW A;  2AHV A;  3CDK A;  5DBN A;  3RRL B;  1OPE A;  3OXO A;  2NRC A;  1POI B;  3K6M A;  3RRL A;  1XR4 A;  3D3U A;  3QDQ A;  3GK7 A;  1O9L A;  2AHU A;  2HJ0 A;  3DLX A;  1M3E A;  1POI A;  2OAS A;  3CDK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...