3GK7A

Crystal structure of 4-hydroxybutyrate coa-transferase from clostridium aminobutyricum
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
447
structure length
447
Chain Sequence
b'MDWKKIYEDRTCTADEAVKSIKSGDRVLFAHCVAEPPVLVEAMVANAAAYKNVTVSHMVTLGKGEYSKPEYKENFTFEGWFTSPSTRGSIAEGHGQFVPVFFHEVPSLIRKDIFHVDVFMVMVSPPDHNGFCCVGVSSDYTMQAIKSAKIVLAEVNDQVPVVYGDTFVHVSEIDKFVETSHPLPEIGLPKIGEVEAAIGKHCASLIEDGSTLQLGIGAIPDAVLSQLKDKKHLGIHSEMISDGVVDLYEAGVIDCSQKSIDKGKMAITFLMGTKRLYDFAANNPKVELKPVDYINHPSVVAQCSKMVCINACLQVDFMGQIVSDSIGTKQFSGVGGQVDFVRGASMSIDGKGKAIIAMPSVAKKKDGSMISKIVPFIDHGAAVTTSRNDADYVVTEYGIAEMKGKSLQDRARALINIAHPDFKDELKAEFEKRFNAAFSAWSHPQFE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 4-Hydroxybutyrate CoA-transferase
publication title Crystal structure of 4-hydroxybutyrate CoA-transferase from Clostridium aminobutyricum
pubmed doi rcsb
source organism Clostridium aminobutyricum
molecule tags Transferase
total genus 160
structure length 447
sequence length 447
chains with identical sequence B
ec nomenclature ec 2.8.3.-:
pdb deposition date 2009-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02550 AcetylCoA_hydro Acetyl-CoA hydrolase/transferase N-terminal domain
A PF13336 AcetylCoA_hyd_C Acetyl-CoA hydrolase/transferase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.750.70 Alpha Beta 2-Layer Sandwich Transcription Regulator spoIIAA 4-hydroxybutyrate coenzyme like domains 3gk7A02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A01
3.40.1080.20 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 3gk7A03
1POIA 3DLXA 1OOZA 2AHWA 3CDKB 3OXOA 1OOYA 1O9LA 1OPEA 3EH7A 2HJ0A 3CDKA 1XR4A 2AHVA 1K6DA 3QDQA 1M3EA 2AHUA 5DBNB 3RRLB 3D3UA 3K6MA 4KGBA 1POIB 5DBNA 3RRLA 3GK7A 2OASA 2NRBA 2NRCA
chains in the Genus database with same CATH superfamily
1POIA 2DXNA 4XS5A 4AEJA 3GVLA 1N6FA 3CDKB 1TILB 1O9LA 1OPEA 1V0EA 3EH7A 3LLOA 3D03A 4DMGA 3K50A 3IH9A 1HF2A 4DGFA 1K6DA 5EZBA 5EUXA 3LKLA 5DBNA 4HIZA 3T6OA 2NRBA 5EUSA 1V0FA 3OIRA 3DLXA 2VY9A 1K32A 3OXOA 1N6EA 3ZXNA 3JU4A 3C0KA 3GVKA 2ZO9B 2RRLA 1THNB 3CDKA 2AHVA 3GMFA 3IHBA 3RRLB 2KA5A 1H4YA 3AGDA 4L1CA 1WXXA 3F43A 2AS0A 2NRCA 1TH8B 3DJAA 3VSEA 1WXWA 4QTPA 1FC9A 3IH8A 5EUWA 1J7XA 1T6RA 1TIDB 3OIZA 4JC0A 1H4XA 5EUZA 4HYLA 5EUUA 4L8KA 4AE2A 1FC6A 1M3EA 2AHUA 3IHAA 1FCFA 1POIB 4DGHA 3RRLA 3GK7A 2OASA 1N6DA 3IF5A 1FC7A 4GHNA 2CWWA 3MOGA 1OOZA 1BPLA 2AHWA 3GHFA 2B78A 2DXLA 3AGEA 3NY7A 1OOYA 3V97A 3ZTBA 2HJ0A 3V8VA 3GVJA 1XR4A 2KLNA 1H4ZA 1BUZA 3QDQA 1SBOA 3LDFA 5DBNB 3D3UA 1VC1A 3K6MA 4KGBA 1AUZA 3DORA 3DUPA 3MGLA 2ZOAA
chains in the Genus database with same CATH topology
1POIA 3DLXA 1OOZA 2AHWA 3CDKB 3OXOA 1OOYA 1O9LA 1OPEA 3EH7A 2HJ0A 3CDKA 1XR4A 2AHVA 1K6DA 3QDQA 1M3EA 2AHUA 5DBNB 3RRLB 3D3UA 3K6MA 4KGBA 1POIB 5DBNA 3RRLA 3GK7A 2OASA 2NRBA 2NRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1POI A;  3DLX A;  1OOZ A;  2AHW A;  3CDK B;  3OXO A;  1OOY A;  1O9L A;  1OPE A;  3EH7 A;  2HJ0 A;  3CDK A;  1XR4 A;  2AHV A;  1K6D A;  3QDQ A;  1M3E A;  2AHU A;  5DBN B;  3RRL B;  3D3U A;  3K6M A;  4KGB A;  1POI B;  5DBN A;  3RRL A;  3GK7 A;  2OAS A;  2NRB A;  2NRC A; 
#chains in the Genus database with same CATH topology
 1POI A;  2DXN A;  4XS5 A;  4AEJ A;  3GVL A;  1N6F A;  3CDK B;  1TIL B;  1O9L A;  1OPE A;  1V0E A;  3EH7 A;  3LLO A;  3D03 A;  4DMG A;  3K50 A;  3IH9 A;  1HF2 A;  4DGF A;  1K6D A;  5EZB A;  5EUX A;  3LKL A;  5DBN A;  4HIZ A;  3T6O A;  2NRB A;  5EUS A;  1V0F A;  3OIR A;  3DLX A;  2VY9 A;  1K32 A;  3OXO A;  1N6E A;  3ZXN A;  3JU4 A;  3C0K A;  3GVK A;  2ZO9 B;  2RRL A;  1THN B;  3CDK A;  2AHV A;  3GMF A;  3IHB A;  3RRL B;  2KA5 A;  1H4Y A;  3AGD A;  4L1C A;  1WXX A;  3F43 A;  2AS0 A;  2NRC A;  1TH8 B;  3DJA A;  3VSE A;  1WXW A;  4QTP A;  1FC9 A;  3IH8 A;  5EUW A;  1J7X A;  1T6R A;  1TID B;  3OIZ A;  4JC0 A;  1H4X A;  5EUZ A;  4HYL A;  5EUU A;  4L8K A;  4AE2 A;  1FC6 A;  1M3E A;  2AHU A;  3IHA A;  1FCF A;  1POI B;  4DGH A;  3RRL A;  3GK7 A;  2OAS A;  1N6D A;  3IF5 A;  1FC7 A;  4GHN A;  2CWW A;  3MOG A;  1OOZ A;  1BPL A;  2AHW A;  3GHF A;  2B78 A;  2DXL A;  3AGE A;  3NY7 A;  1OOY A;  3V97 A;  3ZTB A;  2HJ0 A;  3V8V A;  3GVJ A;  1XR4 A;  2KLN A;  1H4Z A;  1BUZ A;  3QDQ A;  1SBO A;  3LDF A;  5DBN B;  3D3U A;  1VC1 A;  3K6M A;  4KGB A;  1AUZ A;  3DOR A;  3DUP A;  3MGL A;  2ZOA A; 
#chains in the Genus database with same CATH homology
 1POI A;  3DLX A;  1OOZ A;  2AHW A;  3CDK B;  3OXO A;  1OOY A;  1O9L A;  1OPE A;  3EH7 A;  2HJ0 A;  3CDK A;  1XR4 A;  2AHV A;  1K6D A;  3QDQ A;  1M3E A;  2AHU A;  5DBN B;  3RRL B;  3D3U A;  3K6M A;  4KGB A;  1POI B;  5DBN A;  3RRL A;  3GK7 A;  2OAS A;  2NRB A;  2NRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...