1POIA

Crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
317
Chain Sequence
b'SKVMTLKDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQGITDLTGLGGAAGGDWDMLIGNGRVKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIWGGKFQDVDIAEAAKYTIVTCEEIISDEEIRRDPTKNDIPGMCVDAVVLAPYGAHPSQCYGLYDYDNPFLKVYDKVSKTQEDFDAFCKEWVFDLKDHDEYLNKLGATRLINLKVVPGLGYHIDMTKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTACONATE COENZYME A-TRANSFERASE
publication title Glutaconate CoA-transferase from Acidaminococcus fermentans: the crystal structure reveals homology with other CoA-transferases.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Transferase
total genus 119
structure length 317
sequence length 317
chains with identical sequence C
ec nomenclature ec 2.8.3.12: Glutaconate CoA-transferase.
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01144 CoA_trans Coenzyme A transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.40 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 1poiA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 1poiA01
2HJ0A 2AHWA 2AHUA 1XR4A 3CDKB 3K6MA 5DBNB 3DLXA 2NRBA 3OXOA 1OOYA 2AHVA 5DBNA 3CDKA 1K6DA 1POIB 3EH7A 1OPEA 3QDQA 1O9LA 3RRLB 1M3EA 1POIA 2OASA 3RRLA 2NRCA 3D3UA 1OOZA 3GK7A 4KGBA
chains in the Genus database with same CATH superfamily
2E88A 5EVZA 2QWOA 3CDKB 2KJAA 3L56A 1C56A 5AQOA 1DJTA 1NE5A 5FPEA 3ATVA 1VNBA 4CQKA 3QI7A 1QQMA 2VY6A 2BRZA 2LY6A 3KOXA 3CW4A 2N2QA 2AHWA 1SEGA 5AQUA 3GL1A 5AQLA 2NY8X 1T7EA 1GPTA 1NGIA 2KSKA 3D2EB 3L6QA 1NH5A 2BUPA 4AAZA 1POIA 1ZVGA 3SF4D 3FZHA 5AQMA 1FH3A 3KVGA 2YEOA 5AQQA 5EY4A 2YBRC 2M8BB 2NY9X 4H5RA 1L4VA 4GNIA 5FPMA 2KHOA 4H5NA 2QWMA 2NRBA 5AQRA 2QWRA 1SNBA 1NGHA 1T7BA 2QWNA 1P0AA 1T0ZA 1ICAA 1T1TA 1DQ7A 1NGEA 5AQWA 3FZLA 3KOYA 2K35A 3KP0A 1BCGA 5DBNA 3ATUA 1POIB 2LI7A 1BRZA 3QMLA 5AQHA 2QWLA 4V1DC 5BPNA 1BA0A 1WMTA 4H5TA 3RRLA 4UAEF 3K6MA 1HJOA 2KBHA 2KGQA 2E3GA 1PTXA 5CY0A 1GPSA 3L4IA 2LT8A 1PX9A 3E7UX 2LJ7A 5AQSA 3FZFA 5AQYA 2YILA 1KAYA 2HJ0A 1ZYWA 1ATRA 2N66A 1XR4A 1TI5A 5FPDA 1ZUTA 1MR4A 1LQHA 5F2RA 1NGFA 2GL1A 3QFPA 5AQJA 1B7DA 1C55A 1NGJA 3BK3C 4UADE 3D3UA 1I2VA 2ATBA 4KBOA 2LR3A 4HHFA 1WT7A 3R2VA 3DLXA 3GDQA 2GMOA 5AQIA 3RRLB 3LDLA 2LY5A 3FZMA 3CQXA 4KYPA 1NGGA 3KP1A 1PE4A 3LDPA 1N4NA 1ZVEA 2QW9A 2KBKA 3JXUA 4UAFE 1HPMA 4HE7A 1ZFUA 4AB0A 1T7AA 2N69A 1DKGD 3QDQA 1SN1A 1KAXA 2KBJA 1I2UA 2QXLA 5AQNA 1I6FA 2E0HA 1CN2A 3IUCA 5EX5A 3HSCA 1NGBA 1ATSA 2N2RA 2A7TA 1OPEA 5BPMA 4IO8A 3KOZA 1UGLA 2MBKA 5AQKA 3KOWA 5AQZA 3C7NA 1NPIA 3A8YA 2B3CA 1JKZA 1P00A 1LQIA 1SN4A 1O9LA 1KV0A 1XRSB 3LDNA 4H5VA 1OZZA 1JZAA 1VNAA 1ZYVA 5AQTA 4KGBA 3KHWA 2QWPA 1BK8A 1ZU3A 1YUWA 5AR0A 1NGDA 3FZKA 2YIOA 2LN8A 1S3XA 1BMRA 2KPYA 3LDOA 3D2FA 5F1XA 1JZBA 2B68A 2OASA 3GKUA 1BA1A 2QWQA 2JDQD 2MN5A 3QFUA 5AQXA 5DBNB 3OXOA 2LKBA 1K6DA 2YC1C 5BN8A 3I33A 5BPLA 4H5WA 2LJMA 3C7NB 1QQOA 3PSMA 5FPNA 1KAZA 2G2KA 5EXWA 3AY9A 3CDKA 2V7ZA 2I61A 5AQFA 4HWIA 1I6GA 5BN9A 3FE1A 1NRAA 1NGCA 1CHZA 3M3ZA 1JXCA 2KYQA 1OOZA 3GK7A 1NRBA 1WWNA 3KC6A 3D2FB 2MZ0A 2E2FA 2YIPA 3EH7A 2SN3A 2D56A 1M3EA 2ASCA 3D2EA 5KK4A 1B3CA 2NRCA 1HX1A 1OMYA 1LQQA 1AHOA 1BUPA 3E7RL 2E8AA 1K8BA 4FSVA 5AQVA 2AHUA 4FL9A 1QQNA 5F0XA 1OOYA 4UJ0A 2AHVA 1NGAA 5AQPA 1AYJA 4AEIA 2E3FA 3LDQA 1MYNA 5AQGA
chains in the Genus database with same CATH topology
2E88A 1BA1A 2QW9A 1NGEA 5EVZA 5AQWA 2QWQA 3FZLA 2QWOA 2JDQD 3JXUA 2MN5A 3QFUA 4UAFE 5AQXA 3CDKB 1HPMA 5DBNB 3OXOA 2K35A 3L56A 5AQOA 5DBNA 3ATUA 5FPEA 3ATVA 1DKGD 1K6DA 1POIB 3QDQA 3QI7A 3QMLA 1KAXA 3I33A 5BN8A 5AQHA 2QWLA 5BPLA 4H5WA 1QQMA 2VY6A 5BPNA 1BA0A 3RRLA 4H5TA 2QXLA 3C7NB 4UAEF 3K6MA 1QQOA 5AQNA 1HJOA 3CW4A 5FPNA 2AHWA 1KAZA 5AQUA 3L4IA 3GL1A 3IUCA 5EX5A 3HSCA 1NGBA 5AQLA 5EXWA 3AY9A 3CDKA 1ATSA 2V7ZA 5AQFA 4HWIA 1NGIA 5BPMA 1OPEA 3D2EB 4IO8A 3L6QA 5BN9A 3FE1A 2BUPA 5AQSA 2MBKA 5AQKA 1POIA 1NGCA 3M3ZA 3FZFA 3SF4D 5AQYA 5AQZA 1OOZA 3FZHA 5AQMA 3GK7A 2YILA 1KAYA 2HJ0A 1ATRA 3C7NA 3KC6A 1XR4A 3A8YA 3KVGA 5FPDA 5AQQA 3D2FB 5F2RA 5EY4A 2E2FA 1NGFA 2YIPA 3EH7A 1O9LA 4H5RA 2D56A 3LDNA 1M3EA 4H5VA 4GNIA 3QFPA 5AQJA 3D2EA 5FPMA 2NRCA 1NGJA 3BK3C 2KHOA 4UADE 3D3UA 5AQTA 1HX1A 4KGBA 3KHWA 4H5NA 2QWPA 1BUPA 2QWMA 4KBOA 2E8AA 4FSVA 5AQVA 1YUWA 4FL9A 5AR0A 2AHUA 1NGDA 1QQNA 3FZKA 3R2VA 2NRBA 3DLXA 3GDQA 2GMOA 5AQIA 5F0XA 1OOYA 2YIOA 5AQRA 2AHVA 1NGAA 2QWRA 1NGHA 2LN8A 5AQPA 1S3XA 2QWNA 3RRLB 3LDLA 5F1XA 3LDOA 3D2FA 3FZMA 3CQXA 3LDQA 2OASA 1NGGA 5AQGA 3LDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ0 A;  2AHW A;  2AHU A;  1XR4 A;  3CDK B;  3K6M A;  5DBN B;  3DLX A;  2NRB A;  3OXO A;  1OOY A;  2AHV A;  5DBN A;  3CDK A;  1K6D A;  1POI B;  3EH7 A;  1OPE A;  3QDQ A;  1O9L A;  3RRL B;  1M3E A;  1POI A;  2OAS A;  3RRL A;  2NRC A;  3D3U A;  1OOZ A;  3GK7 A;  4KGB A; 
#chains in the Genus database with same CATH topology
 2E88 A;  5EVZ A;  2QWO A;  3CDK B;  2KJA A;  3L56 A;  1C56 A;  5AQO A;  1DJT A;  1NE5 A;  5FPE A;  3ATV A;  1VNB A;  4CQK A;  3QI7 A;  1QQM A;  2VY6 A;  2BRZ A;  2LY6 A;  3KOX A;  3CW4 A;  2N2Q A;  2AHW A;  1SEG A;  5AQU A;  3GL1 A;  5AQL A;  2NY8 X;  1T7E A;  1GPT A;  1NGI A;  2KSK A;  3D2E B;  3L6Q A;  1NH5 A;  2BUP A;  4AAZ A;  1POI A;  1ZVG A;  3SF4 D;  3FZH A;  5AQM A;  1FH3 A;  3KVG A;  2YEO A;  5AQQ A;  5EY4 A;  2YBR C;  2M8B B;  2NY9 X;  4H5R A;  1L4V A;  4GNI A;  5FPM A;  2KHO A;  4H5N A;  2QWM A;  2NRB A;  5AQR A;  2QWR A;  1SNB A;  1NGH A;  1T7B A;  2QWN A;  1P0A A;  1T0Z A;  1ICA A;  1T1T A;  1DQ7 A;  1NGE A;  5AQW A;  3FZL A;  3KOY A;  2K35 A;  3KP0 A;  1BCG A;  5DBN A;  3ATU A;  1POI B;  2LI7 A;  1BRZ A;  3QML A;  5AQH A;  2QWL A;  4V1D C;  5BPN A;  1BA0 A;  1WMT A;  4H5T A;  3RRL A;  4UAE F;  3K6M A;  1HJO A;  2KBH A;  2KGQ A;  2E3G A;  1PTX A;  5CY0 A;  1GPS A;  3L4I A;  2LT8 A;  1PX9 A;  3E7U X;  2LJ7 A;  5AQS A;  3FZF A;  5AQY A;  2YIL A;  1KAY A;  2HJ0 A;  1ZYW A;  1ATR A;  2N66 A;  1XR4 A;  1TI5 A;  5FPD A;  1ZUT A;  1MR4 A;  1LQH A;  5F2R A;  1NGF A;  2GL1 A;  3QFP A;  5AQJ A;  1B7D A;  1C55 A;  1NGJ A;  3BK3 C;  4UAD E;  3D3U A;  1I2V A;  2ATB A;  4KBO A;  2LR3 A;  4HHF A;  1WT7 A;  3R2V A;  3DLX A;  3GDQ A;  2GMO A;  5AQI A;  3RRL B;  3LDL A;  2LY5 A;  3FZM A;  3CQX A;  4KYP A;  1NGG A;  3KP1 A;  1PE4 A;  3LDP A;  1N4N A;  1ZVE A;  2QW9 A;  2KBK A;  3JXU A;  4UAF E;  1HPM A;  4HE7 A;  1ZFU A;  4AB0 A;  1T7A A;  2N69 A;  1DKG D;  3QDQ A;  1SN1 A;  1KAX A;  2KBJ A;  1I2U A;  2QXL A;  5AQN A;  1I6F A;  2E0H A;  1CN2 A;  3IUC A;  5EX5 A;  3HSC A;  1NGB A;  1ATS A;  2N2R A;  2A7T A;  1OPE A;  5BPM A;  4IO8 A;  3KOZ A;  1UGL A;  2MBK A;  5AQK A;  3KOW A;  5AQZ A;  3C7N A;  1NPI A;  3A8Y A;  2B3C A;  1JKZ A;  1P00 A;  1LQI A;  1SN4 A;  1O9L A;  1KV0 A;  1XRS B;  3LDN A;  4H5V A;  1OZZ A;  1JZA A;  1VNA A;  1ZYV A;  5AQT A;  4KGB A;  3KHW A;  2QWP A;  1BK8 A;  1ZU3 A;  1YUW A;  5AR0 A;  1NGD A;  3FZK A;  2YIO A;  2LN8 A;  1S3X A;  1BMR A;  2KPY A;  3LDO A;  3D2F A;  5F1X A;  1JZB A;  2B68 A;  2OAS A;  3GKU A;  1BA1 A;  2QWQ A;  2JDQ D;  2MN5 A;  3QFU A;  5AQX A;  5DBN B;  3OXO A;  2LKB A;  1K6D A;  2YC1 C;  5BN8 A;  3I33 A;  5BPL A;  4H5W A;  2LJM A;  3C7N B;  1QQO A;  3PSM A;  5FPN A;  1KAZ A;  2G2K A;  5EXW A;  3AY9 A;  3CDK A;  2V7Z A;  2I61 A;  5AQF A;  4HWI A;  1I6G A;  5BN9 A;  3FE1 A;  1NRA A;  1NGC A;  1CHZ A;  3M3Z A;  1JXC A;  2KYQ A;  1OOZ A;  3GK7 A;  1NRB A;  1WWN A;  3KC6 A;  3D2F B;  2MZ0 A;  2E2F A;  2YIP A;  3EH7 A;  2SN3 A;  2D56 A;  1M3E A;  2ASC A;  3D2E A;  5KK4 A;  1B3C A;  2NRC A;  1HX1 A;  1OMY A;  1LQQ A;  1AHO A;  1BUP A;  3E7R L;  2E8A A;  1K8B A;  4FSV A;  5AQV A;  2AHU A;  4FL9 A;  1QQN A;  5F0X A;  1OOY A;  4UJ0 A;  2AHV A;  1NGA A;  5AQP A;  1AYJ A;  4AEI A;  2E3F A;  3LDQ A;  1MYN A;  5AQG A; 
#chains in the Genus database with same CATH homology
 2E88 A;  1BA1 A;  2QW9 A;  1NGE A;  5EVZ A;  5AQW A;  2QWQ A;  3FZL A;  2QWO A;  2JDQ D;  3JXU A;  2MN5 A;  3QFU A;  4UAF E;  5AQX A;  3CDK B;  1HPM A;  5DBN B;  3OXO A;  2K35 A;  3L56 A;  5AQO A;  5DBN A;  3ATU A;  5FPE A;  3ATV A;  1DKG D;  1K6D A;  1POI B;  3QDQ A;  3QI7 A;  3QML A;  1KAX A;  3I33 A;  5BN8 A;  5AQH A;  2QWL A;  5BPL A;  4H5W A;  1QQM A;  2VY6 A;  5BPN A;  1BA0 A;  3RRL A;  4H5T A;  2QXL A;  3C7N B;  4UAE F;  3K6M A;  1QQO A;  5AQN A;  1HJO A;  3CW4 A;  5FPN A;  2AHW A;  1KAZ A;  5AQU A;  3L4I A;  3GL1 A;  3IUC A;  5EX5 A;  3HSC A;  1NGB A;  5AQL A;  5EXW A;  3AY9 A;  3CDK A;  1ATS A;  2V7Z A;  5AQF A;  4HWI A;  1NGI A;  5BPM A;  1OPE A;  3D2E B;  4IO8 A;  3L6Q A;  5BN9 A;  3FE1 A;  2BUP A;  5AQS A;  2MBK A;  5AQK A;  1POI A;  1NGC A;  3M3Z A;  3FZF A;  3SF4 D;  5AQY A;  5AQZ A;  1OOZ A;  3FZH A;  5AQM A;  3GK7 A;  2YIL A;  1KAY A;  2HJ0 A;  1ATR A;  3C7N A;  3KC6 A;  1XR4 A;  3A8Y A;  3KVG A;  5FPD A;  5AQQ A;  3D2F B;  5F2R A;  5EY4 A;  2E2F A;  1NGF A;  2YIP A;  3EH7 A;  1O9L A;  4H5R A;  2D56 A;  3LDN A;  1M3E A;  4H5V A;  4GNI A;  3QFP A;  5AQJ A;  3D2E A;  5FPM A;  2NRC A;  1NGJ A;  3BK3 C;  2KHO A;  4UAD E;  3D3U A;  5AQT A;  1HX1 A;  4KGB A;  3KHW A;  4H5N A;  2QWP A;  1BUP A;  2QWM A;  4KBO A;  2E8A A;  4FSV A;  5AQV A;  1YUW A;  4FL9 A;  5AR0 A;  2AHU A;  1NGD A;  1QQN A;  3FZK A;  3R2V A;  2NRB A;  3DLX A;  3GDQ A;  2GMO A;  5AQI A;  5F0X A;  1OOY A;  2YIO A;  5AQR A;  2AHV A;  1NGA A;  2QWR A;  1NGH A;  2LN8 A;  5AQP A;  1S3X A;  2QWN A;  3RRL B;  3LDL A;  5F1X A;  3LDO A;  3D2F A;  3FZM A;  3CQX A;  3LDQ A;  2OAS A;  1NGG A;  5AQG A;  3LDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...