1POIA

Crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
317
structure length
317
Chain Sequence
SKVMTLKDAIAKYVHSGDHIALGGFTTDRKPYAAVFEILRQGITDLTGLGGAAGGDWDMLIGNGRVKAYINCYTANSGVTNVSRRFRKWFEAGKLTMEDYSQDVIYMMWHAAALGLPFLPVTLMQGSGLTDEWGISKEVRKTLDKVPDDKFKYIDNPFKPGEKVVAVPVPQVDVAIIHAQQASPDGTVRIWGGKFQDVDIAEAAKYTIVTCEEIISDEEIRRDPTKNDIPGMCVDAVVLAPYGAHPSQCYGLYDYDNPFLKVYDKVSKTQEDFDAFCKEWVFDLKDHDEYLNKLGATRLINLKVVPGLGYHIDMTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTACONATE COENZYME A-TRANSFERASE
publication title Glutaconate CoA-transferase from Acidaminococcus fermentans: the crystal structure reveals homology with other CoA-transferases.
pubmed doi rcsb
source organism Acidaminococcus fermentans
molecule tags Transferase
total genus 119
structure length 317
sequence length 317
chains with identical sequence C
ec nomenclature ec 2.8.3.12: Glutaconate CoA-transferase.
pdb deposition date 1997-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01144 CoA_trans Coenzyme A transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.30.40 Alpha Beta 2-Layer Sandwich Defensin A-like Defensin A-like 1poiA02
3.40.1080.10 Alpha Beta 3-Layer(aba) Sandwich Glutaconate Coenzyme A-transferase Glutaconate Coenzyme A-transferase 1poiA01
3GK7A 2AHVA 1M3EA 1OPEA 2AHWA 1OOYA 1POIA 1K6DA 3RRLA 2NRCA 3OXOA 1OOZA 1POIB 3RRLB 1XR4A 3D3UA 3EH7A 5DBNA 3QDQA 4KGBA 3DLXA 3CDKA 5DBNB 1O9LA 2AHUA 3K6MA 2OASA 2HJ0A 3CDKB 2NRBA
chains in the Genus database with same CATH superfamily
5FPEA 4UJ0A 3FZHA 1ZYWA 2N2RA 2QW9A 4H5WA 1JZBA 1C56A 2A7TA 1NGDA 1WWNA 2QWRA 1BA1A 2YC1C 1B7DA 3KVGA 4V1DC 2V7ZA 2AHVA 1T7AA 1M3EA 4H5TA 5KK4A 1NGHA 1I6GA 1MYNA 1AYJA 1SN1A 2OASA 1VNBA 1NGEA 1L4VA 2NY8X 3FE1A 1OPEA 2AHWA 3QI7A 3KC6A 1NGGA 1C55A 1NE5A 2MBKA 3LDNA 2N2QA 2KYQA 5AQQA 3EH7A 4H5VA 1GPSA 1JZAA 5AQLA 2B3CA 1NH5A 2QWQA 1HJOA 5CY0A 2NRBA 4HE7A 5AQPA 1SEGA 5AQRA 2ASCA 4GNIA 3IUCA 1NRBA 1ZVGA 1I2UA 1OOYA 2KBHA 2NRCA 3KOXA 1ZU3A 4FSVA 4AAZA 2YIPA 1OMYA 1N4NA 1SN4A 2QWNA 2QXLA 3DLXA 1T0ZA 3CW4A 3I33A 2M8BB 1NGJA 1BK8A 1QQNA 1JKZA 2KBJA 1VNAA 4AB0A 5F2RA 5AQIA 1CN2A 2LN8A 3CDKA 3CDKB 2KGQA 3ATUA 1WMTA 1BMRA 3GL1A 1HX1A 4CQKA 1NGIA 1DQ7A 2KHOA 5AQGA 4KYPA 3BK3C 1I2VA 5AQWA 3D2FA 2G2KA 1OZZA 2D56A 3KOZA 4UADE 3D2FB 1T7EA 1BCGA 3LDPA 1DJTA 5AQYA 3RRLA 3OXOA 1KAZA 2LR3A 4H5NA 3RRLB 3E7RL 1S3XA 2ATBA 2I61A 3GDQA 5AQTA 2KBKA 1GPTA 2JDQD 5AQHA 1LQIA 1I6FA 2KPYA 1BUPA 2HJ0A 5EXWA 5AQZA 3KOWA 2K35A 1QQOA 1K6DA 5EY4A 3L4IA 5AQSA 1SNBA 2LKBA 5AQJA 4KGBA 1DKGD 3KP0A 1NRAA 2E3FA 1B3CA 1PE4A 1WT7A 4KBOA 1KAXA 1ATRA 3GK7A 2QWLA 1YUWA 3LDLA 3L56A 2SN3A 2MZ0A 2E3GA 5F0XA 2E88A 5FPMA 2GL1A 4AEIA 1JXCA 1NGCA 5FPNA 1LQHA 2YBRC 2VY6A 1PTXA 5BN9A 5F1XA 2LY6A 1ATSA 1T7BA 5DBNA 5BPNA 5BN8A 3CQXA 2YIOA 5EVZA 1NGBA 2LY5A 1XRSB 1K8BA 4HHFA 3E7UX 1ZYVA 2BUPA 3FZFA 1ICAA 1MR4A 1OOZA 3KOYA 2B68A 5EX5A 5AQVA 3QDQA 3HSCA 5AR0A 3QMLA 3C7NA 3GKUA 1UGLA 2MN5A 1ZUTA 2E0HA 2N69A 1P00A 3C7NB 5AQFA 2BRZA 4HWIA 1KAYA 3LDQA 3ATVA 2LJMA 3M3ZA 1BA0A 1NPIA 2LI7A 4IO8A 1ZVEA 1P0AA 1POIA 1NGFA 1LQQA 1POIB 2NY9X 3QFPA 2KJAA 3FZLA 1HPMA 5BPMA 4UAFE 1QQMA 5AQMA 5AQOA 2QWOA 3FZKA 3KP1A 5AQUA 5FPDA 1XR4A 3D3UA 2KSKA 3L6QA 3D2EA 3R2VA 3D2EB 3K6MA 2QWMA 1TI5A 2YEOA 5BPLA 2LT8A 1CHZA 3KHWA 5AQKA 4H5RA 3PSMA 3A8YA 1AHOA 3SF4D 1FH3A 5DBNB 2GMOA 1O9LA 1KV0A 1BRZA 2YILA 1NGAA 2N66A 1T1TA 1ZFUA 3JXUA 1PX9A 5AQNA 2LJ7A 5AQXA 3AY9A 2QWPA 3LDOA 2E2FA 3FZMA 3QFUA 2E8AA 2AHUA 4UAEF 4FL9A
chains in the Genus database with same CATH topology
5FPEA 1KAXA 1ATRA 1QQNA 3GK7A 2QWLA 1YUWA 3FZHA 4IO8A 2QW9A 1POIA 1NGFA 4H5WA 3LDLA 3L56A 1POIB 1NGDA 2QWRA 1BA1A 5F2RA 5AQIA 5F0XA 2LN8A 3QFPA 3FZLA 3KVGA 3CDKA 2E88A 1HPMA 5FPMA 5BPMA 4UAFE 3CDKB 1QQMA 2V7ZA 5AQMA 5AQOA 3ATUA 2AHVA 1NGCA 1M3EA 2QWOA 5FPNA 2VY6A 4H5TA 3FZKA 5FPDA 5AQUA 5BN9A 1NGHA 3GL1A 5F1XA 1HX1A 1ATSA 1NGIA 1XR4A 3D3UA 5DBNA 3L6QA 2KHOA 5AQGA 5BPNA 3D2EA 3CQXA 5BN8A 2YIOA 3R2VA 5EVZA 1NGBA 3BK3C 3D2EB 3K6MA 2OASA 5AQWA 2QWMA 3D2FA 5BPLA 1NGEA 2D56A 4UADE 3D2FB 3KHWA 3FE1A 4H5RA 3LDPA 2BUPA 5AQKA 1OPEA 2AHWA 3FZFA 5AQYA 3QI7A 3RRLA 3KC6A 3OXOA 1NGGA 2MBKA 1OOZA 1KAZA 3A8YA 4H5NA 3LDNA 5EX5A 3RRLB 5AQQA 1S3XA 5AQVA 3EH7A 4H5VA 3SF4D 3GDQA 3QDQA 5AQTA 5AQLA 2QWQA 3HSCA 2JDQD 5AQHA 5AR0A 2GMOA 1O9LA 5DBNB 3QMLA 1BUPA 1HJOA 2HJ0A 2NRBA 5EXWA 5AQZA 5AQPA 3C7NA 2YILA 2MN5A 1NGAA 2K35A 5AQRA 1QQOA 3C7NB 4GNIA 5AQFA 3IUCA 4HWIA 1KAYA 1OOYA 1K6DA 2NRCA 5EY4A 3JXUA 4FSVA 3L4IA 2YIPA 3LDQA 5AQNA 5AQSA 3ATVA 5AQJA 5AQXA 4KGBA 2QWNA 1DKGD 2QWPA 3AY9A 3LDOA 2QXLA 3DLXA 3M3ZA 2E2FA 3FZMA 1BA0A 3CW4A 3I33A 3QFUA 2E8AA 2AHUA 4UAEF 4KBOA 1NGJA 4FL9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GK7 A;  2AHV A;  1M3E A;  1OPE A;  2AHW A;  1OOY A;  1POI A;  1K6D A;  3RRL A;  2NRC A;  3OXO A;  1OOZ A;  1POI B;  3RRL B;  1XR4 A;  3D3U A;  3EH7 A;  5DBN A;  3QDQ A;  4KGB A;  3DLX A;  3CDK A;  5DBN B;  1O9L A;  2AHU A;  3K6M A;  2OAS A;  2HJ0 A;  3CDK B;  2NRB A; 
#chains in the Genus database with same CATH topology
 5FPE A;  4UJ0 A;  3FZH A;  1ZYW A;  2N2R A;  2QW9 A;  4H5W A;  1JZB A;  1C56 A;  2A7T A;  1NGD A;  1WWN A;  2QWR A;  1BA1 A;  2YC1 C;  1B7D A;  3KVG A;  4V1D C;  2V7Z A;  2AHV A;  1T7A A;  1M3E A;  4H5T A;  5KK4 A;  1NGH A;  1I6G A;  1MYN A;  1AYJ A;  1SN1 A;  2OAS A;  1VNB A;  1NGE A;  1L4V A;  2NY8 X;  3FE1 A;  1OPE A;  2AHW A;  3QI7 A;  3KC6 A;  1NGG A;  1C55 A;  1NE5 A;  2MBK A;  3LDN A;  2N2Q A;  2KYQ A;  5AQQ A;  3EH7 A;  4H5V A;  1GPS A;  1JZA A;  5AQL A;  2B3C A;  1NH5 A;  2QWQ A;  1HJO A;  5CY0 A;  2NRB A;  4HE7 A;  5AQP A;  1SEG A;  5AQR A;  2ASC A;  4GNI A;  3IUC A;  1NRB A;  1ZVG A;  1I2U A;  1OOY A;  2KBH A;  2NRC A;  3KOX A;  1ZU3 A;  4FSV A;  4AAZ A;  2YIP A;  1OMY A;  1N4N A;  1SN4 A;  2QWN A;  2QXL A;  3DLX A;  1T0Z A;  3CW4 A;  3I33 A;  2M8B B;  1NGJ A;  1BK8 A;  1QQN A;  1JKZ A;  2KBJ A;  1VNA A;  4AB0 A;  5F2R A;  5AQI A;  1CN2 A;  2LN8 A;  3CDK A;  3CDK B;  2KGQ A;  3ATU A;  1WMT A;  1BMR A;  3GL1 A;  1HX1 A;  4CQK A;  1NGI A;  1DQ7 A;  2KHO A;  5AQG A;  4KYP A;  3BK3 C;  1I2V A;  5AQW A;  3D2F A;  2G2K A;  1OZZ A;  2D56 A;  3KOZ A;  4UAD E;  3D2F B;  1T7E A;  1BCG A;  3LDP A;  1DJT A;  5AQY A;  3RRL A;  3OXO A;  1KAZ A;  2LR3 A;  4H5N A;  3RRL B;  3E7R L;  1S3X A;  2ATB A;  2I61 A;  3GDQ A;  5AQT A;  2KBK A;  1GPT A;  2JDQ D;  5AQH A;  1LQI A;  1I6F A;  2KPY A;  1BUP A;  2HJ0 A;  5EXW A;  5AQZ A;  3KOW A;  2K35 A;  1QQO A;  1K6D A;  5EY4 A;  3L4I A;  5AQS A;  1SNB A;  2LKB A;  5AQJ A;  4KGB A;  1DKG D;  3KP0 A;  1NRA A;  2E3F A;  1B3C A;  1PE4 A;  1WT7 A;  4KBO A;  1KAX A;  1ATR A;  3GK7 A;  2QWL A;  1YUW A;  3LDL A;  3L56 A;  2SN3 A;  2MZ0 A;  2E3G A;  5F0X A;  2E88 A;  5FPM A;  2GL1 A;  4AEI A;  1JXC A;  1NGC A;  5FPN A;  1LQH A;  2YBR C;  2VY6 A;  1PTX A;  5BN9 A;  5F1X A;  2LY6 A;  1ATS A;  1T7B A;  5DBN A;  5BPN A;  5BN8 A;  3CQX A;  2YIO A;  5EVZ A;  1NGB A;  2LY5 A;  1XRS B;  1K8B A;  4HHF A;  3E7U X;  1ZYV A;  2BUP A;  3FZF A;  1ICA A;  1MR4 A;  1OOZ A;  3KOY A;  2B68 A;  5EX5 A;  5AQV A;  3QDQ A;  3HSC A;  5AR0 A;  3QML A;  3C7N A;  3GKU A;  1UGL A;  2MN5 A;  1ZUT A;  2E0H A;  2N69 A;  1P00 A;  3C7N B;  5AQF A;  2BRZ A;  4HWI A;  1KAY A;  3LDQ A;  3ATV A;  2LJM A;  3M3Z A;  1BA0 A;  1NPI A;  2LI7 A;  4IO8 A;  1ZVE A;  1P0A A;  1POI A;  1NGF A;  1LQQ A;  1POI B;  2NY9 X;  3QFP A;  2KJA A;  3FZL A;  1HPM A;  5BPM A;  4UAF E;  1QQM A;  5AQM A;  5AQO A;  2QWO A;  3FZK A;  3KP1 A;  5AQU A;  5FPD A;  1XR4 A;  3D3U A;  2KSK A;  3L6Q A;  3D2E A;  3R2V A;  3D2E B;  3K6M A;  2QWM A;  1TI5 A;  2YEO A;  5BPL A;  2LT8 A;  1CHZ A;  3KHW A;  5AQK A;  4H5R A;  3PSM A;  3A8Y A;  1AHO A;  3SF4 D;  1FH3 A;  5DBN B;  2GMO A;  1O9L A;  1KV0 A;  1BRZ A;  2YIL A;  1NGA A;  2N66 A;  1T1T A;  1ZFU A;  3JXU A;  1PX9 A;  5AQN A;  2LJ7 A;  5AQX A;  3AY9 A;  2QWP A;  3LDO A;  2E2F A;  3FZM A;  3QFU A;  2E8A A;  2AHU A;  4UAE F;  4FL9 A; 
#chains in the Genus database with same CATH homology
 5FPE A;  1KAX A;  1ATR A;  1QQN A;  3GK7 A;  2QWL A;  1YUW A;  3FZH A;  4IO8 A;  2QW9 A;  1POI A;  1NGF A;  4H5W A;  3LDL A;  3L56 A;  1POI B;  1NGD A;  2QWR A;  1BA1 A;  5F2R A;  5AQI A;  5F0X A;  2LN8 A;  3QFP A;  3FZL A;  3KVG A;  3CDK A;  2E88 A;  1HPM A;  5FPM A;  5BPM A;  4UAF E;  3CDK B;  1QQM A;  2V7Z A;  5AQM A;  5AQO A;  3ATU A;  2AHV A;  1NGC A;  1M3E A;  2QWO A;  5FPN A;  2VY6 A;  4H5T A;  3FZK A;  5FPD A;  5AQU A;  5BN9 A;  1NGH A;  3GL1 A;  5F1X A;  1HX1 A;  1ATS A;  1NGI A;  1XR4 A;  3D3U A;  5DBN A;  3L6Q A;  2KHO A;  5AQG A;  5BPN A;  3D2E A;  3CQX A;  5BN8 A;  2YIO A;  3R2V A;  5EVZ A;  1NGB A;  3BK3 C;  3D2E B;  3K6M A;  2OAS A;  5AQW A;  2QWM A;  3D2F A;  5BPL A;  1NGE A;  2D56 A;  4UAD E;  3D2F B;  3KHW A;  3FE1 A;  4H5R A;  3LDP A;  2BUP A;  5AQK A;  1OPE A;  2AHW A;  3FZF A;  5AQY A;  3QI7 A;  3RRL A;  3KC6 A;  3OXO A;  1NGG A;  2MBK A;  1OOZ A;  1KAZ A;  3A8Y A;  4H5N A;  3LDN A;  5EX5 A;  3RRL B;  5AQQ A;  1S3X A;  5AQV A;  3EH7 A;  4H5V A;  3SF4 D;  3GDQ A;  3QDQ A;  5AQT A;  5AQL A;  2QWQ A;  3HSC A;  2JDQ D;  5AQH A;  5AR0 A;  2GMO A;  1O9L A;  5DBN B;  3QML A;  1BUP A;  1HJO A;  2HJ0 A;  2NRB A;  5EXW A;  5AQZ A;  5AQP A;  3C7N A;  2YIL A;  2MN5 A;  1NGA A;  2K35 A;  5AQR A;  1QQO A;  3C7N B;  4GNI A;  5AQF A;  3IUC A;  4HWI A;  1KAY A;  1OOY A;  1K6D A;  2NRC A;  5EY4 A;  3JXU A;  4FSV A;  3L4I A;  2YIP A;  3LDQ A;  5AQN A;  5AQS A;  3ATV A;  5AQJ A;  5AQX A;  4KGB A;  2QWN A;  1DKG D;  2QWP A;  3AY9 A;  3LDO A;  2QXL A;  3DLX A;  3M3Z A;  2E2F A;  3FZM A;  1BA0 A;  3CW4 A;  3I33 A;  3QFU A;  2E8A A;  2AHU A;  4UAE F;  4KBO A;  1NGJ A;  4FL9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...