The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
28
|
sequence length |
115
|
structure length |
115
|
Chain Sequence |
GISAANYAASNIEPNSVGRCAEYVRKAIEWGGISLQRTRSAKDYGPSLLAAGFHEAIGSPMKGDVIVIQPAPGHPHGHMAIYDGSHWISDFKQLHGFYPGPAYRSAKPAYKTYRY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural insights into the inhibition of type VI effector Tae3 by its immunity protein Tai3
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Ralstonia pickettii
|
molecule keywords |
Putative cytoplasmic protein
|
total genus |
28
|
structure length |
115
|
sequence length |
115
|
chains with identical sequence |
D
|
ec nomenclature | |
pdb deposition date | 2012-11-15 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | endopeptidase fold (from Nostoc punctiforme) | endopeptidase domain like (from Nostoc punctiforme) |
#chains in the Genus database with same CATH superfamily 3O98 A; 3A2Y A; 4HPE A; 3H41 A; 2IOA A; 3GT2 A; 4F0V A; 2IOB A; 3VPJ A; 2VPS A; 2HBW A; 4FQA A; 2LRJ A; 2K3A A; 3S0Q A; 4EOB A; 4OLK A; 4FQB A; 4JXB A; 4CSH A; 3PBI A; 2K1G A; 2IO9 A; 3PBC A; 4FGE A; 2IO8 A; 4CT3 A; 4EQ8 A; 3NE0 A; 4F0W A; 4R0K A; 3VPI A; 4FGI A; 2VOB A; 4FGD A; 3A2Z A; 3I86 A; 3M1U A; 4Q4T A; 4F4M A; 4HZB A; 4FDY A; 3NPF A; 4LJ1 A; 3PVQ A; 2XIV A; 3A30 A; 4Q4N A; 4EQA A; 4CGK A; 2IO7 A; 2EVR A; 4HZ9 A; 3KW0 A; 2IF6 A; 4Q4G X; 2VPM A; 2FG0 A; #chains in the Genus database with same CATH topology 3O98 A; 4J32 A; 3A2Y A; 4HPE A; 3H41 A; 4HFK A; 4J30 A; 2IOA A; 3GT2 A; 4F0V A; 2IOB A; 3VPJ A; 2VPS A; 2HBW A; 4FQA A; 2LRJ A; 2K3A A; 4JUR A; 3S0Q A; 4EOB A; 4OLK A; 4FQB A; 4JXB A; 4CSH A; 3PBI A; 2K1G A; 2IO9 A; 3PBC A; 4FGE A; 2IO8 A; 4HFL A; 4CT3 A; 4EQ8 A; 3NE0 A; 4F0W A; 4R0K A; 3VPI A; 4FGI A; 2VOB A; 4FGD A; 3A2Z A; 3I86 A; 3M1U A; 4Q4T A; 4F4M A; 4HZB A; 4FDY A; 3NPF A; 4LJ1 A; 2WP7 A; 3PVQ A; 2XIV A; 3A30 A; 4Q4N A; 4EQA A; 4CGK A; 2IO7 A; 2EVR A; 4HZ9 A; 3KW0 A; 4HFF A; 2IF6 A; 4Q4G X; 2VPM A; 3EBQ A; 2FG0 A; #chains in the Genus database with same CATH homology 3O98 A; 3A2Y A; 4HPE A; 3H41 A; 2IOA A; 3GT2 A; 4F0V A; 2IOB A; 3VPJ A; 2VPS A; 2HBW A; 4FQA A; 2LRJ A; 2K3A A; 3S0Q A; 4EOB A; 4OLK A; 4FQB A; 4JXB A; 4CSH A; 3PBI A; 2K1G A; 2IO9 A; 3PBC A; 4FGE A; 2IO8 A; 4CT3 A; 4EQ8 A; 3NE0 A; 4F0W A; 4R0K A; 3VPI A; 4FGI A; 2VOB A; 4FGD A; 3A2Z A; 3I86 A; 3M1U A; 4Q4T A; 4F4M A; 4HZB A; 4FDY A; 3NPF A; 4LJ1 A; 3PVQ A; 2XIV A; 3A30 A; 4Q4N A; 4EQA A; 4CGK A; 2IO7 A; 2EVR A; 4HZ9 A; 3KW0 A; 2IF6 A; 4Q4G X; 2VPM A; 2FG0 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...