2HBWA

Crystal structure of a putative endopeptidase (ava_3396) from anabaena variabilis atcc 29413 at 1.05 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
GEYQCLAALNLYDSPECTSLATQAAVGRHLQVTSNQQGAAVEVCLCEDDYPGWLSLGDLGLLKPATVLYQAKSFSESEIKKLLPGAIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFVSVGIWLPRDAYQQEAFTQAITIDELAPGDLVFFGTPVKATHVGLYLGDGCYIHSSGKAQGRDGIGIDILSEQGDVVSRSYYQQLRGAGRVVKSYKPQRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords NLP/P60 protein
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Anabaena variabilis
total genus 66
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2hbwA01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2hbwA02
1RLQC 4AFQC 3UA7A 1SSHA 1G83A 1SRLA 1WX6A 1U06A 2HBWA 4CC4B 2J7IA 1K1ZA 1TUDA 4RTYA 2P4RA 2GTOA 2LJ3A 2KYMA 2RQTA 2IOAA 2G6FX 3EG0A 1W1FA 4D8DA 3VS0A 1FYNA 4LUDA 2EVRA 1JQQA 1WXUA 4RTTA 2OJ2A 1QLYA 4E6RA 1X6BA 1WIEA 1YNZA 4JPBW 1W70A 2KRNA 2FPEA 3VPIA 1UDLA 3M0PA 3QWYA 3VS3A 2J05A 5ECAA 2CUDA 2DBMA 1YWPA 4WCIA 2DL4A 2KT1A 5GJVB 4AFSC 3H0HA 1QKXA 1AD5A 4RTVA 1UTIA 1M3CA 2RQWA 2ESWA 2M51A 3M0UA 2J6KA 2VPMA 2RPNA 2A28A 2IO9A 1K0SA 2M0YA 2CREA 3A2YA 4AFZC 1W6XA 4LNPA 4JZ3A 2LJ0A 1UG1A 2EYZA 4IIOA 3EG2A 1ZUYA 2DVJA 2JS2A 3H41A 1WXBA 5IHKA 2EQIA 2K3AA 3S0QA 5I11A 1X2QA 4HVUA 3M1UA 2L3QA 2LX7A 2KGTA 2YUPA 1GCQC 3O98A 1AWJA 3M0TA 1S1NA 1CSKA 2JMAA 4J9EA 3VS4A 2VVKA 1NG2A 2DL8A 3ULRB 2LP5A 1KFZA 2LMJA 1BBZA 2IOBA 4LUEA 2KNBB 2K3BA 3RBBB 2J06A 3U23A 2IO7A 2LZ6B 2KXDA 2EBPA 2GTJA 3PVQA 1UE9A 2BZYA 2V1QA 1GBQA 1NYGA 2D8JA 2DILA 2GNCA 1YN8A 2C0TA 4J9BA 3VRYA 4OMPA 1SHFA 2JMCA 4FQBA 2D8HA 4A63B 4AG2C 4QT7A 1X43A 3NMZC 1PHTA 2YUNA 2C0OA 3EHQA 5I22A 1OPLA 2LQNA 1IO6A 1OEBA 1JO8A 2ROTA 1ABQA 2FG0A 4LJ1A 1NEBA 2DF6A 2IO8A 1M3BA 2DRMA 3VS5A 3VS7A 2L3PA 3CQTA 2X3WD 4J9HA 4F4MA 2JW4A 1ZSGA 1BU1A 4Z8AA 4ESRA 2K1GA 4Q4GX 1E6GA 1X27A 2DBKA 1AWWA 4AG1C 4F16A 3A98A 2F2VA 4HZ9A 2ROLA 4Q4NA 2W10A 1QCFA 3M0RA 1UFFA 3JV3A 1Z9ZA 4Y92A 2KYBA 2PZ1A 1KJWA 1RUWA 2EPDA 2NUZA 4LN2A 4FSSA 1K0XA 2EW3A 2RNAA 4EOBA 2AZSA 4FGDA 1MV0B 1MUZA 2EYYA 3TSWA 2RN8A 2LRJA 1X6GA 4CGKA 2ED1A 3I9QA 1N5ZA 2K6DA 2SEMA 3EG3A 3QWXX 3KW0A 5GJWB 4HCKA 2D0NA 2FPFA 1PRLC 4FQAA 4OMLA 1KIKA 2PNIA 1E7OA 2JT4A 5IXBA 1QWFA 1FMKA 2K2MA 4JJDA 4Q4TA 4CC7A 1PWTA 3A2ZA 2KXCA 1AEYA 4OMMA 4HPEA 2EGEA 2J6FA 2ECZA 2CT4A 1HJDA 1LCKA 2A37A 1NYFA 3GT2A 2L2PA 3PBIA 4F0VA 3SEMA 1JU5C 2L0AA 1NLOC 4CC2A 1VYUA 1UGVA 1UUEA 2CSQA 1VYTA 1UJYA 1AWOA 3NPFA 2J6OA 1GCPA 2DRKA 2RQRA 4F14A 1U5SA 1ARKA 3LH5A 1M30A 2ED0A 1PKTA 3REAB 1AVZC 3M0SA 1T3SA 3VS1A 4CC3A 2D1XA 2EGAA 1X69A 4OLKA 2E5KA 2IIMA 1NLPC 3IQLA 4JJBA 2AKKA 2JM9A 1M27C 2FO0A 4Z88A 2A36A 2RQVA 2SRCA 4OMQA 1U3OA 1PRMC 2AZVA 2RQUA 4J9FA 3I35A 1I1JA 2O88A 3FJ5A 4EQ8A 1ZBJA 2AKLA 2VWFA 2YUOA 3KFVA 5L23A 3VPJA 1WA7A 4J9IA 1SHGA 1YWOA 3GBQA 5FWCA 2L3SA 2MCNA 4AFUC 1ZUKA 2X3XD 1SEMA 1T0JA 4OMOA 2YSQA 4X1VA 1TG0A 2F2XA 3UATA 2DL7A 1AOJA 4EIKA 2DJQA 1YP5A 4FDYA 1V1CA 2K79A 5IH2A 1WLPB 2JM8A 1I07A 1YCSB 3R6NA 3O5ZA 1JEGA 1CKBA 1T0HA 5EC7A 1AWXA 4GLMA 2XIVA 1E6HA 1UECA 2DYBA 3M0QA 1WDXA 4J9DA 2FPDA 4Z89A 2HSPA 1RI9A 1M8MA 1Z9QA 4F0WA 2FEIA 4RTZA 3H0IA 3VS2A 2MIOA 2HDAA 2VKNA 4RTXA 3NHNA 4FGEA 2OI3A 1VYVA 1MV3A 1UJ0A 1WXTA 4HXJA 4HZBA 2O9VA 4M4ZA 4DEXA 4J9CA 2DL5A 1I0CA 1EFNA 3RNJA 3ZL7C 1M3AA 2KT8A 3C0CA 1TUCA 2C0IA 1UHCA 3TSZA 2JXBA 4RTUA 2JTEA 3NE0A 2AK5A 2PTKA 2VPSA 1WI7A 1OPKA 1GCQA 2YUQA 1K9AA 2DA9A 1NM7A 4JXBA 3VS6A 1VA7A 2DE0X 3NGPA 1X2KA 3PVLA 2DNUA 2A08A 1SPKA 3SHWA 2KR3A 1K76A 1AZEA 2DMOA 4FGIA 2F2WA 2KRSA 2DX1A 2NWMA 1GBRA 2YT6A 2CT3A 4HVVA 3THKA 1BB9A 1ZLMA 5IHIA 2KBTA 2LQWA 1WFWA 3EG1A 1T3LA 2KE9A 2LJ1A 2BTTA 5HCKA 1H8KA 3A30A 2K9GA 5IXFA 3I5SA 1QKWA 2EYXA 4ORZA 1CKAA 3EHRA 1B3QA 2JS0A 5FW9A 4LE9A 5IHNA 1G2BA 2LCSA 1WYXA 2CDTA 1HD3A 4CSHA 2I0NA 1SRMA 1PNJA 1GFCA 4JJCA 4J9GA 1H3HA 2LNHB 2ENMA 3PBCA 1KSWA 1ZUUA 2H8HA 2BZXA 4ZNXA 2FRWA 3I5RA 3I86A 1K4US 2O9SA 1A0NB 4K11A 4D8KA 3VRZA 2FRYA 1HSQA 2CSIA 3PE0A 2O2OA 2RMOA 2DL3A 4HVWA 2QDLA 2EGCA 2BZ8A 2GQIA 1AZGB 2EYWA 4RUGA 4F17A 2YDLA 2GBQA 2O31A 4CT3A 4R0KA 2VOBA 3H0FA 1JXOA 4OMNA 4KRTA 4EQAA 3UA6A 1GRIA 1Y0MA 2OAWA 2XMFA 1H92A 4IIMA 2HEQA 2KEAA 4GBQA 5FWBA 2EKHA 1RLPC 2CH4A 2CH4W 1NEGA 2ABLA 1B07A 2DLPA 1UHFA 3TVTA 2IF6A 1XOVA 1OOTA 1OV3A 1QWEA 2HCKA 2KROA 4JZ4A 3UF4A 1J3TA 2CUBA 4DEYA 3REBB 1BK2A 1ZX6A 2RF0A 2B86A 2V1RA 2W0ZA 2MOXA 2KRMA 2K7AA 1PKSA 2DM1A 1GL5A 1ABOA 1JXMA 1Y57A 3EGUA 4RTWA 2GGRA 1GFDA
chains in the Genus database with same CATH superfamily
2NYSA 5CKDA 5IAYA 1EZZB 1SRLA 3CCMT 1U06A 4CC4B 4RTYA 3V8KA 2G6FX 3EG0A 4HFKA 1YJWQ 2PUOB 3J80E 4FM4B 1WXUA 2LQ8A 2BUDA 1VQ7T 2JTMA 1ZBXA 2DERA 4F04B 1YNZA 4JPBW 2COYA 4Y91A 2KRNA 3VPIA 2FPEA 3E2UA 1K9MR 3VS3A 2J05A 1QVGS 5ECAA 4PLLA 2NUTB 1UEBA 1AD5A 3OS0A 4M75B 5I21A 1D1CA 2A28A 2FZCB 1KD1U 2IO9A 3CCJQ 4PLIA 2CREA 3HKSA 3A2YA 1Q82U 2M0OA 4JZ3A 4C0GA 3CC7A 2QK0A 3H41A 2FB7A 4BI8B 4JURA 2K3AA 3S0QA 4HVUA 3M1UA 3N5BB 2L3QA 2KGTA 4ZGEB 1GCQC 3O98A 1VQ8Q 3M0TA 1S1NA 4PFPA 2Z0WA 2RK2A 5A0GA 5KYWB 3I55A 2DL8A 2HQHA 1Y7XA 3MO8A 2LMJA 1VQNT 1BBZA 1QP3A 3VYGA 3CCEQ 2IOBA 2KNBB 3LYIA 4LXCA 2BE9B 3INZA 3M5AA 2WSCE 4A4GA 1ZHIA 1JJ2S 5L8RE 1FMWA 1R0BG 1ZSZC 1GBQA 1NYGA 2NUTA 2D8JA 2C0TA 4PJOB 5LJ5d 4M75G 4OMPA 4M75A 3LW5E 3C95A 4HA8A 4FYXB 1Y07A 2X4XA 2JJ9A 2YUNA 2DO3A 4QKUA 1IO6A 3RKYA 2YRDA 2ROTA 3VKIA 2A7YA 4JRPA 3VS5A 3CCVT 2E1HA 2X3WD 2L8DA 2QQRA 4Z8AA 5C6SA 2QA4Q 4Q4GX 1C0MA 2DEUA 1AWWA 1FXXA 3M55A 3V7CA 1K73U 2K2VA 2W10A 1UFFA 1VQ4A 3JV3A 3JCMh 1Z9ZA 3G1JA 4EMKC 2NUZA 1KD1R 3EFOB 4LN2A 4PJOG 2LVMA 2JOYA 4BY6B 4FSSA 1Q82R 3G71A 4PJOA 1K0XA 2EW3A 2RNAA 1VQ6A 3ER0A 1R77A 3FIFA 4CGKA 4BE2A 3DLMA 2NUPB 5FRMA 4HCKA 4B9XA 8AT1B 4FQAA 4RG2A 4OB3B 4NL3A 5GMKj 2PNIA 1VQPQ 1IGQA 1E7OA 5KE2A 2K2MA 1XQHA 3H9NA 1N8RR 1WPYA 2KXCA 3LLRA 4J32A 2EWNA 1M1KC 1QVFS 1LOJA 4J7FA 3TQ7P 1V76A 2ECZA 2DZCA 1V29B 2R5AA 3AT1B 3G4SA 5AYFA 1JU5C 2L0AA 3EFOA 3MP6A 3EGDB 1UGVA 1X6OA 1VYTA 3EG9B 5LJ5e 1AWOA 1DJ7B 2J6OA 1YI2Q 5FU6B 1M30A 1D1BA 1PKTA 2X35A 4M77C 3M0SA 3VS1A 5FROA 2D1XA 2NUPA 3FB9A 1O9SA 2IIMA 1NLPC 1NJIU 4EMKB 2XICA 5CCAA 4J6XA 4Z88A 2KVQG 4F7UF 2AT1B 3RERA 1SKUB 1K73R 2P84A 3DB4A 3P8DA 5HY6A 1LPLA 2RQUA 3ZBDA 1OI1A 3I35A 1KK7A 5FU7B 3WVDB 2E12A 1ZBJA 2AKLA 2CZ7B 2H3JA 2VWFA 1SF9A 3KFVA 2DTHA 2HD0A 2VB6A 4HCZA 2MCNA 3EGDA 4E7ZA 3NTKA 3M54A 3LGLA 3EG9A 5KYUB 1K8AU 5KYNA 1TG0A 2WSFE 4A53A 4HCCA 2MMPA 2XDDA 1K9MC 3A8OB 2HNIA 4E7IA 2RJDA 5IH2A 3CMAA 5GMKe 3CC7T 4EMKA 2EQJA 1VIFA 3X20B 1I07A 1YCSB 3R6NA 4XK8E 3EH1A 4BD3A 1VQLA 1BI1A 1QW1A 2E10A 5EC7A 3I55T 2XIVA 3M4GA 4M78B 1WDXA 4J9DA 3FDRA 4C8QE 1G3SA 4LDVA 2QEXA 3J81E 3CCUQ 1MHNA 4Z89A 1N9SA 2BKDN 4XQ3A 2ZPBB 1VOMA 4F0WA 5KYXB 2FEIA 2YXYA 4FYVB 5A0LA 4Z02A 2X4JA 1PSEA 3CPWS 1MV3A 1NJIR 4M75D 1UJ0A 3M56A 4NOYA 2QGGA 2DYIA 1XNIA 4DEXA 3GF5A 3VYHB 1YIJA 2RA2A 2P0PA 2X9HA 3C0CA 2G3RA 5CKFA 4QVZA 5M9OA 4M78G 2VPSA 3OSVA 1PC0A 3M53A 4L59A 4M77A 4M78A 4Y28E 3JCMb 1EIFA 1X01A 3JCMJ 4M7AF 3C4SA 2DA9A 1NM7A 3SB2A 3VS6A 3EH2A 2QQSA 1X2KA 3GOXA 5DLQE 1W2BA 5GAMg 1MNEA 2A08A 3MKDA 4QQGA 3SHWA 5GAMf 2KR3A 3G71T 2DMOA 4MDWA 4PJOD 2KRSA 2DX1A 3HL8A 3QJYA 3META 3PMTA 4HVVA 3THKA 1BB9A 1I81A 3OS2A 2LQWA 1WFWA 3VUZA 1T3LA 2LJ1A 2BTTA 3LH0A 1S72T 2CYZB 5HCKA 3RIRA 1H641 1Q7YR 2K9GA 3TU4K 3I5SA 1IHVA 1QKWA 1Q95G 3CD6A 5LJ5h 3EHRA 5GMKm 1B3QA 4PKCC 1G2BA 2CDTA 1YHQQ 4JJCA 1H3HA 3L42A 2WP7A 4J30A 2K57A 1BI0A 4FYWB 4JDSA 4ZNXA 4DBQA 2FRWA 2V8IA 4X9DA 4L5GA 1K4US 2YRVA 4M7AC 3G4ST 4K11A 2DD5A 2FRYA 3PE0A 2RI2A 2M16A 4HVWA 4BDZA 2EGCA 2BZ8A 3JB9H 1AZGB 4MZTA 4F17A 5LJ3g 2DXCA 2O31A 1Q86C 4JJNK 5LJ3f 2HL5C 1N8RC 2Y90A 5GAOq 3ZFJA 1GRIA 2OAWA 4ME7A 5GANg 1QCOA 2HEQA 5GANf 5I2MA 1N9RA 5J3BA 4HT9A 3HPWA 1UGSB 2O4XB 1QVPA 3TVTA 2IF6A 2LC4A 3S6WA 2KROA 2HCKA 3EFSA 4JZ4A 2QQBA 3Q1JA 1BK2A 5GMKh 2MOXA 1W2BP 3G6EA 4KH0B 1WQ7A 2CZ6B 1TSFA 1RLQC 4AFQC 3UA7A 4NL2A 1M1KU 1IHWA 1H3ZA 4OB0B 3CCMQ 1K1ZA 1WJRA 1O75A 2P4RA 2KYMA 2RQTA 2IOAA 1JB0E 5DM7R 3GNFB 3A5ZB 3CBMA 2OTLA 4A4HA 2RK1A 2LT4A 4XTYA 1RAAB 1QLYA 4ZTJA 5IN1A 4PJLA 1VQ7Q 4C0ZA 1IXDA 3M58A 5CQXA 3CMAT 1WIEA 2RHIA 1MMAA 3OYBA 1UDLA 3M0PA 4XU2A 2O4XA 4C92G 4RKUE 4CRIA 1YWPA 3OYGA 2DL4A 4BI3A 1VQ9T 1QKXA 3QHSA 4DQ2A 2HZYA 1ZA2B 2RQWA 4PJMA 5GAN4 2J6KA 2VPMA 2QEXT 2CP2A 2M0YA 3A8LB 3OYLA 4AFZC 1W6XA 3JCMP 4JRIA 4LNPA 2EYZA 3NTIA 4IIOA 2R57A 5LJ3d 1KHIA 2JS2A 3H6ZA 1WXBA 2EQIA 4PL6A 1X2QA 3GPLA 2LX7A 9ATCB 4OMFB 1M2VA 1CSKA 1IREB 4J9EA 2DVEA 5D6WA 3M4YA 1YITA 2XDPA 1VQNQ 2DEQA 2LQKA 3TCJA 4A54A 2OTJA 3RBBB 2HKQB 3A1PA 1K9MU 1YIJT 3OMCA 2IO7A 3LWHA 3AHUA 1RAHB 1UE9A 1QVGA 1RADB 5A2QE 2RJFA 5HKCA 4M7DB 3CCSA 1PD0A 1SHFA 1D3BA 4A63B 4M78D 4AG2C 3MPUB 4FT4A 4E7HA 1PHTA 2C0OA 3JB9F 4KH1B 3FLGA 5GAMe 2F5TX 1ABQA 4XTWA 1NEBA 2E4HA 1M3BA 1YJWA 3CCVQ 5GAOr 3HRUA 3V8JA 3A8GB 2EAYA 2E3IA 5CQYA 2H3EB 4ESRA 1E6GA 1X27A 2VXEA 4DBFA 3A98A 2F2VA 3L2RA 3CD6T 4HZ9A 4LD9K 3M0RA 3CXCS 4IUTA 4QQ6A 2KYBA 1JJ2A 2EPDA 2O01E 3CMET 4M7DG 6AT1B 2M02A 1VQOT 4M7DA 2K5IA 3CCJA 1Q7YC 1MV0B 1MUZA 2EYYA 4II1A 3TSWA 1X6GA 2DXTA 3X26B 3A8HB 2ED1A 2K6DA 2NLUA 2SEMA 5LJ3e 4OF1A 3JRZA 1VQ8A 2FPFA 1PRLC 5C0MA 1ACMB 2OX7A 2EJ9A 5GANe 4N4GA 5IXBA 2MI6A 3A2ZA 3QKJA 4IURA 4BI4A 1QVGP 3OQ5A 2EGEA 3RDVA 2J6FA 1IGUA 3CCQA 1HJDA 1MNDA 3RESA 3L1AA 1NYFA 3GT2A 2L2PA 3PBIA 5DLOA 3SEMA 1G3YA 4CC2A 3FC3A 2CSQA 2LX9A 1N27A 2CS7A 1UJYA 3CEYA 3OSSC 4PFOA 4EDUA 3G6ET 4C8QB 2DRKA 2RQRA 1ARKA 3LH5A 2VV5A 3HRTA 4CI0C 2RO0A 1AVZC 1Q81U 1T3SA 3HFNA 3JCMV 2E5KA 3SDZA 5GAN3 3IQLA 3KUFA 2AKKA 3EBQA 4IUVA 5GAOm 2FO0A 2DIGA 1YCYA 2A36A 5GAOp 3QDRB 1U3OA 1PRMC 2QA4A 3QZ5B 4J9FA 1Q86U 1N8RU 4EQ8A 1N6AA 4FL6A 1JJ2P 3PTAA 4IKFA 1RABB 1YWOA 1QVFA 1OYXA 3QSUA 2A3LA 2OAUA 2K3YA 2FZGB 4HFLA 5LJ5j 4AFUC 4C92D 1TU0B 1SEMA 2M1HA 4OMOA 2B8AA 4M7AE 4X1VA 2JNGA 4MZPA 4C8QA 2PQWA 1I4K1 2QXFA 2RB6A 3UATA 2DL7A 1AOJA 1XJWB 1OU8A 1YP5A 2QDYB 1V1CA 3CC7Q 1WLPB 2EQMA 4KUIA 1YJ9A 1VQPA 3O5ZA 4GLKA 3V8LA 2ZPEB 3SFMA 4GY5A 5GAMh 2RHUA 1T0HA 4O5VA 3I55Q 3UWNA 2DYBA 4MMKA 4E47A 2LRQA 2V8JA 3C12A 2HSPA 3S3OA 3CCLT 4QW2A 2KDSA 1Q81R 3CBPA 2VKNA 2K5FA 2MWPA 3CCST 4FGEA 2DTIA 1VYVA 2I2LA 1ZSZB 1WXTA 1B7TA 5KYYB 1Q86R 3OBYA 1I0CA 1EFNA 4EMGA 1PG5B 2RI5A 2F69A 3LX7A 2KT8A 2EQKA 1TUCA 2C0IA 3TSZA 4X34A 4RTUA 3OW2A 3NE0A 1QVFP 1HYOA 1RL2A 5LJ3h 1WI7A 1GCQA 4O6JA 3QIIA 5GAN8 3QO3A 5GANh 2VUBA 2DE0X 3NGPA 4J8OA 2DNUA 3QYHB 4DBRA 4XU1A 1PSFA 1AZEA 3G71Q 4FGIA 2MAMA 1Y96B 3L2UA 2RHZA 2YWWA 4M7DD 2PVOB 2CT3A 1ZSZA 2EQUA 4DOVA 3HTRA 5IHIA 2L3RA 2KBTA 2E3HA 5KCHA 2CGHA 3CPWA 2KE9A 1TUGB 1S72Q 5IXFA 3H8ZA 1LNXA 5CKBA 5KYYA 3QZ9B 3X24B 2EYXA 4PJJA 1NBEB 4DBHA 1HXDA 1WHMA 5D6XA 5GAN5 1VQ8T 3PNWC 1WYXA 2MWOA 1ZA1B 1HD3A 4Q5WA 4CSHA 2I0NA 1U1TA 1SRMA 3QYGB 2LNVA 5LL6S 1M2OA 2HMAA 3VU3C 1D09B 1KSWA 2L89A 4XTZA 5A0DA 4E7KA 4YTLA 3CCQT 2BE7D 3R6OA 1A0NB 3G4SQ 1FX7A 2CSIA 5KH6A 2RMOA 3CC4Q 2EYWA 4RUGA 1Y96A 3PT9A 1OX9A 2KY9A 2YDLA 2EFIA 3C94A 5HK0A 3JCMW 3TEEA 4OMNA 1BCOA 1Q7YU 3UA6A 2VC8A 4IIMA 2COWA 2K3XA 4A4EA 1YJNA 4HT8A 3TREA 2EKHA 3OW2P 2CH4A 1BI2A 2HQXA 4M77B 3CCRA 4A4FA 1B34B 3OB9A 4MMLA 3UDCA 3E19A 3OYCA 3UF4A 1J3TA 1G3TA 2E41A 3P8BB 2JZ2A 4M75E 2RF0A 4OGCA 2KRMA 2K7AA 2LTOA 2DM1A 4JUVA 1XTDA 1ABOA 1U8RA 3EGUA 4RTWA 2DZ9A 1SSHA 1G83A 4JS4A 1VQ5A 1WX6A 1BIBA 2GTOA 2LJ3A 3CPWP 2QTXA 2EYQA 2FZKB 1BKBA 4N0AC 2V8KA 4OGEA 1M8VA 4C92F 4RTTA 3PIPA 4E6RA 4JRQA 2X4WA 2XU8A 4C0DC 3MEVA 1X6BA 3OS5A 3CMAQ 4M77G 1YHQA 1W70A 1YJ9T 3QWYA 1KC8R 1B34A 2DBMA 4WCIA 1WHJA 1VQ4T 2IG0A 1VQ9Q 2ZGWA 4RTVA 2VYTA 1M3CA 3KXTA 2ZPGB 2M51A 4F7UB 3M0UA 3A8MB 2RPNA 5KCOA 2GGRA 1VQ6T 1K0SA 2YLBA 4OP0A 1JBMA 4B9WA 2XDBA 2LJ0A 1UG1A 1PCXA 3GLXA 3NTHA 2ZZDA 3HFOA 2HQEA 1I5OB 3OA6A 3DKMA 5IHKA 3G7ZA 3OS1A 1BYMA 2PU9B 4OB1B 3ZEHA 3GNGA 1AWJA 1VQMA 4C92C 4EMHA 3VS4A 2VVKA 2KI7A 3ULRB 3BFMA 3QBYA 3JAME 1C6VX 2HL3A 2K3BA 3VJPA 2J06A 1AT1B 3U23A 1YIJQ 2LZ6B 2KXDA 3UPUA 2EBPA 2GTJA 1Q81C 3PVQA 3OYIA 2V1QA 2DILA 1YN8A 2KMTA 4MZMA 2GFUA 3VRYA 2QGFB 4PNOA 4F7UG 4FQBA 4F7UA 2D8HA 3JSCA 1BCMA 2M9UA 1WJQA 3JB9I 3EHQA 2KAFA 1UB4A 1OEBA 3MHXA 1JO8A 4PJNA 3JCMX 4LJ1A 3HP9A 2DF6A 2AHJB 2DRMA 2KK4A 2GCXA 2MK5A 2L3PA 2JW4A 2JUFA 1BU1A 4MDXA 4AG1C 3SWNC 2ROLA 3CD6Q 4Q4NA 1NPPA 3RKXA 1VQKA 4BUGA 4R55A 1KJWA 4UC4A 3X25B 3V7RA 1WHKA 2DD4A 4KULA 3CMEQ 1VQOQ 1RACB 2VGMA 1M4ZA 4FGDA 3I56A 5GAMj 2RN8A 2LRJA 2HSEB 1M2VB 2E5QA 1TWBA 2JN0A 3MP1A 4ZGJB 3ASKA 3JCMd 4M7AB 4EPCA 5KE3A 4C5IA 3LGFA 3JCMQ 5FLXE 1KIKA 1RI0A 1OU9A 2VGNA 2CZ1B 4N4IA 3RUXA 4ZN3A 1VQLT 1QWFA 4WF2A 1FMKA 2D9TA 4JJDA 2QYZA 4Q4TA 4RCBA 1PWTA 1YJNT 2XD0A 1TS9A 3EGXB 4OMMA 3HSBA 1M1FA 3CCRT 1D3BB 1LCKA 2A37A 4F0VA 1KQSS 1HK9A 1VYUA 3CPFA 2P0KA 1UUEA 2CP5A 4LDUA 2QI2A 4E7LA 1PM3A 4BE0A 3NPFA 4C5HA 1GCPA 3G6EQ 4F14A 3UT1A 2ED0A 2CZ0B 3REAB 5LJ3j 4CC3A 3F70A 4ATOA 1VQ5T 1X69A 4OLKA 2XK0A 3CCVA 4BB7A 2MPXC 4M7AG 1ZQ1A 4M7AA 2JM9A 5AT1B 1M27C 5GANj 3T9NA 2RQVA 4QQDA 1OX8A 2SRCA 4M75F 4V2SA 2E70A 1I1JA 1SSFA 4FYYB 4M78E 3CC2A 3FJ5A 2KQWA 4XTXA 2MYSA 3EGXA 4LD6A 2YUOA 5L23A 2MF2A 3WXMB 1LJOA 1D0ZA 3GBQA 4M77D 1M90C 3MEUA 1R0CB 1WNLA 5CR2A 5FWCA 3OYAA 7AT1B 3FRNA 1T0JA 4QVCA 1YBYA 2DKGA 2XG8D 4XAXB 2EJFA 4EIKA 3S3MA 1KC8C 4ZTFA 1UGQB 2K79A 4PJOF 1TOVA 1JEGA 4IUPA 4J6YA 4M75C 3E9FA 4WTOB 1VQMT 1AWXA 4GLMA 4ELZC 1OZ3A 3OMGA 1E6HA 1OZ2A 2FPDA 2QTVA 2K5LA 4FW1A 4E2FB 2QG9B 4KBMB 4XTUA 3CCLQ 1RI9A 2F5KA 2JVVA 1Z9QA 4FU6A 3H0IA 3VS2A 2HDAA 4RTXA 3CCSQ 3NHNA 3L2QA 2OI3A 2GQVA 4HXJA 3OYMA 4HKEA 2O9VA 4M4ZA 4IUQA 3CCEA 4AT1B 4J9CA 1EX4A 5GAOn 4PJOC 3DLLA 5GMKl 1R8OB 2JTFA 3FJPA 2ZPHB 1MMDA 2HBPA 2AK5A 4C5EA 1BIAA 3V7SA 2DJZA 3GIBA 3OYDA 1VQKT 1K9AA 2CP0A 3BY7A 1VA7A 2WACA 4JLIA 4QVDA 3PVLA 4OB2B 4BDYA 2KSSA 1K76A 2DXUA 2F2WA 3CBOA 1GBRA 3I56T 3JB9J 1MGQA 3EG1A 2OTLT 1WHLA 1WQWA 3A30A 4BACA 3S3NA 1IZ6A 3D7SB 1CKAA 5FW9A 4A4KA 4BY6C 4PFZA 5IHNA 4C92E 2DPPB 2LCSA 2RHYA 5CKHA 4J9GA 2LNHB 1WHGA 2P0QA 4FSXA 2FVUA 1ZUUA 3MEWA 2DIQA 2CP7A 2E65A 1I8FA 3OY9A 2EJGA 4C8QG 3CCQQ 1YFNA 3OYNA 2QDLA 2QASA 1MMGA 1UGRB 5FRNA 4ELYC 3GP8A 2LCCA 3O8VA 4CT3A 3E1SA 4R0KA 2VOBA 3QJ6A 3QG1A 5GMKi 4KRTA 3NFCA 1QCNA 5FWBA 1YITT 1RLPC 3OYHA 3JB9G 2OTJT 2CH4W 1NEGA 2DFUA 4M7AD 8ATCB 1UHFA 5KYWA 5CO7A 3OYFA 1D0XA 1OOTA 1OV3A 1QWEA 5FU6C 3CC2T 2CUBA 4DEYA 3REBB 1I5LA 2B86A 2V1RA 1IB8A 1RAGB 3RKWA 1PKSA 1GL5A 1YI2A 4EOBA 1GFDA 4J6WA 1X75C 3L2WA 2HBWA 4RMOA 2J7IA 1TUDA 3QXEB 5FU7C 2BIVA 1D1AA 4M77F 4M78F 1W1FA 5GAN2 4D8DA 1S72A 3VS0A 1FYNA 1YJWT 4LUDA 4OVAA 4FIBA 2EVRA 2CKKA 1JQQA 1TH7A 2OJ2A 1QMCA 4LDWA 4PK4A 1YJ9Q 4J7IA 2WSEE 2CUDA 2KT1A 5GJVB 4AFSC 1VQ4Q 1UGPB 3H0HA 4M7DE 1MMNA 1U1SA 1UTIA 1C1AA 2ESWA 3CCJT 1VQ6Q 4XU3A 3CC4A 2FL7A 4P5NA 1TTHB 1WJSA 3EG2A 1ZUYA 2DVJA 1M90U 5I11A 4M78C 2YUPA 2JMAA 5DY9A 2ZPIB 1NG2A 2LP5A 2LDMA 2PVGB 1KFZA 3CCET 4LUEA 3OYYA 1KHCA 3CCUA 1KC8U 4J5YA 2DETA 3L2VA 2BZYA 5CK9A 4RCCA 2GNCA 4J83A 4J9BA 5HK3A 2JMCA 1QP2A 4QT7A 1X43A 3NMZC 4ANJA 4TVRA 2RHXA 5I22A 4X9CA 1OPLA 1VUBA 2LQNA 2FG0A 2IPOB 3MEAA 4KT0E 2IO8A 5CIUA 3EFRA 3VS7A 4JS5A 4NS5A 4DA4A 3RR6A 3CQTA 4J9HA 5CAIA 4F4MA 1ZSGA 4FT2A 2PUKB 4LDXA 2K1GA 2QA4T 1Y71A 3E9GA 2DBKA 2K4YA 4F16A 5CVIA 2YLCA 1G8XA 2FYKA 3OW2S 2DTOA 3QPHA 1QCFA 1QQJA 1NE8A 2EIFA 4Y92A 1VQ9A 3URGA 2PZ1A 2YRCA 1RUWA 4AMCA 1NZ9A 2YHTA 2EKOA 4L6V5 2L5QA 2AZSA 3MJXA 4XU0A 3BDLA 1M90R 3M9QA 2RM4A 2RJEA 5KYUA 4C8QD 3I9QA 4FW2A 2E6NA 1N5ZA 3QWXX 4R56A 3KW0A 3P8HA 5GJWB 2F1LA 2D0NA 4OMLA 2GFAA 3DB3A 3OYEA 3VUBA 1VQPT 2JT4A 1VQLQ 4JLGA 2DK3A 5GAOl 4CC7A 4PJOE 1AHJB 2Y4XA 1YJNQ 1AEYA 4HPEA 4C0FA 3L2ZA 3PFSA 2CT4A 3CCRQ 5J26A 2QEXQ 3M59A 1RAFB 3VV0A 3JB9D 1NLOC 3QUIA 2XI9A 2XKOC 3BE3A 2XHCA 4KUDK 1K8AR 2CP3A 4E7SA 1G3WA 1YI2T 1U5SA 2RH2A 4KGXB 2CP6A 5KYXA 3JCMg 3JCMf 2EGAA 1IRXA 1VQ5Q 2E6ZA 2IVWA 2LCLA 1PD1A 4ZN1A 4JJBA 3HRSA 1KQ2A 3FEOA 2VXFA 2R5MA 4OMQA 1BI3A 4IUUA 4DOWA 4HFFA 2GF7A 2AZVA 2O88A 1NPRA 1KD1C 4JRKA 1WGSA 1Q82C 2HKNA 4N4HA 4FCYA 3VPJA 1WA7A 4J9IA 1SHGA 2VASA 4C0DB 3CMEA 3CCMA 1VQOA 4RG8A 2L3SA 1ZUKA 2X3XD 1KQSA 2QQAA 2YSQA 4LDYA 4C5GA 1G5VA 2F2XA 1JRIA 3ME9A 1WZOA 2RJCA 3CC4T 2DJQA 2A0FB 3JCMc 4FDYA 1VQ7A 2JM8A 4M7DF 4ZGDB 3OYJA 1OQKA 1CKBA 5CKEA 1VQMQ 4N0AA 1UECA 3M0QA 5D6YA 3CCUT 4C92B 1VIEA 2X51A 2ZAEA 2AIRB 1W2BS 2RD1A 1M8MA 5IT9E 2DXBA 4RTZA 2ZPFB 2MIOA 2XIDA 3OBWA 4B6MA 1KG1A 2P4TA 5GAMd 4BE1A 1RAEB 4HZBA 3EAEA 2D0QB 1K73C 1VQNA 3BW1A 2D6FA 2DL5A 3WVEB 3RNJA 3ZL7C 1M3AA 3RMSA 1SG5A 4M7DC 1WHHA 1UHCA 1W4SA 2JXBA 2JTEA 2QAZA 1M9SA 5GAN6 3CXCA 2PTKA 2V26A 1OPKA 3SD4A 3RMQA 2ATCB 4C92A 1KQSP 2YUQA 1VQKQ 4XTVA 2LT1A 4JXBA 4HCBA 3SWNB 4KGVB 1SPKA 3PGGA 3MCAB 1KQ1A 2RI3A 2E64A 2COZA 2C06A 2NWMA 2YT6A 3I56Q 1ZLMA 3PIOA 1GXIE 1OULA 3OYKA 2OTLQ 1H8KA 1RAIB 3PMIA 1D0YA 1M1GA 4M77E 2X4YA 4KGZB 4ORZA 5D7UA 2JS0A 4LE9A 5GANd 2R58A 1FMVA 1YHQT 4C8QF 1PNJA 1GFCA 2ENMA 4VUBA 5EG2A 3PBCA 3HHTB 3QDFA 2H8HA 2BZXA 4E7JA 3CCLA 3I5RA 3I86A 1TXQA 2O9SA 2DAQA 2Y4YA 4D6WA 1NJIC 4D8KA 3VRZA 1HSQA 1M1KR 2O2OA 3SWNA 2DL3A 5GAN7 3LWIA 2GQIA 1P92A 3X28B 1F1BB 3KBGA 2GBQA 2ZCFB 3BDUA 3JCMe 5J39A 2FHDA 3H0FA 1FWZA 1JXOA 2QQ9A 4EQAA 1Y0MA 2XMFA 1H92A 3J7AF 3MP8A 2KEAA 4GBQA 1YITQ 3CXCP 2OTJQ 2ABLA 1B07A 1LVKA 2DLPA 5I2SA 1K8AC 4C8QC 3M57A 1XOVA 3CC2Q 4F7UE 1ZX6A 2PVDB 2W0ZA 5LJ5g 1JXMA 1Y57A 1M5Q1 2HAXA 3EG3A 5LJ5f
chains in the Genus database with same CATH topology
1RLQC 4AFQC 3UA7A 1SSHA 1G83A 1SRLA 1WX6A 1U06A 2HBWA 4CC4B 2J7IA 1K1ZA 1TUDA 4RTYA 2P4RA 2GTOA 2LJ3A 2KYMA 2RQTA 2IOAA 2G6FX 3EG0A 1W1FA 4D8DA 3VS0A 1FYNA 4LUDA 2EVRA 1JQQA 1WXUA 4RTTA 2OJ2A 1QLYA 4E6RA 1X6BA 1WIEA 1YNZA 4JPBW 1W70A 2KRNA 2FPEA 3VPIA 1UDLA 3M0PA 3QWYA 3VS3A 2J05A 5ECAA 2CUDA 2DBMA 1YWPA 4WCIA 2DL4A 2KT1A 5GJVB 4AFSC 3H0HA 1QKXA 1AD5A 4RTVA 1UTIA 1M3CA 2RQWA 2ESWA 2M51A 3M0UA 2J6KA 2VPMA 2RPNA 2A28A 2IO9A 1K0SA 2M0YA 2CREA 3A2YA 4AFZC 1W6XA 4LNPA 4JZ3A 2LJ0A 1UG1A 2EYZA 4IIOA 3EG2A 1ZUYA 2DVJA 2JS2A 3H41A 1WXBA 5IHKA 2EQIA 2K3AA 3S0QA 5I11A 1X2QA 4HVUA 3M1UA 2L3QA 2LX7A 2KGTA 2YUPA 1GCQC 3O98A 1AWJA 3M0TA 1S1NA 1CSKA 2JMAA 4J9EA 3VS4A 2VVKA 1NG2A 2DL8A 3ULRB 2LP5A 1KFZA 2LMJA 1BBZA 2IOBA 4LUEA 2KNBB 2K3BA 3RBBB 2J06A 3U23A 2IO7A 2LZ6B 2KXDA 2EBPA 2GTJA 3PVQA 1UE9A 2BZYA 2V1QA 1GBQA 1NYGA 2D8JA 2DILA 2GNCA 1YN8A 2C0TA 4J9BA 3VRYA 4OMPA 1SHFA 2JMCA 4FQBA 2D8HA 4A63B 4AG2C 4QT7A 1X43A 3NMZC 1PHTA 2YUNA 2C0OA 3EHQA 5I22A 1OPLA 2LQNA 1IO6A 1OEBA 1JO8A 2ROTA 1ABQA 2FG0A 4LJ1A 1NEBA 2DF6A 2IO8A 1M3BA 2DRMA 3VS5A 3VS7A 2L3PA 3CQTA 2X3WD 4J9HA 4F4MA 2JW4A 1ZSGA 1BU1A 4Z8AA 4ESRA 2K1GA 4Q4GX 1E6GA 1X27A 2DBKA 1AWWA 4AG1C 4F16A 3A98A 2F2VA 4HZ9A 2ROLA 4Q4NA 2W10A 1QCFA 3M0RA 1UFFA 3JV3A 1Z9ZA 4Y92A 2KYBA 2PZ1A 1KJWA 1RUWA 2EPDA 2NUZA 4LN2A 4FSSA 1K0XA 2EW3A 2RNAA 4EOBA 2AZSA 4FGDA 1MV0B 1MUZA 2EYYA 3TSWA 2RN8A 2LRJA 1X6GA 4CGKA 2ED1A 3I9QA 1N5ZA 2K6DA 2SEMA 3EG3A 3QWXX 3KW0A 5GJWB 4HCKA 2D0NA 2FPFA 1PRLC 4FQAA 4OMLA 1KIKA 2PNIA 1E7OA 2JT4A 5IXBA 1QWFA 1FMKA 2K2MA 4JJDA 4Q4TA 4CC7A 1PWTA 3A2ZA 2KXCA 1AEYA 4OMMA 4HPEA 2EGEA 2J6FA 2ECZA 2CT4A 1HJDA 1LCKA 2A37A 1NYFA 3GT2A 2L2PA 3PBIA 4F0VA 3SEMA 1JU5C 2L0AA 1NLOC 4CC2A 1VYUA 1UGVA 1UUEA 2CSQA 1VYTA 1UJYA 1AWOA 3NPFA 2J6OA 1GCPA 2DRKA 2RQRA 4F14A 1U5SA 1ARKA 3LH5A 1M30A 2ED0A 1PKTA 3REAB 1AVZC 3M0SA 1T3SA 3VS1A 4CC3A 2D1XA 2EGAA 1X69A 4OLKA 2E5KA 2IIMA 1NLPC 3IQLA 4JJBA 2AKKA 2JM9A 1M27C 2FO0A 4Z88A 2A36A 2RQVA 2SRCA 4OMQA 1U3OA 1PRMC 2AZVA 2RQUA 4J9FA 3I35A 1I1JA 2O88A 3FJ5A 4EQ8A 1ZBJA 2AKLA 2VWFA 2YUOA 3KFVA 5L23A 3VPJA 1WA7A 4J9IA 1SHGA 1YWOA 3GBQA 5FWCA 2L3SA 2MCNA 4AFUC 1ZUKA 2X3XD 1SEMA 1T0JA 4OMOA 2YSQA 4X1VA 1TG0A 2F2XA 3UATA 2DL7A 1AOJA 4EIKA 2DJQA 1YP5A 4FDYA 1V1CA 2K79A 5IH2A 1WLPB 2JM8A 1I07A 1YCSB 3R6NA 3O5ZA 1JEGA 1CKBA 1T0HA 5EC7A 1AWXA 4GLMA 2XIVA 1E6HA 1UECA 2DYBA 3M0QA 1WDXA 4J9DA 2FPDA 4Z89A 2HSPA 1RI9A 1M8MA 1Z9QA 4F0WA 2FEIA 4RTZA 3H0IA 3VS2A 2MIOA 2HDAA 2VKNA 4RTXA 3NHNA 4FGEA 2OI3A 1VYVA 1MV3A 1UJ0A 1WXTA 4HXJA 4HZBA 2O9VA 4M4ZA 4DEXA 4J9CA 2DL5A 1I0CA 1EFNA 3RNJA 3ZL7C 1M3AA 2KT8A 3C0CA 1TUCA 2C0IA 1UHCA 3TSZA 2JXBA 4RTUA 2JTEA 3NE0A 2AK5A 2PTKA 2VPSA 1WI7A 1OPKA 1GCQA 2YUQA 1K9AA 2DA9A 1NM7A 4JXBA 3VS6A 1VA7A 2DE0X 3NGPA 1X2KA 3PVLA 2DNUA 2A08A 1SPKA 3SHWA 2KR3A 1K76A 1AZEA 2DMOA 4FGIA 2F2WA 2KRSA 2DX1A 2NWMA 1GBRA 2YT6A 2CT3A 4HVVA 3THKA 1BB9A 1ZLMA 5IHIA 2KBTA 2LQWA 1WFWA 3EG1A 1T3LA 2KE9A 2LJ1A 2BTTA 5HCKA 1H8KA 3A30A 2K9GA 5IXFA 3I5SA 1QKWA 2EYXA 4ORZA 1CKAA 3EHRA 1B3QA 2JS0A 5FW9A 4LE9A 5IHNA 1G2BA 2LCSA 1WYXA 2CDTA 1HD3A 4CSHA 2I0NA 1SRMA 1PNJA 1GFCA 4JJCA 4J9GA 1H3HA 2LNHB 2ENMA 3PBCA 1KSWA 1ZUUA 2H8HA 2BZXA 4ZNXA 2FRWA 3I5RA 3I86A 1K4US 2O9SA 1A0NB 4K11A 4D8KA 3VRZA 2FRYA 1HSQA 2CSIA 3PE0A 2O2OA 2RMOA 2DL3A 4HVWA 2QDLA 2EGCA 2BZ8A 2GQIA 1AZGB 2EYWA 4RUGA 4F17A 2YDLA 2GBQA 2O31A 4CT3A 4R0KA 2VOBA 3H0FA 1JXOA 4OMNA 4KRTA 4EQAA 3UA6A 1GRIA 1Y0MA 2OAWA 2XMFA 1H92A 4IIMA 2HEQA 2KEAA 4GBQA 5FWBA 2EKHA 1RLPC 2CH4A 2CH4W 1NEGA 2ABLA 1B07A 2DLPA 1UHFA 3TVTA 2IF6A 1XOVA 1OOTA 1OV3A 1QWEA 2HCKA 2KROA 4JZ4A 3UF4A 1J3TA 2CUBA 4DEYA 3REBB 1BK2A 1ZX6A 2RF0A 2B86A 2V1RA 2W0ZA 2MOXA 2KRMA 2K7AA 1PKSA 2DM1A 1GL5A 1ABOA 1JXMA 1Y57A 3EGUA 4RTWA 2GGRA 1GFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RLQ C;  4AFQ C;  3UA7 A;  1SSH A;  1G83 A;  1SRL A;  1WX6 A;  1U06 A;  2HBW A;  4CC4 B;  2J7I A;  1K1Z A;  1TUD A;  4RTY A;  2P4R A;  2GTO A;  2LJ3 A;  2KYM A;  2RQT A;  2IOA A;  2G6F X;  3EG0 A;  1W1F A;  4D8D A;  3VS0 A;  1FYN A;  4LUD A;  2EVR A;  1JQQ A;  1WXU A;  4RTT A;  2OJ2 A;  1QLY A;  4E6R A;  1X6B A;  1WIE A;  1YNZ A;  4JPB W;  1W70 A;  2KRN A;  2FPE A;  3VPI A;  1UDL A;  3M0P A;  3QWY A;  3VS3 A;  2J05 A;  5ECA A;  2CUD A;  2DBM A;  1YWP A;  4WCI A;  2DL4 A;  2KT1 A;  5GJV B;  4AFS C;  3H0H A;  1QKX A;  1AD5 A;  4RTV A;  1UTI A;  1M3C A;  2RQW A;  2ESW A;  2M51 A;  3M0U A;  2J6K A;  2VPM A;  2RPN A;  2A28 A;  2IO9 A;  1K0S A;  2M0Y A;  2CRE A;  3A2Y A;  4AFZ C;  1W6X A;  4LNP A;  4JZ3 A;  2LJ0 A;  1UG1 A;  2EYZ A;  4IIO A;  3EG2 A;  1ZUY A;  2DVJ A;  2JS2 A;  3H41 A;  1WXB A;  5IHK A;  2EQI A;  2K3A A;  3S0Q A;  5I11 A;  1X2Q A;  4HVU A;  3M1U A;  2L3Q A;  2LX7 A;  2KGT A;  2YUP A;  1GCQ C;  3O98 A;  1AWJ A;  3M0T A;  1S1N A;  1CSK A;  2JMA A;  4J9E A;  3VS4 A;  2VVK A;  1NG2 A;  2DL8 A;  3ULR B;  2LP5 A;  1KFZ A;  2LMJ A;  1BBZ A;  2IOB A;  4LUE A;  2KNB B;  2K3B A;  3RBB B;  2J06 A;  3U23 A;  2IO7 A;  2LZ6 B;  2KXD A;  2EBP A;  2GTJ A;  3PVQ A;  1UE9 A;  2BZY A;  2V1Q A;  1GBQ A;  1NYG A;  2D8J A;  2DIL A;  2GNC A;  1YN8 A;  2C0T A;  4J9B A;  3VRY A;  4OMP A;  1SHF A;  2JMC A;  4FQB A;  2D8H A;  4A63 B;  4AG2 C;  4QT7 A;  1X43 A;  3NMZ C;  1PHT A;  2YUN A;  2C0O A;  3EHQ A;  5I22 A;  1OPL A;  2LQN A;  1IO6 A;  1OEB A;  1JO8 A;  2ROT A;  1ABQ A;  2FG0 A;  4LJ1 A;  1NEB A;  2DF6 A;  2IO8 A;  1M3B A;  2DRM A;  3VS5 A;  3VS7 A;  2L3P A;  3CQT A;  2X3W D;  4J9H A;  4F4M A;  2JW4 A;  1ZSG A;  1BU1 A;  4Z8A A;  4ESR A;  2K1G A;  4Q4G X;  1E6G A;  1X27 A;  2DBK A;  1AWW A;  4AG1 C;  4F16 A;  3A98 A;  2F2V A;  4HZ9 A;  2ROL A;  4Q4N A;  2W10 A;  1QCF A;  3M0R A;  1UFF A;  3JV3 A;  1Z9Z A;  4Y92 A;  2KYB A;  2PZ1 A;  1KJW A;  1RUW A;  2EPD A;  2NUZ A;  4LN2 A;  4FSS A;  1K0X A;  2EW3 A;  2RNA A;  4EOB A;  2AZS A;  4FGD A;  1MV0 B;  1MUZ A;  2EYY A;  3TSW A;  2RN8 A;  2LRJ A;  1X6G A;  4CGK A;  2ED1 A;  3I9Q A;  1N5Z A;  2K6D A;  2SEM A;  3EG3 A;  3QWX X;  3KW0 A;  5GJW B;  4HCK A;  2D0N A;  2FPF A;  1PRL C;  4FQA A;  4OML A;  1KIK A;  2PNI A;  1E7O A;  2JT4 A;  5IXB A;  1QWF A;  1FMK A;  2K2M A;  4JJD A;  4Q4T A;  4CC7 A;  1PWT A;  3A2Z A;  2KXC A;  1AEY A;  4OMM A;  4HPE A;  2EGE A;  2J6F A;  2ECZ A;  2CT4 A;  1HJD A;  1LCK A;  2A37 A;  1NYF A;  3GT2 A;  2L2P A;  3PBI A;  4F0V A;  3SEM A;  1JU5 C;  2L0A A;  1NLO C;  4CC2 A;  1VYU A;  1UGV A;  1UUE A;  2CSQ A;  1VYT A;  1UJY A;  1AWO A;  3NPF A;  2J6O A;  1GCP A;  2DRK A;  2RQR A;  4F14 A;  1U5S A;  1ARK A;  3LH5 A;  1M30 A;  2ED0 A;  1PKT A;  3REA B;  1AVZ C;  3M0S A;  1T3S A;  3VS1 A;  4CC3 A;  2D1X A;  2EGA A;  1X69 A;  4OLK A;  2E5K A;  2IIM A;  1NLP C;  3IQL A;  4JJB A;  2AKK A;  2JM9 A;  1M27 C;  2FO0 A;  4Z88 A;  2A36 A;  2RQV A;  2SRC A;  4OMQ A;  1U3O A;  1PRM C;  2AZV A;  2RQU A;  4J9F A;  3I35 A;  1I1J A;  2O88 A;  3FJ5 A;  4EQ8 A;  1ZBJ A;  2AKL A;  2VWF A;  2YUO A;  3KFV A;  5L23 A;  3VPJ A;  1WA7 A;  4J9I A;  1SHG A;  1YWO A;  3GBQ A;  5FWC A;  2L3S A;  2MCN A;  4AFU C;  1ZUK A;  2X3X D;  1SEM A;  1T0J A;  4OMO A;  2YSQ A;  4X1V A;  1TG0 A;  2F2X A;  3UAT A;  2DL7 A;  1AOJ A;  4EIK A;  2DJQ A;  1YP5 A;  4FDY A;  1V1C A;  2K79 A;  5IH2 A;  1WLP B;  2JM8 A;  1I07 A;  1YCS B;  3R6N A;  3O5Z A;  1JEG A;  1CKB A;  1T0H A;  5EC7 A;  1AWX A;  4GLM A;  2XIV A;  1E6H A;  1UEC A;  2DYB A;  3M0Q A;  1WDX A;  4J9D A;  2FPD A;  4Z89 A;  2HSP A;  1RI9 A;  1M8M A;  1Z9Q A;  4F0W A;  2FEI A;  4RTZ A;  3H0I A;  3VS2 A;  2MIO A;  2HDA A;  2VKN A;  4RTX A;  3NHN A;  4FGE A;  2OI3 A;  1VYV A;  1MV3 A;  1UJ0 A;  1WXT A;  4HXJ A;  4HZB A;  2O9V A;  4M4Z A;  4DEX A;  4J9C A;  2DL5 A;  1I0C A;  1EFN A;  3RNJ A;  3ZL7 C;  1M3A A;  2KT8 A;  3C0C A;  1TUC A;  2C0I A;  1UHC A;  3TSZ A;  2JXB A;  4RTU A;  2JTE A;  3NE0 A;  2AK5 A;  2PTK A;  2VPS A;  1WI7 A;  1OPK A;  1GCQ A;  2YUQ A;  1K9A A;  2DA9 A;  1NM7 A;  4JXB A;  3VS6 A;  1VA7 A;  2DE0 X;  3NGP A;  1X2K A;  3PVL A;  2DNU A;  2A08 A;  1SPK A;  3SHW A;  2KR3 A;  1K76 A;  1AZE A;  2DMO A;  4FGI A;  2F2W A;  2KRS A;  2DX1 A;  2NWM A;  1GBR A;  2YT6 A;  2CT3 A;  4HVV A;  3THK A;  1BB9 A;  1ZLM A;  5IHI A;  2KBT A;  2LQW A;  1WFW A;  3EG1 A;  1T3L A;  2KE9 A;  2LJ1 A;  2BTT A;  5HCK A;  1H8K A;  3A30 A;  2K9G A;  5IXF A;  3I5S A;  1QKW A;  2EYX A;  4ORZ A;  1CKA A;  3EHR A;  1B3Q A;  2JS0 A;  5FW9 A;  4LE9 A;  5IHN A;  1G2B A;  2LCS A;  1WYX A;  2CDT A;  1HD3 A;  4CSH A;  2I0N A;  1SRM A;  1PNJ A;  1GFC A;  4JJC A;  4J9G A;  1H3H A;  2LNH B;  2ENM A;  3PBC A;  1KSW A;  1ZUU A;  2H8H A;  2BZX A;  4ZNX A;  2FRW A;  3I5R A;  3I86 A;  1K4U S;  2O9S A;  1A0N B;  4K11 A;  4D8K A;  3VRZ A;  2FRY A;  1HSQ A;  2CSI A;  3PE0 A;  2O2O A;  2RMO A;  2DL3 A;  4HVW A;  2QDL A;  2EGC A;  2BZ8 A;  2GQI A;  1AZG B;  2EYW A;  4RUG A;  4F17 A;  2YDL A;  2GBQ A;  2O31 A;  4CT3 A;  4R0K A;  2VOB A;  3H0F A;  1JXO A;  4OMN A;  4KRT A;  4EQA A;  3UA6 A;  1GRI A;  1Y0M A;  2OAW A;  2XMF A;  1H92 A;  4IIM A;  2HEQ A;  2KEA A;  4GBQ A;  5FWB A;  2EKH A;  1RLP C;  2CH4 A;  2CH4 W;  1NEG A;  2ABL A;  1B07 A;  2DLP A;  1UHF A;  3TVT A;  2IF6 A;  1XOV A;  1OOT A;  1OV3 A;  1QWE A;  2HCK A;  2KRO A;  4JZ4 A;  3UF4 A;  1J3T A;  2CUB A;  4DEY A;  3REB B;  1BK2 A;  1ZX6 A;  2RF0 A;  2B86 A;  2V1R A;  2W0Z A;  2MOX A;  2KRM A;  2K7A A;  1PKS A;  2DM1 A;  1GL5 A;  1ABO A;  1JXM A;  1Y57 A;  3EGU A;  4RTW A;  2GGR A;  1GFD A; 
#chains in the Genus database with same CATH topology
 2NYS A;  5CKD A;  5IAY A;  1EZZ B;  1SRL A;  3CCM T;  1U06 A;  4CC4 B;  4RTY A;  3V8K A;  2G6F X;  3EG0 A;  4HFK A;  1YJW Q;  2PUO B;  3J80 E;  4FM4 B;  1WXU A;  2LQ8 A;  2BUD A;  1VQ7 T;  2JTM A;  1ZBX A;  2DER A;  4F04 B;  1YNZ A;  4JPB W;  2COY A;  4Y91 A;  2KRN A;  3VPI A;  2FPE A;  3E2U A;  1K9M R;  3VS3 A;  2J05 A;  1QVG S;  5ECA A;  4PLL A;  2NUT B;  1UEB A;  1AD5 A;  3OS0 A;  4M75 B;  5I21 A;  1D1C A;  2A28 A;  2FZC B;  1KD1 U;  2IO9 A;  3CCJ Q;  4PLI A;  2CRE A;  3HKS A;  3A2Y A;  1Q82 U;  2M0O A;  4JZ3 A;  4C0G A;  3CC7 A;  2QK0 A;  3H41 A;  2FB7 A;  4BI8 B;  4JUR A;  2K3A A;  3S0Q A;  4HVU A;  3M1U A;  3N5B B;  2L3Q A;  2KGT A;  4ZGE B;  1GCQ C;  3O98 A;  1VQ8 Q;  3M0T A;  1S1N A;  4PFP A;  2Z0W A;  2RK2 A;  5A0G A;  5KYW B;  3I55 A;  2DL8 A;  2HQH A;  1Y7X A;  3MO8 A;  2LMJ A;  1VQN T;  1BBZ A;  1QP3 A;  3VYG A;  3CCE Q;  2IOB A;  2KNB B;  3LYI A;  4LXC A;  2BE9 B;  3INZ A;  3M5A A;  2WSC E;  4A4G A;  1ZHI A;  1JJ2 S;  5L8R E;  1FMW A;  1R0B G;  1ZSZ C;  1GBQ A;  1NYG A;  2NUT A;  2D8J A;  2C0T A;  4PJO B;  5LJ5 d;  4M75 G;  4OMP A;  4M75 A;  3LW5 E;  3C95 A;  4HA8 A;  4FYX B;  1Y07 A;  2X4X A;  2JJ9 A;  2YUN A;  2DO3 A;  4QKU A;  1IO6 A;  3RKY A;  2YRD A;  2ROT A;  3VKI A;  2A7Y A;  4JRP A;  3VS5 A;  3CCV T;  2E1H A;  2X3W D;  2L8D A;  2QQR A;  4Z8A A;  5C6S A;  2QA4 Q;  4Q4G X;  1C0M A;  2DEU A;  1AWW A;  1FXX A;  3M55 A;  3V7C A;  1K73 U;  2K2V A;  2W10 A;  1UFF A;  1VQ4 A;  3JV3 A;  3JCM h;  1Z9Z A;  3G1J A;  4EMK C;  2NUZ A;  1KD1 R;  3EFO B;  4LN2 A;  4PJO G;  2LVM A;  2JOY A;  4BY6 B;  4FSS A;  1Q82 R;  3G71 A;  4PJO A;  1K0X A;  2EW3 A;  2RNA A;  1VQ6 A;  3ER0 A;  1R77 A;  3FIF A;  4CGK A;  4BE2 A;  3DLM A;  2NUP B;  5FRM A;  4HCK A;  4B9X A;  8AT1 B;  4FQA A;  4RG2 A;  4OB3 B;  4NL3 A;  5GMK j;  2PNI A;  1VQP Q;  1IGQ A;  1E7O A;  5KE2 A;  2K2M A;  1XQH A;  3H9N A;  1N8R R;  1WPY A;  2KXC A;  3LLR A;  4J32 A;  2EWN A;  1M1K C;  1QVF S;  1LOJ A;  4J7F A;  3TQ7 P;  1V76 A;  2ECZ A;  2DZC A;  1V29 B;  2R5A A;  3AT1 B;  3G4S A;  5AYF A;  1JU5 C;  2L0A A;  3EFO A;  3MP6 A;  3EGD B;  1UGV A;  1X6O A;  1VYT A;  3EG9 B;  5LJ5 e;  1AWO A;  1DJ7 B;  2J6O A;  1YI2 Q;  5FU6 B;  1M30 A;  1D1B A;  1PKT A;  2X35 A;  4M77 C;  3M0S A;  3VS1 A;  5FRO A;  2D1X A;  2NUP A;  3FB9 A;  1O9S A;  2IIM A;  1NLP C;  1NJI U;  4EMK B;  2XIC A;  5CCA A;  4J6X A;  4Z88 A;  2KVQ G;  4F7U F;  2AT1 B;  3RER A;  1SKU B;  1K73 R;  2P84 A;  3DB4 A;  3P8D A;  5HY6 A;  1LPL A;  2RQU A;  3ZBD A;  1OI1 A;  3I35 A;  1KK7 A;  5FU7 B;  3WVD B;  2E12 A;  1ZBJ A;  2AKL A;  2CZ7 B;  2H3J A;  2VWF A;  1SF9 A;  3KFV A;  2DTH A;  2HD0 A;  2VB6 A;  4HCZ A;  2MCN A;  3EGD A;  4E7Z A;  3NTK A;  3M54 A;  3LGL A;  3EG9 A;  5KYU B;  1K8A U;  5KYN A;  1TG0 A;  2WSF E;  4A53 A;  4HCC A;  2MMP A;  2XDD A;  1K9M C;  3A8O B;  2HNI A;  4E7I A;  2RJD A;  5IH2 A;  3CMA A;  5GMK e;  3CC7 T;  4EMK A;  2EQJ A;  1VIF A;  3X20 B;  1I07 A;  1YCS B;  3R6N A;  4XK8 E;  3EH1 A;  4BD3 A;  1VQL A;  1BI1 A;  1QW1 A;  2E10 A;  5EC7 A;  3I55 T;  2XIV A;  3M4G A;  4M78 B;  1WDX A;  4J9D A;  3FDR A;  4C8Q E;  1G3S A;  4LDV A;  2QEX A;  3J81 E;  3CCU Q;  1MHN A;  4Z89 A;  1N9S A;  2BKD N;  4XQ3 A;  2ZPB B;  1VOM A;  4F0W A;  5KYX B;  2FEI A;  2YXY A;  4FYV B;  5A0L A;  4Z02 A;  2X4J A;  1PSE A;  3CPW S;  1MV3 A;  1NJI R;  4M75 D;  1UJ0 A;  3M56 A;  4NOY A;  2QGG A;  2DYI A;  1XNI A;  4DEX A;  3GF5 A;  3VYH B;  1YIJ A;  2RA2 A;  2P0P A;  2X9H A;  3C0C A;  2G3R A;  5CKF A;  4QVZ A;  5M9O A;  4M78 G;  2VPS A;  3OSV A;  1PC0 A;  3M53 A;  4L59 A;  4M77 A;  4M78 A;  4Y28 E;  3JCM b;  1EIF A;  1X01 A;  3JCM J;  4M7A F;  3C4S A;  2DA9 A;  1NM7 A;  3SB2 A;  3VS6 A;  3EH2 A;  2QQS A;  1X2K A;  3GOX A;  5DLQ E;  1W2B A;  5GAM g;  1MNE A;  2A08 A;  3MKD A;  4QQG A;  3SHW A;  5GAM f;  2KR3 A;  3G71 T;  2DMO A;  4MDW A;  4PJO D;  2KRS A;  2DX1 A;  3HL8 A;  3QJY A;  3MET A;  3PMT A;  4HVV A;  3THK A;  1BB9 A;  1I81 A;  3OS2 A;  2LQW A;  1WFW A;  3VUZ A;  1T3L A;  2LJ1 A;  2BTT A;  3LH0 A;  1S72 T;  2CYZ B;  5HCK A;  3RIR A;  1H64 1;  1Q7Y R;  2K9G A;  3TU4 K;  3I5S A;  1IHV A;  1QKW A;  1Q95 G;  3CD6 A;  5LJ5 h;  3EHR A;  5GMK m;  1B3Q A;  4PKC C;  1G2B A;  2CDT A;  1YHQ Q;  4JJC A;  1H3H A;  3L42 A;  2WP7 A;  4J30 A;  2K57 A;  1BI0 A;  4FYW B;  4JDS A;  4ZNX A;  4DBQ A;  2FRW A;  2V8I A;  4X9D A;  4L5G A;  1K4U S;  2YRV A;  4M7A C;  3G4S T;  4K11 A;  2DD5 A;  2FRY A;  3PE0 A;  2RI2 A;  2M16 A;  4HVW A;  4BDZ A;  2EGC A;  2BZ8 A;  3JB9 H;  1AZG B;  4MZT A;  4F17 A;  5LJ3 g;  2DXC A;  2O31 A;  1Q86 C;  4JJN K;  5LJ3 f;  2HL5 C;  1N8R C;  2Y90 A;  5GAO q;  3ZFJ A;  1GRI A;  2OAW A;  4ME7 A;  5GAN g;  1QCO A;  2HEQ A;  5GAN f;  5I2M A;  1N9R A;  5J3B A;  4HT9 A;  3HPW A;  1UGS B;  2O4X B;  1QVP A;  3TVT A;  2IF6 A;  2LC4 A;  3S6W A;  2KRO A;  2HCK A;  3EFS A;  4JZ4 A;  2QQB A;  3Q1J A;  1BK2 A;  5GMK h;  2MOX A;  1W2B P;  3G6E A;  4KH0 B;  1WQ7 A;  2CZ6 B;  1TSF A;  1RLQ C;  4AFQ C;  3UA7 A;  4NL2 A;  1M1K U;  1IHW A;  1H3Z A;  4OB0 B;  3CCM Q;  1K1Z A;  1WJR A;  1O75 A;  2P4R A;  2KYM A;  2RQT A;  2IOA A;  1JB0 E;  5DM7 R;  3GNF B;  3A5Z B;  3CBM A;  2OTL A;  4A4H A;  2RK1 A;  2LT4 A;  4XTY A;  1RAA B;  1QLY A;  4ZTJ A;  5IN1 A;  4PJL A;  1VQ7 Q;  4C0Z A;  1IXD A;  3M58 A;  5CQX A;  3CMA T;  1WIE A;  2RHI A;  1MMA A;  3OYB A;  1UDL A;  3M0P A;  4XU2 A;  2O4X A;  4C92 G;  4RKU E;  4CRI A;  1YWP A;  3OYG A;  2DL4 A;  4BI3 A;  1VQ9 T;  1QKX A;  3QHS A;  4DQ2 A;  2HZY A;  1ZA2 B;  2RQW A;  4PJM A;  5GAN 4;  2J6K A;  2VPM A;  2QEX T;  2CP2 A;  2M0Y A;  3A8L B;  3OYL A;  4AFZ C;  1W6X A;  3JCM P;  4JRI A;  4LNP A;  2EYZ A;  3NTI A;  4IIO A;  2R57 A;  5LJ3 d;  1KHI A;  2JS2 A;  3H6Z A;  1WXB A;  2EQI A;  4PL6 A;  1X2Q A;  3GPL A;  2LX7 A;  9ATC B;  4OMF B;  1M2V A;  1CSK A;  1IRE B;  4J9E A;  2DVE A;  5D6W A;  3M4Y A;  1YIT A;  2XDP A;  1VQN Q;  2DEQ A;  2LQK A;  3TCJ A;  4A54 A;  2OTJ A;  3RBB B;  2HKQ B;  3A1P A;  1K9M U;  1YIJ T;  3OMC A;  2IO7 A;  3LWH A;  3AHU A;  1RAH B;  1UE9 A;  1QVG A;  1RAD B;  5A2Q E;  2RJF A;  5HKC A;  4M7D B;  3CCS A;  1PD0 A;  1SHF A;  1D3B A;  4A63 B;  4M78 D;  4AG2 C;  3MPU B;  4FT4 A;  4E7H A;  1PHT A;  2C0O A;  3JB9 F;  4KH1 B;  3FLG A;  5GAM e;  2F5T X;  1ABQ A;  4XTW A;  1NEB A;  2E4H A;  1M3B A;  1YJW A;  3CCV Q;  5GAO r;  3HRU A;  3V8J A;  3A8G B;  2EAY A;  2E3I A;  5CQY A;  2H3E B;  4ESR A;  1E6G A;  1X27 A;  2VXE A;  4DBF A;  3A98 A;  2F2V A;  3L2R A;  3CD6 T;  4HZ9 A;  4LD9 K;  3M0R A;  3CXC S;  4IUT A;  4QQ6 A;  2KYB A;  1JJ2 A;  2EPD A;  2O01 E;  3CME T;  4M7D G;  6AT1 B;  2M02 A;  1VQO T;  4M7D A;  2K5I A;  3CCJ A;  1Q7Y C;  1MV0 B;  1MUZ A;  2EYY A;  4II1 A;  3TSW A;  1X6G A;  2DXT A;  3X26 B;  3A8H B;  2ED1 A;  2K6D A;  2NLU A;  2SEM A;  5LJ3 e;  4OF1 A;  3JRZ A;  1VQ8 A;  2FPF A;  1PRL C;  5C0M A;  1ACM B;  2OX7 A;  2EJ9 A;  5GAN e;  4N4G A;  5IXB A;  2MI6 A;  3A2Z A;  3QKJ A;  4IUR A;  4BI4 A;  1QVG P;  3OQ5 A;  2EGE A;  3RDV A;  2J6F A;  1IGU A;  3CCQ A;  1HJD A;  1MND A;  3RES A;  3L1A A;  1NYF A;  3GT2 A;  2L2P A;  3PBI A;  5DLO A;  3SEM A;  1G3Y A;  4CC2 A;  3FC3 A;  2CSQ A;  2LX9 A;  1N27 A;  2CS7 A;  1UJY A;  3CEY A;  3OSS C;  4PFO A;  4EDU A;  3G6E T;  4C8Q B;  2DRK A;  2RQR A;  1ARK A;  3LH5 A;  2VV5 A;  3HRT A;  4CI0 C;  2RO0 A;  1AVZ C;  1Q81 U;  1T3S A;  3HFN A;  3JCM V;  2E5K A;  3SDZ A;  5GAN 3;  3IQL A;  3KUF A;  2AKK A;  3EBQ A;  4IUV A;  5GAO m;  2FO0 A;  2DIG A;  1YCY A;  2A36 A;  5GAO p;  3QDR B;  1U3O A;  1PRM C;  2QA4 A;  3QZ5 B;  4J9F A;  1Q86 U;  1N8R U;  4EQ8 A;  1N6A A;  4FL6 A;  1JJ2 P;  3PTA A;  4IKF A;  1RAB B;  1YWO A;  1QVF A;  1OYX A;  3QSU A;  2A3L A;  2OAU A;  2K3Y A;  2FZG B;  4HFL A;  5LJ5 j;  4AFU C;  4C92 D;  1TU0 B;  1SEM A;  2M1H A;  4OMO A;  2B8A A;  4M7A E;  4X1V A;  2JNG A;  4MZP A;  4C8Q A;  2PQW A;  1I4K 1;  2QXF A;  2RB6 A;  3UAT A;  2DL7 A;  1AOJ A;  1XJW B;  1OU8 A;  1YP5 A;  2QDY B;  1V1C A;  3CC7 Q;  1WLP B;  2EQM A;  4KUI A;  1YJ9 A;  1VQP A;  3O5Z A;  4GLK A;  3V8L A;  2ZPE B;  3SFM A;  4GY5 A;  5GAM h;  2RHU A;  1T0H A;  4O5V A;  3I55 Q;  3UWN A;  2DYB A;  4MMK A;  4E47 A;  2LRQ A;  2V8J A;  3C12 A;  2HSP A;  3S3O A;  3CCL T;  4QW2 A;  2KDS A;  1Q81 R;  3CBP A;  2VKN A;  2K5F A;  2MWP A;  3CCS T;  4FGE A;  2DTI A;  1VYV A;  2I2L A;  1ZSZ B;  1WXT A;  1B7T A;  5KYY B;  1Q86 R;  3OBY A;  1I0C A;  1EFN A;  4EMG A;  1PG5 B;  2RI5 A;  2F69 A;  3LX7 A;  2KT8 A;  2EQK A;  1TUC A;  2C0I A;  3TSZ A;  4X34 A;  4RTU A;  3OW2 A;  3NE0 A;  1QVF P;  1HYO A;  1RL2 A;  5LJ3 h;  1WI7 A;  1GCQ A;  4O6J A;  3QII A;  5GAN 8;  3QO3 A;  5GAN h;  2VUB A;  2DE0 X;  3NGP A;  4J8O A;  2DNU A;  3QYH B;  4DBR A;  4XU1 A;  1PSF A;  1AZE A;  3G71 Q;  4FGI A;  2MAM A;  1Y96 B;  3L2U A;  2RHZ A;  2YWW A;  4M7D D;  2PVO B;  2CT3 A;  1ZSZ A;  2EQU A;  4DOV A;  3HTR A;  5IHI A;  2L3R A;  2KBT A;  2E3H A;  5KCH A;  2CGH A;  3CPW A;  2KE9 A;  1TUG B;  1S72 Q;  5IXF A;  3H8Z A;  1LNX A;  5CKB A;  5KYY A;  3QZ9 B;  3X24 B;  2EYX A;  4PJJ A;  1NBE B;  4DBH A;  1HXD A;  1WHM A;  5D6X A;  5GAN 5;  1VQ8 T;  3PNW C;  1WYX A;  2MWO A;  1ZA1 B;  1HD3 A;  4Q5W A;  4CSH A;  2I0N A;  1U1T A;  1SRM A;  3QYG B;  2LNV A;  5LL6 S;  1M2O A;  2HMA A;  3VU3 C;  1D09 B;  1KSW A;  2L89 A;  4XTZ A;  5A0D A;  4E7K A;  4YTL A;  3CCQ T;  2BE7 D;  3R6O A;  1A0N B;  3G4S Q;  1FX7 A;  2CSI A;  5KH6 A;  2RMO A;  3CC4 Q;  2EYW A;  4RUG A;  1Y96 A;  3PT9 A;  1OX9 A;  2KY9 A;  2YDL A;  2EFI A;  3C94 A;  5HK0 A;  3JCM W;  3TEE A;  4OMN A;  1BCO A;  1Q7Y U;  3UA6 A;  2VC8 A;  4IIM A;  2COW A;  2K3X A;  4A4E A;  1YJN A;  4HT8 A;  3TRE A;  2EKH A;  3OW2 P;  2CH4 A;  1BI2 A;  2HQX A;  4M77 B;  3CCR A;  4A4F A;  1B34 B;  3OB9 A;  4MML A;  3UDC A;  3E19 A;  3OYC A;  3UF4 A;  1J3T A;  1G3T A;  2E41 A;  3P8B B;  2JZ2 A;  4M75 E;  2RF0 A;  4OGC A;  2KRM A;  2K7A A;  2LTO A;  2DM1 A;  4JUV A;  1XTD A;  1ABO A;  1U8R A;  3EGU A;  4RTW A;  2DZ9 A;  1SSH A;  1G83 A;  4JS4 A;  1VQ5 A;  1WX6 A;  1BIB A;  2GTO A;  2LJ3 A;  3CPW P;  2QTX A;  2EYQ A;  2FZK B;  1BKB A;  4N0A C;  2V8K A;  4OGE A;  1M8V A;  4C92 F;  4RTT A;  3PIP A;  4E6R A;  4JRQ A;  2X4W A;  2XU8 A;  4C0D C;  3MEV A;  1X6B A;  3OS5 A;  3CMA Q;  4M77 G;  1YHQ A;  1W70 A;  1YJ9 T;  3QWY A;  1KC8 R;  1B34 A;  2DBM A;  4WCI A;  1WHJ A;  1VQ4 T;  2IG0 A;  1VQ9 Q;  2ZGW A;  4RTV A;  2VYT A;  1M3C A;  3KXT A;  2ZPG B;  2M51 A;  4F7U B;  3M0U A;  3A8M B;  2RPN A;  5KCO A;  2GGR A;  1VQ6 T;  1K0S A;  2YLB A;  4OP0 A;  1JBM A;  4B9W A;  2XDB A;  2LJ0 A;  1UG1 A;  1PCX A;  3GLX A;  3NTH A;  2ZZD A;  3HFO A;  2HQE A;  1I5O B;  3OA6 A;  3DKM A;  5IHK A;  3G7Z A;  3OS1 A;  1BYM A;  2PU9 B;  4OB1 B;  3ZEH A;  3GNG A;  1AWJ A;  1VQM A;  4C92 C;  4EMH A;  3VS4 A;  2VVK A;  2KI7 A;  3ULR B;  3BFM A;  3QBY A;  3JAM E;  1C6V X;  2HL3 A;  2K3B A;  3VJP A;  2J06 A;  1AT1 B;  3U23 A;  1YIJ Q;  2LZ6 B;  2KXD A;  3UPU A;  2EBP A;  2GTJ A;  1Q81 C;  3PVQ A;  3OYI A;  2V1Q A;  2DIL A;  1YN8 A;  2KMT A;  4MZM A;  2GFU A;  3VRY A;  2QGF B;  4PNO A;  4F7U G;  4FQB A;  4F7U A;  2D8H A;  3JSC A;  1BCM A;  2M9U A;  1WJQ A;  3JB9 I;  3EHQ A;  2KAF A;  1UB4 A;  1OEB A;  3MHX A;  1JO8 A;  4PJN A;  3JCM X;  4LJ1 A;  3HP9 A;  2DF6 A;  2AHJ B;  2DRM A;  2KK4 A;  2GCX A;  2MK5 A;  2L3P A;  2JW4 A;  2JUF A;  1BU1 A;  4MDX A;  4AG1 C;  3SWN C;  2ROL A;  3CD6 Q;  4Q4N A;  1NPP A;  3RKX A;  1VQK A;  4BUG A;  4R55 A;  1KJW A;  4UC4 A;  3X25 B;  3V7R A;  1WHK A;  2DD4 A;  4KUL A;  3CME Q;  1VQO Q;  1RAC B;  2VGM A;  1M4Z A;  4FGD A;  3I56 A;  5GAM j;  2RN8 A;  2LRJ A;  2HSE B;  1M2V B;  2E5Q A;  1TWB A;  2JN0 A;  3MP1 A;  4ZGJ B;  3ASK A;  3JCM d;  4M7A B;  4EPC A;  5KE3 A;  4C5I A;  3LGF A;  3JCM Q;  5FLX E;  1KIK A;  1RI0 A;  1OU9 A;  2VGN A;  2CZ1 B;  4N4I A;  3RUX A;  4ZN3 A;  1VQL T;  1QWF A;  4WF2 A;  1FMK A;  2D9T A;  4JJD A;  2QYZ A;  4Q4T A;  4RCB A;  1PWT A;  1YJN T;  2XD0 A;  1TS9 A;  3EGX B;  4OMM A;  3HSB A;  1M1F A;  3CCR T;  1D3B B;  1LCK A;  2A37 A;  4F0V A;  1KQS S;  1HK9 A;  1VYU A;  3CPF A;  2P0K A;  1UUE A;  2CP5 A;  4LDU A;  2QI2 A;  4E7L A;  1PM3 A;  4BE0 A;  3NPF A;  4C5H A;  1GCP A;  3G6E Q;  4F14 A;  3UT1 A;  2ED0 A;  2CZ0 B;  3REA B;  5LJ3 j;  4CC3 A;  3F70 A;  4ATO A;  1VQ5 T;  1X69 A;  4OLK A;  2XK0 A;  3CCV A;  4BB7 A;  2MPX C;  4M7A G;  1ZQ1 A;  4M7A A;  2JM9 A;  5AT1 B;  1M27 C;  5GAN j;  3T9N A;  2RQV A;  4QQD A;  1OX8 A;  2SRC A;  4M75 F;  4V2S A;  2E70 A;  1I1J A;  1SSF A;  4FYY B;  4M78 E;  3CC2 A;  3FJ5 A;  2KQW A;  4XTX A;  2MYS A;  3EGX A;  4LD6 A;  2YUO A;  5L23 A;  2MF2 A;  3WXM B;  1LJO A;  1D0Z A;  3GBQ A;  4M77 D;  1M90 C;  3MEU A;  1R0C B;  1WNL A;  5CR2 A;  5FWC A;  3OYA A;  7AT1 B;  3FRN A;  1T0J A;  4QVC A;  1YBY A;  2DKG A;  2XG8 D;  4XAX B;  2EJF A;  4EIK A;  3S3M A;  1KC8 C;  4ZTF A;  1UGQ B;  2K79 A;  4PJO F;  1TOV A;  1JEG A;  4IUP A;  4J6Y A;  4M75 C;  3E9F A;  4WTO B;  1VQM T;  1AWX A;  4GLM A;  4ELZ C;  1OZ3 A;  3OMG A;  1E6H A;  1OZ2 A;  2FPD A;  2QTV A;  2K5L A;  4FW1 A;  4E2F B;  2QG9 B;  4KBM B;  4XTU A;  3CCL Q;  1RI9 A;  2F5K A;  2JVV A;  1Z9Q A;  4FU6 A;  3H0I A;  3VS2 A;  2HDA A;  4RTX A;  3CCS Q;  3NHN A;  3L2Q A;  2OI3 A;  2GQV A;  4HXJ A;  3OYM A;  4HKE A;  2O9V A;  4M4Z A;  4IUQ A;  3CCE A;  4AT1 B;  4J9C A;  1EX4 A;  5GAO n;  4PJO C;  3DLL A;  5GMK l;  1R8O B;  2JTF A;  3FJP A;  2ZPH B;  1MMD A;  2HBP A;  2AK5 A;  4C5E A;  1BIA A;  3V7S A;  2DJZ A;  3GIB A;  3OYD A;  1VQK T;  1K9A A;  2CP0 A;  3BY7 A;  1VA7 A;  2WAC A;  4JLI A;  4QVD A;  3PVL A;  4OB2 B;  4BDY A;  2KSS A;  1K76 A;  2DXU A;  2F2W A;  3CBO A;  1GBR A;  3I56 T;  3JB9 J;  1MGQ A;  3EG1 A;  2OTL T;  1WHL A;  1WQW A;  3A30 A;  4BAC A;  3S3N A;  1IZ6 A;  3D7S B;  1CKA A;  5FW9 A;  4A4K A;  4BY6 C;  4PFZ A;  5IHN A;  4C92 E;  2DPP B;  2LCS A;  2RHY A;  5CKH A;  4J9G A;  2LNH B;  1WHG A;  2P0Q A;  4FSX A;  2FVU A;  1ZUU A;  3MEW A;  2DIQ A;  2CP7 A;  2E65 A;  1I8F A;  3OY9 A;  2EJG A;  4C8Q G;  3CCQ Q;  1YFN A;  3OYN A;  2QDL A;  2QAS A;  1MMG A;  1UGR B;  5FRN A;  4ELY C;  3GP8 A;  2LCC A;  3O8V A;  4CT3 A;  3E1S A;  4R0K A;  2VOB A;  3QJ6 A;  3QG1 A;  5GMK i;  4KRT A;  3NFC A;  1QCN A;  5FWB A;  1YIT T;  1RLP C;  3OYH A;  3JB9 G;  2OTJ T;  2CH4 W;  1NEG A;  2DFU A;  4M7A D;  8ATC B;  1UHF A;  5KYW A;  5CO7 A;  3OYF A;  1D0X A;  1OOT A;  1OV3 A;  1QWE A;  5FU6 C;  3CC2 T;  2CUB A;  4DEY A;  3REB B;  1I5L A;  2B86 A;  2V1R A;  1IB8 A;  1RAG B;  3RKW A;  1PKS A;  1GL5 A;  1YI2 A;  4EOB A;  1GFD A;  4J6W A;  1X75 C;  3L2W A;  2HBW A;  4RMO A;  2J7I A;  1TUD A;  3QXE B;  5FU7 C;  2BIV A;  1D1A A;  4M77 F;  4M78 F;  1W1F A;  5GAN 2;  4D8D A;  1S72 A;  3VS0 A;  1FYN A;  1YJW T;  4LUD A;  4OVA A;  4FIB A;  2EVR A;  2CKK A;  1JQQ A;  1TH7 A;  2OJ2 A;  1QMC A;  4LDW A;  4PK4 A;  1YJ9 Q;  4J7I A;  2WSE E;  2CUD A;  2KT1 A;  5GJV B;  4AFS C;  1VQ4 Q;  1UGP B;  3H0H A;  4M7D E;  1MMN A;  1U1S A;  1UTI A;  1C1A A;  2ESW A;  3CCJ T;  1VQ6 Q;  4XU3 A;  3CC4 A;  2FL7 A;  4P5N A;  1TTH B;  1WJS A;  3EG2 A;  1ZUY A;  2DVJ A;  1M90 U;  5I11 A;  4M78 C;  2YUP A;  2JMA A;  5DY9 A;  2ZPI B;  1NG2 A;  2LP5 A;  2LDM A;  2PVG B;  1KFZ A;  3CCE T;  4LUE A;  3OYY A;  1KHC A;  3CCU A;  1KC8 U;  4J5Y A;  2DET A;  3L2V A;  2BZY A;  5CK9 A;  4RCC A;  2GNC A;  4J83 A;  4J9B A;  5HK3 A;  2JMC A;  1QP2 A;  4QT7 A;  1X43 A;  3NMZ C;  4ANJ A;  4TVR A;  2RHX A;  5I22 A;  4X9C A;  1OPL A;  1VUB A;  2LQN A;  2FG0 A;  2IPO B;  3MEA A;  4KT0 E;  2IO8 A;  5CIU A;  3EFR A;  3VS7 A;  4JS5 A;  4NS5 A;  4DA4 A;  3RR6 A;  3CQT A;  4J9H A;  5CAI A;  4F4M A;  1ZSG A;  4FT2 A;  2PUK B;  4LDX A;  2K1G A;  2QA4 T;  1Y71 A;  3E9G A;  2DBK A;  2K4Y A;  4F16 A;  5CVI A;  2YLC A;  1G8X A;  2FYK A;  3OW2 S;  2DTO A;  3QPH A;  1QCF A;  1QQJ A;  1NE8 A;  2EIF A;  4Y92 A;  1VQ9 A;  3URG A;  2PZ1 A;  2YRC A;  1RUW A;  4AMC A;  1NZ9 A;  2YHT A;  2EKO A;  4L6V 5;  2L5Q A;  2AZS A;  3MJX A;  4XU0 A;  3BDL A;  1M90 R;  3M9Q A;  2RM4 A;  2RJE A;  5KYU A;  4C8Q D;  3I9Q A;  4FW2 A;  2E6N A;  1N5Z A;  3QWX X;  4R56 A;  3KW0 A;  3P8H A;  5GJW B;  2F1L A;  2D0N A;  4OML A;  2GFA A;  3DB3 A;  3OYE A;  3VUB A;  1VQP T;  2JT4 A;  1VQL Q;  4JLG A;  2DK3 A;  5GAO l;  4CC7 A;  4PJO E;  1AHJ B;  2Y4X A;  1YJN Q;  1AEY A;  4HPE A;  4C0F A;  3L2Z A;  3PFS A;  2CT4 A;  3CCR Q;  5J26 A;  2QEX Q;  3M59 A;  1RAF B;  3VV0 A;  3JB9 D;  1NLO C;  3QUI A;  2XI9 A;  2XKO C;  3BE3 A;  2XHC A;  4KUD K;  1K8A R;  2CP3 A;  4E7S A;  1G3W A;  1YI2 T;  1U5S A;  2RH2 A;  4KGX B;  2CP6 A;  5KYX A;  3JCM g;  3JCM f;  2EGA A;  1IRX A;  1VQ5 Q;  2E6Z A;  2IVW A;  2LCL A;  1PD1 A;  4ZN1 A;  4JJB A;  3HRS A;  1KQ2 A;  3FEO A;  2VXF A;  2R5M A;  4OMQ A;  1BI3 A;  4IUU A;  4DOW A;  4HFF A;  2GF7 A;  2AZV A;  2O88 A;  1NPR A;  1KD1 C;  4JRK A;  1WGS A;  1Q82 C;  2HKN A;  4N4H A;  4FCY A;  3VPJ A;  1WA7 A;  4J9I A;  1SHG A;  2VAS A;  4C0D B;  3CME A;  3CCM A;  1VQO A;  4RG8 A;  2L3S A;  1ZUK A;  2X3X D;  1KQS A;  2QQA A;  2YSQ A;  4LDY A;  4C5G A;  1G5V A;  2F2X A;  1JRI A;  3ME9 A;  1WZO A;  2RJC A;  3CC4 T;  2DJQ A;  2A0F B;  3JCM c;  4FDY A;  1VQ7 A;  2JM8 A;  4M7D F;  4ZGD B;  3OYJ A;  1OQK A;  1CKB A;  5CKE A;  1VQM Q;  4N0A A;  1UEC A;  3M0Q A;  5D6Y A;  3CCU T;  4C92 B;  1VIE A;  2X51 A;  2ZAE A;  2AIR B;  1W2B S;  2RD1 A;  1M8M A;  5IT9 E;  2DXB A;  4RTZ A;  2ZPF B;  2MIO A;  2XID A;  3OBW A;  4B6M A;  1KG1 A;  2P4T A;  5GAM d;  4BE1 A;  1RAE B;  4HZB A;  3EAE A;  2D0Q B;  1K73 C;  1VQN A;  3BW1 A;  2D6F A;  2DL5 A;  3WVE B;  3RNJ A;  3ZL7 C;  1M3A A;  3RMS A;  1SG5 A;  4M7D C;  1WHH A;  1UHC A;  1W4S A;  2JXB A;  2JTE A;  2QAZ A;  1M9S A;  5GAN 6;  3CXC A;  2PTK A;  2V26 A;  1OPK A;  3SD4 A;  3RMQ A;  2ATC B;  4C92 A;  1KQS P;  2YUQ A;  1VQK Q;  4XTV A;  2LT1 A;  4JXB A;  4HCB A;  3SWN B;  4KGV B;  1SPK A;  3PGG A;  3MCA B;  1KQ1 A;  2RI3 A;  2E64 A;  2COZ A;  2C06 A;  2NWM A;  2YT6 A;  3I56 Q;  1ZLM A;  3PIO A;  1GXI E;  1OUL A;  3OYK A;  2OTL Q;  1H8K A;  1RAI B;  3PMI A;  1D0Y A;  1M1G A;  4M77 E;  2X4Y A;  4KGZ B;  4ORZ A;  5D7U A;  2JS0 A;  4LE9 A;  5GAN d;  2R58 A;  1FMV A;  1YHQ T;  4C8Q F;  1PNJ A;  1GFC A;  2ENM A;  4VUB A;  5EG2 A;  3PBC A;  3HHT B;  3QDF A;  2H8H A;  2BZX A;  4E7J A;  3CCL A;  3I5R A;  3I86 A;  1TXQ A;  2O9S A;  2DAQ A;  2Y4Y A;  4D6W A;  1NJI C;  4D8K A;  3VRZ A;  1HSQ A;  1M1K R;  2O2O A;  3SWN A;  2DL3 A;  5GAN 7;  3LWI A;  2GQI A;  1P92 A;  3X28 B;  1F1B B;  3KBG A;  2GBQ A;  2ZCF B;  3BDU A;  3JCM e;  5J39 A;  2FHD A;  3H0F A;  1FWZ A;  1JXO A;  2QQ9 A;  4EQA A;  1Y0M A;  2XMF A;  1H92 A;  3J7A F;  3MP8 A;  2KEA A;  4GBQ A;  1YIT Q;  3CXC P;  2OTJ Q;  2ABL A;  1B07 A;  1LVK A;  2DLP A;  5I2S A;  1K8A C;  4C8Q C;  3M57 A;  1XOV A;  3CC2 Q;  4F7U E;  1ZX6 A;  2PVD B;  2W0Z A;  5LJ5 g;  1JXM A;  1Y57 A;  1M5Q 1;  2HAX A;  3EG3 A;  5LJ5 f; 
#chains in the Genus database with same CATH homology
 1RLQ C;  4AFQ C;  3UA7 A;  1SSH A;  1G83 A;  1SRL A;  1WX6 A;  1U06 A;  2HBW A;  4CC4 B;  2J7I A;  1K1Z A;  1TUD A;  4RTY A;  2P4R A;  2GTO A;  2LJ3 A;  2KYM A;  2RQT A;  2IOA A;  2G6F X;  3EG0 A;  1W1F A;  4D8D A;  3VS0 A;  1FYN A;  4LUD A;  2EVR A;  1JQQ A;  1WXU A;  4RTT A;  2OJ2 A;  1QLY A;  4E6R A;  1X6B A;  1WIE A;  1YNZ A;  4JPB W;  1W70 A;  2KRN A;  2FPE A;  3VPI A;  1UDL A;  3M0P A;  3QWY A;  3VS3 A;  2J05 A;  5ECA A;  2CUD A;  2DBM A;  1YWP A;  4WCI A;  2DL4 A;  2KT1 A;  5GJV B;  4AFS C;  3H0H A;  1QKX A;  1AD5 A;  4RTV A;  1UTI A;  1M3C A;  2RQW A;  2ESW A;  2M51 A;  3M0U A;  2J6K A;  2VPM A;  2RPN A;  2A28 A;  2IO9 A;  1K0S A;  2M0Y A;  2CRE A;  3A2Y A;  4AFZ C;  1W6X A;  4LNP A;  4JZ3 A;  2LJ0 A;  1UG1 A;  2EYZ A;  4IIO A;  3EG2 A;  1ZUY A;  2DVJ A;  2JS2 A;  3H41 A;  1WXB A;  5IHK A;  2EQI A;  2K3A A;  3S0Q A;  5I11 A;  1X2Q A;  4HVU A;  3M1U A;  2L3Q A;  2LX7 A;  2KGT A;  2YUP A;  1GCQ C;  3O98 A;  1AWJ A;  3M0T A;  1S1N A;  1CSK A;  2JMA A;  4J9E A;  3VS4 A;  2VVK A;  1NG2 A;  2DL8 A;  3ULR B;  2LP5 A;  1KFZ A;  2LMJ A;  1BBZ A;  2IOB A;  4LUE A;  2KNB B;  2K3B A;  3RBB B;  2J06 A;  3U23 A;  2IO7 A;  2LZ6 B;  2KXD A;  2EBP A;  2GTJ A;  3PVQ A;  1UE9 A;  2BZY A;  2V1Q A;  1GBQ A;  1NYG A;  2D8J A;  2DIL A;  2GNC A;  1YN8 A;  2C0T A;  4J9B A;  3VRY A;  4OMP A;  1SHF A;  2JMC A;  4FQB A;  2D8H A;  4A63 B;  4AG2 C;  4QT7 A;  1X43 A;  3NMZ C;  1PHT A;  2YUN A;  2C0O A;  3EHQ A;  5I22 A;  1OPL A;  2LQN A;  1IO6 A;  1OEB A;  1JO8 A;  2ROT A;  1ABQ A;  2FG0 A;  4LJ1 A;  1NEB A;  2DF6 A;  2IO8 A;  1M3B A;  2DRM A;  3VS5 A;  3VS7 A;  2L3P A;  3CQT A;  2X3W D;  4J9H A;  4F4M A;  2JW4 A;  1ZSG A;  1BU1 A;  4Z8A A;  4ESR A;  2K1G A;  4Q4G X;  1E6G A;  1X27 A;  2DBK A;  1AWW A;  4AG1 C;  4F16 A;  3A98 A;  2F2V A;  4HZ9 A;  2ROL A;  4Q4N A;  2W10 A;  1QCF A;  3M0R A;  1UFF A;  3JV3 A;  1Z9Z A;  4Y92 A;  2KYB A;  2PZ1 A;  1KJW A;  1RUW A;  2EPD A;  2NUZ A;  4LN2 A;  4FSS A;  1K0X A;  2EW3 A;  2RNA A;  4EOB A;  2AZS A;  4FGD A;  1MV0 B;  1MUZ A;  2EYY A;  3TSW A;  2RN8 A;  2LRJ A;  1X6G A;  4CGK A;  2ED1 A;  3I9Q A;  1N5Z A;  2K6D A;  2SEM A;  3EG3 A;  3QWX X;  3KW0 A;  5GJW B;  4HCK A;  2D0N A;  2FPF A;  1PRL C;  4FQA A;  4OML A;  1KIK A;  2PNI A;  1E7O A;  2JT4 A;  5IXB A;  1QWF A;  1FMK A;  2K2M A;  4JJD A;  4Q4T A;  4CC7 A;  1PWT A;  3A2Z A;  2KXC A;  1AEY A;  4OMM A;  4HPE A;  2EGE A;  2J6F A;  2ECZ A;  2CT4 A;  1HJD A;  1LCK A;  2A37 A;  1NYF A;  3GT2 A;  2L2P A;  3PBI A;  4F0V A;  3SEM A;  1JU5 C;  2L0A A;  1NLO C;  4CC2 A;  1VYU A;  1UGV A;  1UUE A;  2CSQ A;  1VYT A;  1UJY A;  1AWO A;  3NPF A;  2J6O A;  1GCP A;  2DRK A;  2RQR A;  4F14 A;  1U5S A;  1ARK A;  3LH5 A;  1M30 A;  2ED0 A;  1PKT A;  3REA B;  1AVZ C;  3M0S A;  1T3S A;  3VS1 A;  4CC3 A;  2D1X A;  2EGA A;  1X69 A;  4OLK A;  2E5K A;  2IIM A;  1NLP C;  3IQL A;  4JJB A;  2AKK A;  2JM9 A;  1M27 C;  2FO0 A;  4Z88 A;  2A36 A;  2RQV A;  2SRC A;  4OMQ A;  1U3O A;  1PRM C;  2AZV A;  2RQU A;  4J9F A;  3I35 A;  1I1J A;  2O88 A;  3FJ5 A;  4EQ8 A;  1ZBJ A;  2AKL A;  2VWF A;  2YUO A;  3KFV A;  5L23 A;  3VPJ A;  1WA7 A;  4J9I A;  1SHG A;  1YWO A;  3GBQ A;  5FWC A;  2L3S A;  2MCN A;  4AFU C;  1ZUK A;  2X3X D;  1SEM A;  1T0J A;  4OMO A;  2YSQ A;  4X1V A;  1TG0 A;  2F2X A;  3UAT A;  2DL7 A;  1AOJ A;  4EIK A;  2DJQ A;  1YP5 A;  4FDY A;  1V1C A;  2K79 A;  5IH2 A;  1WLP B;  2JM8 A;  1I07 A;  1YCS B;  3R6N A;  3O5Z A;  1JEG A;  1CKB A;  1T0H A;  5EC7 A;  1AWX A;  4GLM A;  2XIV A;  1E6H A;  1UEC A;  2DYB A;  3M0Q A;  1WDX A;  4J9D A;  2FPD A;  4Z89 A;  2HSP A;  1RI9 A;  1M8M A;  1Z9Q A;  4F0W A;  2FEI A;  4RTZ A;  3H0I A;  3VS2 A;  2MIO A;  2HDA A;  2VKN A;  4RTX A;  3NHN A;  4FGE A;  2OI3 A;  1VYV A;  1MV3 A;  1UJ0 A;  1WXT A;  4HXJ A;  4HZB A;  2O9V A;  4M4Z A;  4DEX A;  4J9C A;  2DL5 A;  1I0C A;  1EFN A;  3RNJ A;  3ZL7 C;  1M3A A;  2KT8 A;  3C0C A;  1TUC A;  2C0I A;  1UHC A;  3TSZ A;  2JXB A;  4RTU A;  2JTE A;  3NE0 A;  2AK5 A;  2PTK A;  2VPS A;  1WI7 A;  1OPK A;  1GCQ A;  2YUQ A;  1K9A A;  2DA9 A;  1NM7 A;  4JXB A;  3VS6 A;  1VA7 A;  2DE0 X;  3NGP A;  1X2K A;  3PVL A;  2DNU A;  2A08 A;  1SPK A;  3SHW A;  2KR3 A;  1K76 A;  1AZE A;  2DMO A;  4FGI A;  2F2W A;  2KRS A;  2DX1 A;  2NWM A;  1GBR A;  2YT6 A;  2CT3 A;  4HVV A;  3THK A;  1BB9 A;  1ZLM A;  5IHI A;  2KBT A;  2LQW A;  1WFW A;  3EG1 A;  1T3L A;  2KE9 A;  2LJ1 A;  2BTT A;  5HCK A;  1H8K A;  3A30 A;  2K9G A;  5IXF A;  3I5S A;  1QKW A;  2EYX A;  4ORZ A;  1CKA A;  3EHR A;  1B3Q A;  2JS0 A;  5FW9 A;  4LE9 A;  5IHN A;  1G2B A;  2LCS A;  1WYX A;  2CDT A;  1HD3 A;  4CSH A;  2I0N A;  1SRM A;  1PNJ A;  1GFC A;  4JJC A;  4J9G A;  1H3H A;  2LNH B;  2ENM A;  3PBC A;  1KSW A;  1ZUU A;  2H8H A;  2BZX A;  4ZNX A;  2FRW A;  3I5R A;  3I86 A;  1K4U S;  2O9S A;  1A0N B;  4K11 A;  4D8K A;  3VRZ A;  2FRY A;  1HSQ A;  2CSI A;  3PE0 A;  2O2O A;  2RMO A;  2DL3 A;  4HVW A;  2QDL A;  2EGC A;  2BZ8 A;  2GQI A;  1AZG B;  2EYW A;  4RUG A;  4F17 A;  2YDL A;  2GBQ A;  2O31 A;  4CT3 A;  4R0K A;  2VOB A;  3H0F A;  1JXO A;  4OMN A;  4KRT A;  4EQA A;  3UA6 A;  1GRI A;  1Y0M A;  2OAW A;  2XMF A;  1H92 A;  4IIM A;  2HEQ A;  2KEA A;  4GBQ A;  5FWB A;  2EKH A;  1RLP C;  2CH4 A;  2CH4 W;  1NEG A;  2ABL A;  1B07 A;  2DLP A;  1UHF A;  3TVT A;  2IF6 A;  1XOV A;  1OOT A;  1OV3 A;  1QWE A;  2HCK A;  2KRO A;  4JZ4 A;  3UF4 A;  1J3T A;  2CUB A;  4DEY A;  3REB B;  1BK2 A;  1ZX6 A;  2RF0 A;  2B86 A;  2V1R A;  2W0Z A;  2MOX A;  2KRM A;  2K7A A;  1PKS A;  2DM1 A;  1GL5 A;  1ABO A;  1JXM A;  1Y57 A;  3EGU A;  4RTW A;  2GGR A;  1GFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...