2HBWA

Crystal structure of a putative endopeptidase (ava_3396) from anabaena variabilis atcc 29413 at 1.05 a resolution
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
220
structure length
220
Chain Sequence
GEYQCLAALNLYDSPECTSLATQAAVGRHLQVTSNQQGAAVEVCLCEDDYPGWLSLGDLGLLKPATVLYQAKSFSESEIKKLLPGAIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFVSVGIWLPRDAYQQEAFTQAITIDELAPGDLVFFGTPVKATHVGLYLGDGCYIHSSGKAQGRDGIGIDILSEQGDVVSRSYYQQLRGAGRVVKSYKPQRH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Anabaena variabilis
molecule tags Hydrolase
molecule keywords NLP/P60 protein
total genus 66
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2006-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2hbwA01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2hbwA02
1M8MA 2LX7A 3I5SA 1UTIA 3R6NA 3VPIA 1HD3A 1V1CA 4AFUC 1B07A 1WXBA 4F14A 2IF6A 2CDTA 1B3QA 1NEGA 2HEQA 2DL3A 4HCKA 1W1FA 2K3AA 2PZ1A 4J9HA 4CC7A 4Q4TA 2RNAA 2IOAA 2EVRA 1YNZA 3NPFA 2DL5A 2HBWA 2ED0A 4A63B 2IIMA 2YUPA 2D0NA 1BU1A 1WIEA 2L3QA 2RPNA 3M0QA 3M0TA 5IXBA 1YWOA 2O9SA 2C0TA 3TVTA 5I22A 1K76A 4RTXA 2EYXA 1RI9A 2FPEA 2W10A 1E7OA 2A08A 3H41A 2MOXA 1M30A 2A37A 2DE0X 3JV3A 4RTUA 3VRYA 1MUZA 3VS3A 2F2XA 4QT7A 1T0JA 2JS0A 3UF4A 1M27C 4M4ZA 1TUCA 2KR3A 5GJVB 2NWMA 3EHQA 2LRJA 4J9CA 1ARKA 3A2ZA 1SRMA 4OMPA 2LCSA 4OMNA 1H3HA 3VS2A 2VWFA 2KE9A 1X69A 2BZ8A 1N5ZA 2JMCA 4Z88A 2RMOA 4WCIA 1GL5A 5IHKA 4DEYA 1G83A 2LNHB 4CC2A 2GNCA 1ABOA 4IIOA 1FYNA 2RQVA 2L0AA 4J9GA 4CT3A 2EYYA 2JM9A 1M3AA 4FGEA 2IO8A 3FJ5A 1K9AA 2O31A 1T3SA 2RQWA 1UDLA 1UHCA 1X6BA 3O98A 3QWYA 2DL4A 4LUEA 1GFCA 1RLPC 2XMFA 1PNJA 4RTWA 4HVWA 2FO0A 3M1UA 2LJ3A 1JXOA 4X1VA 4Z89A 1I0CA 2CH4A 2EBPA 4FQAA 2DBMA 2GTJA 3VS5A 2GBQA 5IXFA 4Y92A 1TUDA 1VYVA 1JO8A 4CSHA 5L23A 3NHNA 1AZEA 1GRIA 2J06A 3ZL7C 1ZUYA 1HJDA 1SEMA 1CSKA 1UUEA 4KRTA 1X27A 1JQQA 1ZUKA 1M3BA 1PHTA 2LJ0A 4LJ1A 2CH4W 1WXUA 2NUZA 2YUQA 4Q4GX 2J6KA 1PWTA 1XOVA 3C0CA 3VS7A 1K0SA 4J9IA 2O88A 2J05A 1H92A 1U06A 2FEIA 5FWCA 3EG0A 2JTEA 1ABQA 2DVJA 1KJWA 4K11A 1W6XA 2X3XD 3VS0A 2DL8A 3KW0A 4CC3A 1SRLA 3M0PA 2M51A 2V1QA 3KFVA 3TSZA 2CSQA 4F17A 2KXDA 3SEMA 2GGRA 1WDXA 4EQAA 1K0XA 1PKSA 2L3SA 1GBRA 1WXTA 3I35A 4HVVA 3PBCA 1Y57A 5EC7A 4JJDA 4OMMA 1A0NB 3PBIA 5IH2A 2OI3A 4J9BA 1ZUUA 2KT8A 1JU5C 1QLYA 2CUDA 1RLQC 2K2MA 2LJ1A 4J9FA 2J6OA 2KROA 3EG1A 1OPLA 5ECAA 4JXBA 2FRYA 4EQ8A 2ED1A 4LUDA 1NG2A 1NEBA 1OEBA 1TG0A 3UATA 2CSIA 2CUBA 1U5SA 2CREA 2EKHA 2IO9A 2LQNA 3PVQA 1MV3A 2DMOA 2FPDA 2CT4A 4ZNXA 3VS1A 3VRZA 2KEAA 1OOTA 4CC4B 2HDAA 2DRKA 2QDLA 1S1NA 2HCKA 4AFSC 3I86A 4HVUA 4FGIA 2I0NA 4GBQA 2JS2A 2DL7A 2LQWA 2EW3A 1BK2A 1JEGA 1YP5A 2W0ZA 4EOBA 3M0UA 2KYBA 1SPKA 2KXCA 4CGKA 2DILA 1FMKA 1BB9A 1NLOC 2RN8A 1X43A 2YDLA 2MCNA 3VPJA 1E6GA 1VA7A 5GJWB 2RQUA 1IO6A 1W70A 3PE0A 1NYGA 1RUWA 4LE9A 3H0FA 4AFQC 2KBTA 2DJQA 2A36A 1UGVA 1WA7A 1E6HA 4F0VA 4RTVA 4EIKA 2GTOA 1K1ZA 2L2PA 2D1XA 4J9EA 4OMQA 1QKWA 1YWPA 2AZVA 2KYMA 1NYFA 1BBZA 2K6DA 4JZ4A 3UA6A 1WI7A 1YCSB 2RQTA 1QWFA 2K3BA 2YSQA 3A2YA 1UJ0A 1CKBA 4RUGA 2ABLA 2BZYA 2FRWA 1WFWA 4JZ3A 2VOBA 3U23A 4F4MA 2D8JA 2MIOA 4FGDA 3NMZC 1PRLC 2PNIA 3LH5A 4D8DA 4ORZA 1GCQA 4HPEA 1MV0B 1T0HA 1EFNA 4Z8AA 1WX6A 2J6FA 2V1RA 1AWJA 2KNBB 3NGPA 1AWOA 2OAWA 2LMJA 3REAB 3PVLA 1ZSGA 4HXJA 2EGAA 4Q4NA 4F0WA 2ECZA 2X3WD 1PKTA 3RNJA 1Z9ZA 2ROLA 2YUNA 1NM7A 1U3OA 1VYUA 2JW4A 1SSHA 2K1GA 4HZ9A 2KRNA 1PRMC 1YN8A 2J7IA 4IIMA 4R0KA 2DNUA 3EG2A 2AKLA 1QWEA 2D8HA 2LP5A 2BTTA 1GCQC 4GLMA 1CKAA 4OMLA 3GT2A 1AOJA 1UECA 1G2BA 2P4RA 2C0IA 2F2VA 4E6RA 1NLPC 1T3LA 2KRMA 1QKXA 1I1JA 3GBQA 4LNPA 2EYWA 4D8KA 3I5RA 3ULRB 3IQLA 2DX1A 1VYTA 4AG1C 3THKA 2F2WA 2DM1A 3S0QA 2KT1A 5I11A 1WYXA 2AK5A 3CQTA 2JM8A 2VPSA 1UFFA 2K7AA 2DBKA 1KSWA 3M0SA 3RBBB 1KIKA 2AZSA 5IHIA 2VPMA 2ROTA 2IOBA 2FG0A 2KRSA 2DRMA 2DLPA 2LZ6B 2DA9A 3SHWA 1JXMA 2IO7A 1X2QA 1LCKA 4FSSA 2BZXA 3EG3A 4OLKA 2JMAA 5FW9A 2VKNA 3I9QA 1OPKA 3REBB 1AWXA 4AFZC 3VS6A 1AEYA 2ESWA 1SHGA 2OJ2A 1ZX6A 2B86A 1M3CA 2DF6A 2XIVA 1HSQA 2JXBA 2HSPA 1GBQA 1QCFA 4RTTA 3H0HA 2EGEA 2G6FX 2EPDA 3A30A 4RTZA 4J9DA 1X6GA 1UHFA 2K79A 1KFZA 1OV3A 4FQBA 3EHRA 3H0IA 1GFDA 1AZGB 2SRCA 2JT4A 1I07A 4HZBA 4LN2A 5FWBA 2C0OA 2YUOA 3NE0A 1Z9QA 2RF0A 2H8HA 3TSWA 3UA7A 1WLPB 2ENMA 2DYBA 4AG2C 2SEMA 1GCPA 3VS4A 2O9VA 2FPFA 5HCKA 2AKKA 3EGUA 2YT6A 3QWXX 2EGCA 2L3PA 1Y0MA 2M0YA 4FDYA 2E5KA 2KGTA 4JJCA 1AWWA 1AD5A 1AVZC 2O2OA 1UE9A 2PTKA 2RQRA 2EQIA 1ZBJA 3O5ZA 1X2KA 4JPBW 2CT3A 2K9GA 4JJBA 1ZLMA 3A98A 4ESRA 5IHNA 2GQIA 1SHFA 1UJYA 1K4US 4RTYA 4DEXA 3M0RA 2EYZA 1UG1A 4OMOA 1J3TA 2A28A 1H8KA 4F16A 2VVKA
chains in the Genus database with same CATH superfamily
3E9GA 3QO3A 4F04B 1UTIA 5I2SA 3WVEB 1HD3A 1V1CA 2QAZA 2ZZDA 2PVOB 1YIJQ 8AT1B 2MYSA 4QVDA 4F14A 2CDTA 5GAN7 2RHUA 1VQLQ 4J9HA 4CC7A 3F70A 3TU4K 4BE0A 1M90U 4OGEA 2HQHA 3A8GB 1OU8A 3CCLA 3KXTA 2D0NA 3LWIA 1WIEA 4M7AB 2EJ9A 1NE8A 2V26A 1D3BB 3QIIA 1LOJA 2O9SA 2C0TA 3V7CA 5IXBA 4M7DG 2HZYA 4RTXA 4ZN3A 4EMKB 2W10A 2JNGA 2A08A 2RJEA 3M56A 3CC2T 2A37A 1YHQA 1MUZA 4FT4A 3VS3A 5DM7R 3HP9A 3CPWA 2RK1A 1TS9A 2LRJA 4C8QE 4EMKA 3VS2A 4NS5A 3CC4Q 3CCVT 2K3YA 1N5ZA 2CP6A 3MEAA 4E7JA 4HT8A 4FYVB 4Z88A 1BI2A 4WCIA 4C8QC 2M16A 4IURA 1VQMQ 2XICA 4FL6A 1FYNA 3ZFJA 1VQ4A 1Y96B 2L0AA 3BDUA 1XJWB 1O75A 4FGEA 1U1SA 1UDLA 3O98A 2RA2A 2RH2A 2XMFA 1KK7A 4RTWA 1FXXA 2FO0A 2EQJA 2QG9B 1VQ6Q 2DBMA 3VS5A 3INZA 4KGXB 3I55Q 4LD9K 3CCLQ 1VQNA 2E4HA 3NHNA 3MCAB 1JBMA 1N8RU 3ZL7C 1VQ4T 4LDUA 5GAMd 3HL8A 1RABB 3CCMT 2DTOA 2WACA 3OMGA 3MJXA 3A8OB 4L6V5 3OS5A 1X27A 4M78A 4L5GA 2CZ0B 2EQMA 5CKFA 1G5VA 1ZUKA 1YJWT 1WXUA 3L2ZA 1BKBA 1BI3A 4M7DE 1R0CB 1VQ5Q 3VU3C 1XOVA 4PJMA 1W4SA 3VS7A 2RI5A 5GAMe 2O88A 2FVUA 1B7TA 4MDXA 2GF7A 1U06A 1WHLA 2FEIA 2VYTA 1N9RA 1VQNT 1QCOA 3G4ST 4KH0B 3SD4A 2DVJA 3CMAA 3P8BB 2HAXA 1RADB 3X28B 1KG1A 1KC8U 4PJOD 4N4HA 1W6XA 1WQWA 1QVFP 3C94A 2AT1B 2ZGWA 2DYIA 5CVIA 4CC3A 1SRLA 2DVEA 3M0PA 3CCRT 2QA4T 1N27A 2QYZA 1SF9A 2KXDA 3SEMA 1WDXA 3OYAA 1PKSA 4OB1B 3PFSA 5LJ5h 1GBRA 1NJIU 3I35A 4HVVA 4XTZA 1Y57A 4OVAA 3CMAT 1WJQA 5KYYB 2MI6A 1ZHIA 3MP1A 2A0FB 3HSBA 2OI3A 2CZ7B 5FROA 2CUDA 3HRTA 1VQKQ 4M7AE 1OX8A 4J9FA 2J6OA 1VQOA 4JXBA 4EQ8A 2ED1A 2HL5C 3NTIA 4XTWA 2BE9B 5D6WA 5KYUB 5LL6S 1VQ9Q 3C4SA 1TG0A 3A8LB 5AYFA 4PJLA 1Q82U 3JCMd 1MV3A 1D09B 4F7UA 4NL2A 4A4FA 4CC4B 2HDAA 3DB4A 2QDLA 1S1NA 4PK4A 3X24B 3EG9A 4HVUA 4FGIA 2I0NA 1BK2A 3CBMA 2HQEA 3BFMA 1BCMA 4OB0B 2KXCA 2L3RA 5D6YA 1NJIC 1FMKA 2X51A 2RN8A 2EJFA 2E65A 1E6GA 3SWNB 3G6ET 1Q82R 2NUPB 2F5KA 4AFQC 2KBTA 3OS0A 2QA4Q 1PC0A 4EPCA 1UGVA 1VQ9A 2CZ6B 4F0VA 4EIKA 2L2PA 4J9EA 4OMQA 3CMEA 2QEXQ 2KDSA 4DBQA 1QKWA 1YWPA 2KYMA 3QZ9B 2ZPIB 1Q82C 1QWFA 1BCOA 1UJ0A 1Y7XA 2P4TA 1UGRB 2K5LA 2VB6A 2FRWA 2VOBA 2EKOA 3PNWC 1VQKT 2D8JA 3OY9A 4HCZA 1RAFB 1RAIB 4PJOC 3JCMQ 4HPEA 1G3YA 4OF1A 3RIRA 5DLOA 1T0HA 2PUKB 4M75G 2J6FA 3CCJQ 3FJPA 2MK5A 2LMJA 5GANg 4QVCA 4FSXA 4PFPA 5KCOA 3E19A 5GANj 3RMQA 4QQGA 3RNJA 3I55T 1Z9ZA 1U3OA 2JW4A 1SSHA 4XQ3A 2OTLT 2KRNA 5KE2A 2KY9A 2DNUA 2GFAA 2AKLA 4AT1B 5KCHA 3JB9J 2FZCB 1MHNA 3JCMh 3OYHA 2H3JA 3MEVA 3MP6A 1S72A 5KYNA 2E6ZA 3V7RA 2K2VA 3KUFA 2BKDN 5C6SA 1IZ6A 1N8RR 5CIUA 5KYXB 1TSFA 1Q86U 3OYKA 4HCBA 3H8ZA 1KHCA 2EYWA 3JCMJ 3H9NA 2LCLA 1JJ2P 3I5RA 3IQLA 2OTJT 1VYTA 2PVGB 3THKA 3PMTA 2DM1A 1WYXA 1VIEA 1X01A 2HKNA 1KQSA 1QQJA 4KBMB 5KE3A 3V7SA 2VPMA 2ROTA 3OYDA 3NTHA 2DD4A 4JJNK 2DRMA 2DLPA 2DA9A 2JZ2A 2ZPHB 1JXMA 1LCKA 3I9QA 1N6AA 3DLLA 1OPKA 2BUDA 2FB7A 2DF6A 3CC7A 2XIVA 4BD3A 4RTTA 3J80E 5D7UA 3UWNA 2E1HA 2EGEA 2G6FX 4N4GA 5CKHA 1UHFA 2K79A 3OYLA 4FQBA 2R5MA 3H0IA 4R55A 3CCSQ 1GFDA 3GLXA 2SRCA 5I2MA 2JT4A 1I07A 5LJ5g 5FWBA 2YRCA 3E1SA 1Z9QA 5GANh 1MNDA 2H3EB 3LGLA 2XKOC 2DYBA 1VQMA 2SEMA 1M1KR 4M7DA 2RM4A 4ANJA 4M75E 2JTFA 1ZA1B 3CC2A 3MEWA 1WGSA 3OW2S 4EMKC 2E5KA 2KGTA 2CYZB 4BE1A 1AT1B 5KYWA 2RB6A 1DJ7B 1UE9A 4IUPA 4JPBW 2Y4YA 3E2UA 1ZLMA 2LQKA 4RTYA 1VQMT 3WXMB 1J3TA 3RKWA 1H8KA 3C95A 3OYGA 3LLRA 2DERA 2LX7A 3N5BB 2P0PA 1QVGS 4F7UB 3BY7A 2MWPA 4M78C 4C5EA 6AT1B 3EGXA 1B07A 2RHIA 1WXBA 2DTHA 2HBPA 2RJFA 3FIFA 4PJJA 2R57A 2IPOB 1NEGA 2QQRA 3GP8A 4M7AA 5GAOn 4HCKA 1W1FA 1WJRA 2MF2A 3CPWS 2PZ1A 4Q4TA 2RD1A 4BE2A 2IOAA 2EVRA 3AHUA 1YNZA 3NPFA 2DL5A 4LDWA 1RAEB 3H6ZA 3GPLA 2A3LA 5CQYA 1YCYA 4C92D 1OULA 3BW1A 2RPNA 5FRMA 1VIFA 1YWOA 2DZ9A 3SDZA 1RI9A 3PTAA 1WHHA 3EFSA 1C6VX 2DE0X 4M7AD 3CCMA 1WNLA 3R6OA 1JRIA 3RUXA 2F2XA 2EWNA 2JS0A 1M27C 4M4ZA 1Q7YC 1TUCA 4PFZA 1K73C 4JUVA 3L2RA 2Z0WA 4Y28E 1EZZB 3EHQA 2QDYB 3G4SQ 3G71A 4XU2A 1G3WA 2HL3A 1SRMA 4OMNA 4A4EA 3CCEQ 3RERA 4RG2A 4LXCA 5GMKi 1X69A 2BZ8A 2QEXT 5C0MA 2RMOA 1M2VA 1BI1A 4MZPA 1YI2Q 4CC2A 4IIOA 5FU6C 2RQVA 4PJOE 4ATOA 4E47A 2HMAA 2JOYA 2ZPEB 4CT3A 1RL2A 2VASA 2EJGA 3FJ5A 2O4XB 4P5NA 2CKKA 2R58A 4E2FB 1PNJA 1V76A 2CGHA 4IUTA 2LJ3A 2EBPA 4FQAA 5IXFA 3JAME 2DXCA 2PQWA 1VYVA 4X9DA 3CCUQ 3CC4A 2XDBA 3QYGB 1VQOT 1HJDA 2CP3A 4ZGJB 2LDMA 5GAMh 3E9FA 3D7SB 1M3BA 1HXDA 1N8RC 1ZSZC 4QKUA 1YHQQ 2IVWA 5J39A 5LJ5e 3C0CA 3GOXA 2RK2A 4CRIA 2CP5A 3SWNA 2FHDA 5CK9A 1KJWA 5GAN6 4K11A 4DBFA 3PT9A 3KW0A 4F7UE 1MMNA 2DD5A 4BDZA 3GIBA 5D6XA 3OBYA 2CSQA 5CR2A 3EG9B 2GGRA 4GY5A 3EGDB 2X35A 2L3SA 2X4YA 1WXTA 4IKFA 4UC4A 5EC7A 4JJDA 1A0NB 2P0KA 3M9QA 1ZUUA 3I56Q 1QLYA 3QSUA 2LJ1A 4RCBA 2GFUA 2KROA 3EFOB 1VQPQ 1Q95G 4JLIA 1I5LA 2D6FA 4JRKA 1M1GA 1NEBA 2QTVA 3BE3A 2R5AA 1D1AA 3UPUA 3RKYA 2CZ1B 2VV5A 3MKDA 2CT4A 4ZNXA 1VQPA 3J81E 4C0ZA 2DRKA 2RO0A 4C8QF 4FYWB 3HHTB 2K5FA 2QQ9A 3MP8A 2LT4A 2IG0A 4GBQA 2JS2A 2DL7A 2EW3A 2LQWA 3URGA 1JEGA 3CCQQ 1EX4A 3I55A 3M0UA 1KD1C 1SPKA 1NPPA 1BB9A 4BY6B 1X75C 1X43A 1IO6A 1MGQA 1NYGA 1Q81U 4NOYA 2A36A 4WTOB 1WA7A 1TU0B 2XIDA 2GTOA 1K1ZA 3M58A 4OP0A 5GAN8 4JZ4A 3UA6A 2QXFA 1WI7A 4XU1A 2YSQA 3S3MA 2E6NA 4M77D 1YI2T 1QVPA 1TUGB 2ABLA 2Y4XA 2BZYA 4JZ3A 4FW1A 1VUBA 1PRLC 3QJ6A 3CCVA 4ORZA 1M1FA 1ZQ1A 3QDRB 3L2WA 1MV0B 4F7UG 4N4IA 1V29B 2V1RA 1AWJA 1AWOA 2XU8A 5CKBA 2E41A 3P8DA 1WJSA 3NFCA 5GAN2 3LWHA 2ECZA 1PKTA 2DIQA 1Y96A 2FZKB 2YUNA 1NM7A 1VYUA 2K1GA 4C92E 3EFOA 1K9MU 3GF5A 4XU3A 3CCQA 3A8HB 1VQOQ 2AHJB 2HD0A 4C8QG 1NPRA 2QK0A 4MMLA 3JCMf 5GAOq 4GLMA 1D0YA 1CKAA 3JCMg 2DXUA 5LJ3g 2DKGA 1G2BA 3G6EQ 2LRQA 4O6JA 2P4RA 1HYOA 2QASA 4JRQA 3CCET 1W2BS 1NLPC 1PCXA 3GNFB 1QKXA 4KUIA 1G3TA 3HPWA 2HNIA 5HK3A 1UEBA 4LNPA 4XTXA 4D8KA 1YIJA 1WQ7A 4DOVA 2DX1A 1YJWA 2V8IA 1KC8C 3EH2A 1WHMA 2F2WA 2DK3A 3EBQA 4R56A 3CQTA 2VPSA 3CD6T 2K7AA 4QQ6A 5FRNA 1TXQA 1B34B 5I21A 4PJOA 2AZSA 1Q7YR 4FYXB 5FLXE 2O01E 3A5ZB 1YJNQ 4M75A 3OYEA 1K8AR 1HK9A 3BDLA 1VQ6T 4FSSA 3VJPA 2JMAA 4C5GA 2G3RA 4DA4A 1YIJT 1YJ9T 4AFZC 4BI3A 3VS6A 2ESWA 3L42A 2COWA 2OJ2A 1OZ3A 2RHYA 3VYHB 1QCFA 3H0HA 3CXCA 2YLCA 1XTDA 3OS1A 2XHCA 4RTZA 5J26A 1X6GA 3HKSA 3FB9A 1O9SA 3J7AF 4A53A 1NBEB 2CP2A 3M55A 4E7ZA 4RCCA 3EAEA 1VQ6A 1M1KU 9ATCB 1JJ2A 4LN2A 2M02A 1MMGA 1KQSP 1VQNQ 5CAIA 1WLPB 3CC2Q 1YJ9A 4DOWA 4JURA 1YFNA 4M77G 3VS4A 3EGUA 3V8JA 4M7DC 4LDVA 4ZN1A 1C0MA 1FMVA 5CO7A 2X4WA 2YRDA 4FDYA 5HY6A 4PL6A 1AWWA 1AD5A 1RAAB 1AVZC 3OS2A 1OI1A 3O5ZA 2CT3A 4L59A 3V8LA 2DFUA 1UB4A 3CD6Q 4KULA 2QA4A 5IHNA 2F1LA 2EIFA 1SHFA 1K4US 3M0RA 2EYZA 2A28A 4F16A 2VVKA 5IN1A 1M8MA 3I5SA 3L1AA 1VQ8T 1PM3A 3R6NA 3S6WA 3VPIA 3ASKA 3SFMA 3V8KA 4EMHA 5LJ3e 1VQ9T 3M54A 1YJ9Q 5CKEA 2DL3A 2K3AA 2MAMA 1IHWA 4M7AC 2RNAA 1OYXA 4M78G 1QW1A 2VC8A 2BE7D 2HBWA 2ED0A 4A63B 2YUPA 2E64A 1X6OA 4JRIA 2E5QA 1QVGA 3M0QA 3M0TA 4B9WA 3CCMQ 1VQKA 4C0GA 4C5IA 5I22A 3PGGA 2WP7A 3EGDA 3H41A 1M30A 4BY6C 4E7HA 1MNEA 5LJ5j 3VRYA 4QT7A 1T0JA 3M53A 4J30A 4RMOA 5GJVB 1VOMA 4J9CA 3DLMA 4KUDK 1OZ2A 3VKIA 1H3HA 3I56A 2OTLA 1D3BA 3A8MB 5KYWB 4IUUA 5IAYA 5KH6A 2MPXC 3CCRQ 1M1KC 1GL5A 4DEYA 1G83A 2LNHB 3GNGA 2GNCA 2DTIA 3CMET 4M7DB 1S72T 2JN0A 2EYYA 2JM9A 3META 1VQ7T 3RDVA 4M7AG 1K9AA 2RQWA 1T3SA 1UHCA 1X6BA 4A4HA 2DL4A 2E10A 4LUEA 1TH7A 2LVMA 2V8KA 2LX9A 3JRZA 3I56T 1M90C 3OB9A 1JXOA 4C92B 4FT2A 3S3NA 4Y92A 2JUFA 5GMKe 4PJOF 3AT1B 1JO8A 4CSHA 2DIGA 1AZEA 3OQ5A 2DXBA 3JB9D 1M2OA 1SG5A 3OYFA 1ZBXA 1ZUYA 4KRTA 3RMSA 5GAMf 2LCCA 1JQQA 1P92A 3FRNA 1N9SA 2YRVA 3SWNC 3QZ5B 1D0XA 2KI7A 3QDFA 1K9MC 1K0SA 4V2SA 2P0QA 1M2VB 2J05A 5FWCA 1EIFA 3JCMP 3CC7T 2JTEA 1ABQA 3MHXA 1ZSZB 4II1A 3NTKA 3CXCP 3G7ZA 3CCVQ 3OMCA 1R8OB 2X3XD 4HCCA 1QVFA 4OB2B 2DL8A 1OU9A 3CBPA 4Q5WA 2M51A 4E7SA 4F17A 1XQHA 4EQAA 4M77E 1K0XA 1D1BA 2ZPBB 1YJNT 4AMCA 1VQ7Q 4PNOA 4PFOA 5GAOr 5LJ3h 2ZAEA 1NJIR 1PD1A 4J9BA 1R0BG 2KT8A 1JU5C 2LQ8A 3FEOA 1RLQC 3RESA 4C92F 4M75B 5GMKl 2WSEE 2GCXA 4M77B 2VXFA 3EG1A 4EDUA 3JCMW 1OPLA 3G1JA 2FRYA 1NG2A 4M77F 3CCLT 1B34A 1OEBA 4ZGDB 3UATA 3FDRA 2CSIA 1I4K1 2CUBA 2CREA 4QQDA 2NYSA 2LQNA 3PVQA 1ZA2B 2DMOA 3OBWA 1KC8R 4PJOG 3VRZA 4HFKA 2FL7A 2Y90A 4AFSC 2B8AA 1YHQT 2KVQG 3QBYA 4JLGA 1YP5A 2W0ZA 4JRPA 4PKCC 2YDLA 3OYNA 1IGQA 2MCNA 1I8FA 1PD0A 2COYA 5GJWB 3CPWP 2RQUA 5HK0A 5DY9A 2M0OA 2YHTA 1LJOA 3JB9I 3QKJA 3PE0A 3CEYA 4BUGA 3LYIA 2HSEB 4MDWA 4A4KA 3JB9H 1Q7YU 2DJQA 1KQ1A 2CS7A 2QI2A 3PIPA 2D1XA 4J5YA 2K6DA 1BBZA 2DZCA 4ELYC 3EFRA 3M5AA 5GAN5 1LNXA 2WSCE 3A2YA 1LPLA 4BACA 2EAYA 2PUOB 1CKBA 4BI4A 2RJDA 1JB0E 1WFWA 3U23A 4C8QD 3G71T 4F4MA 2MIOA 4HT9A 2D0QB 4D8DA 4BB7A 4Z8AA 4C92G 2KNBB 4C8QB 3REAB 3PVLA 5LJ5d 1ZSGA 2CP7A 2EGAA 2CP0A 4J7IA 3QYHB 3QHSA 4Q4NA 4OGCA 1KQ2A 4F0WA 2X3WD 3JCMb 4CI0C 1K9MR 4HZ9A 1UGPB 1PRMC 2J7IA 1RAHB 3EG2A 1M5Q1 1QWEA 2K57A 3QG1A 4KGZB 3QPHA 2D8HA 2LP5A 2BTTA 1QP2A 1SKUB 1GCQC 2X9HA 4OMLA 3GT2A 5GANe 1UECA 2COZA 2EQKA 2F2VA 3CC4T 1PSEA 2KAFA 5CQXA 4E6RA 1T3LA 2KMTA 2L8DA 3JCMc 1I1JA 3CC7Q 2EFIA 1BI0A 1M90R 1IREB 3ULRB 3OA6A 2E3IA 2WSFE 5I11A 2AK5A 1KD1U 3HTRA 1UFFA 2QQSA 4J8OA 2OX7A 3OYCA 3RBBB 5EG2A 1BIAA 1RACB 3M57A 5IHIA 3G71Q 4BDYA 1KQSS 3L2UA 4LDXA 1NZ9A 2IO7A 3EG3A 5FW9A 2VKNA 3A1PA 1BYMA 3EGXB 4C8QA 1AEYA 1TOVA 2L5QA 3JCMX 3CPFA 4RKUE 1ZX6A 1VQ8A 2B86A 3ER0A 1HSQA 2DJZA 2HSPA 1GBQA 2EYQA 5A2QE 4M78E 4B9XA 4FCYA 3A30A 4J9DA 4C92A 3EHRA 1H641 1AZGB 2FYKA 4M77C 2V8JA 2VUBA 4M75D 4HZBA 5GANd 2C0OA 3JCMe 3NE0A 5IT9E 3UA7A 2H8HA 3G6EA 2ENMA 2E70A 2O9VA 2FPFA 3M4GA 3CXCS 1D1CA 1M4ZA 4NL3A 3OW2A 2L3PA 2RHZA 3VUBA 4HA8A 1K73R 2QQAA 2O2OA 2PTKA 2RQRA 3PMIA 1X2KA 1G3SA 2K3XA 2K9GA 1D0ZA 2VXEA 4WF2A 3A98A 4GLKA 4ESRA 2P84A 5M9OA 2GQIA 1UJYA 2ZPGB 5FU7C 4C92C 1UG1A 4OMOA 5GAOm 3CCSA 2EQUA 2DO3A 3L2QA 3JB9F 2XDPA 4AFUC 1W2BA 2O4XA 2IF6A 2K4YA 2HQXA 1B3QA 2HEQA 2XG8D 4A4GA 4J32A 4OMFB 4FIBA 1H3ZA 4A54A 2IIMA 4XTUA 1QVGP 1BU1A 3CCST 1YI2A 2L3QA 8ATCB 3TVTA 1YITQ 1K76A 2EYXA 2FPEA 4Y91A 1I81A 5GMKh 3X20B 1MMAA 1E7OA 2MOXA 5GAN3 2PU9B 1C1AA 2BIVA 3JV3A 4RTUA 4HKEA 4F7UF 5GAMj 4EMGA 3UF4A 2LNVA 4E7LA 2KR3A 2F5TX 2NWMA 2E3HA 1JJ2S 1KHIA 4XK8E 1ARKA 3A2ZA 4OMPA 3MEUA 2LCSA 4BI8B 2VWFA 4XTVA 2KE9A 3LW5E 4FW2A 2JMCA 2PVDB 4M75F 5IHKA 1G8XA 1K8AU 1QVFS 3C12A 2X4JA 4LD6A 3DB3A 3X26B 1ABOA 3OSSC 4J9GA 1M3AA 3CCEA 1YBYA 2IO8A 4M78B 3VV0A 2O31A 3PIOA 3QWYA 2XK0A 1PSFA 3M59A 1GFCA 1RLPC 1IGUA 2NLUA 4ME7A 1YJNA 2DEUA 7AT1B 3CCJT 3OSVA 4HVWA 3M1UA 4Z89A 4X1VA 1I0CA 2CH4A 4KGVB 2OAUA 2GTJA 2GBQA 2JTMA 2KK4A 1TUDA 5L23A 2OTLQ 1GRIA 1IB8A 2J06A 4JS4A 3TQ7P 4HFFA 1RAGB 1SEMA 1CSKA 1UUEA 3X25B 1YITT 1R77A 3JSCA 4C0DB 5A0LA 1PHTA 2LJ0A 4LJ1A 2CH4W 3CCJA 1WHGA 2NUZA 4M75C 2YUQA 4Q4GX 1QCNA 2ZCFB 2DETA 4DBHA 1UGSB 2J6KA 1PWTA 3CCQT 1TWBA 3OYBA 1Q86C 4J9IA 3M4YA 1H92A 2LTOA 2XD0A 3EG0A 2C06A 2RI3A 3OYIA 3T9NA 4E7IA 2KSSA 2MWOA 2KQWA 3SB2A 3VS0A 2F69A 1RI0A 1YITA 2DAQA 2V1QA 3KFVA 3TSZA 2A7YA 4B6MA 2GQVA 5A0GA 3OYYA 1FX7A 5LJ5f 2FZGB 5GAN4 4HFLA 3PBCA 1IRXA 3CD6A 1FWZA 4OMMA 3PBIA 5LJ3f 5IH2A 5KYUA 2K2MA 3MO8A 5ECAA 4PLIA 3L2VA 4LUDA 4J6WA 3WVDB 1K8AC 4QW2A 5KYYA 4XTYA 1Q81R 1WHJA 2DPPB 3KBGA 2MMPA 5LJ3d 1U5SA 5GAOp 5AT1B 2EKHA 2IO9A 4ZGEB 1ACMB 4O5VA 3VS1A 2FPDA 2LC4A 3HRSA 4ELZC 2KEAA 4LDYA 1OOTA 3Q1JA 2QTXA 4RG8A 3HFNA 3DKMA 2HCKA 3I86A 3G4SA 3FC3A 4FM4B 1VQ5T 5KYXA 4EOBA 1OX9A 3MPUB 4ZTJA 2KYBA 4CGKA 2DILA 1NLOC 4OB3B 3VPJA 3CCRA 4PLLA 4X34A 1VA7A 4KH1B 5HKCA 5LJ3j 1W70A 2JVVA 3EH1A 1RUWA 2ZPFB 4XU0A 4LE9A 3H0FA 3ME9A 3FLGA 4MZMA 3JB9G 2X4XA 1WZOA 1VQLA 1E6HA 4IUVA 4M7DF 2RHXA 4RTVA 4C0FA 1I5OB 1VQ5A 2AZVA 1NYFA 1YCSB 2RQTA 4C5HA 1IXDA 2K3BA 2I2LA 3JCMV 3P8HA 1VQ8Q 2K5IA 1SSFA 4MMKA 4RUGA 2VGMA 1Q86R 4KT0E 4JS5A 3NMZC 3HRUA 2PNIA 3LH5A 1VQLT 4TVRA 3OYMA 1GCQA 2NUTB 3HFOA 4VUBA 5DLQE 3RR6A 1F1BB 1U8RA 4N0AC 1EFNA 1TTHB 1WX6A 3VUZA 3NGPA 1UGQB 2OAWA 3VYGA 2QQBA 2E12A 4HXJA 3TEEA 2ROLA 1W2BP 1VQ7A 3CCUT 4M7AF 4J6XA 2QEXA 2YXYA 1YN8A 3LH0A 4IIMA 3TREA 4R0KA 1VQ4Q 4D6WA 4PJOB 5A0DA 1IHVA 2NUPA 4ZTFA 4PJNA 2JJ9A 2XDDA 1YJWQ 3LX7A 5CKDA 3OW2P 2QGGA 1AOJA 1Q81C 2C0IA 2DXTA 3LGFA 1Y07A 2RJCA 4M78D 1PG5B 2KRMA 4YTLA 4E7KA 2ATCB 4C0DC 1WPYA 3GBQA 3CCUA 5GMKj 5GMKm 1Y71A 1KD1R 1QP3A 1GXIE 5GAOl 4AG1C 3QXEB 3CMEQ 3S0QA 2KT1A 2JM8A 5GAMg 2DBKA 1KSWA 3M0SA 1M8VA 4J83A 1KIKA 4M77A 3TCJA 2IOBA 3OYJA 2FG0A 5CCAA 2KRSA 2LZ6B 3SHWA 3QJYA 1X2QA 3UT1A 3CBOA 2BZXA 3ZBDA 4OLKA 4M78F 4X9CA 1U1TA 5FU7B 3O8VA 3REBB 1AWXA 4M7DD 1SHGA 1M3CA 4FYYB 4J6YA 2M9UA 2JXBA 1VQPT 1K73U 2NUTA 1OQKA 2EPDA 4Z02A 2QGFB 5J3BA 1KFZA 1OV3A 3QUIA 4QVZA 2YLBA 4XAXB 1BIBA 3RKXA 3ZEHA 4DBRA 1WHKA 2YUOA 4N0AA 2M1HA 1ZSZA 2RF0A 3TSWA 5GANf 4MZTA 4AG2C 4FU6A 2AIRB 1AHJB 1GCPA 5HCKA 2OTJA 2AKKA 2YT6A 2RI2A 5FU6B 3QWXX 2LT1A 2EGCA 1FMWA 1Y0MA 2M0YA 2OTJQ 4JJCA 1MMDA 2D9TA 4J7FA 5L8RE 1LVKA 4JDSA 2L89A 2HKQB 2VGNA 2YWWA 3S3OA 2EQIA 1XNIA 1ZBJA 3UDCA 1M9SA 2XI9A 4JJBA 3CMAQ 4IUQA 4DEXA 4DQ2A 2DEQA 1S72Q 4FGDA 1QMCA
chains in the Genus database with same CATH topology
1M8MA 2LX7A 3I5SA 1UTIA 3R6NA 3VPIA 1HD3A 1V1CA 4AFUC 1B07A 1WXBA 4F14A 2IF6A 2CDTA 1B3QA 1NEGA 2HEQA 2DL3A 4HCKA 1W1FA 2K3AA 2PZ1A 4J9HA 4CC7A 4Q4TA 2RNAA 2IOAA 2EVRA 1YNZA 3NPFA 2DL5A 2HBWA 2ED0A 4A63B 2IIMA 2YUPA 2D0NA 1BU1A 1WIEA 2L3QA 2RPNA 3M0QA 3M0TA 5IXBA 1YWOA 2O9SA 2C0TA 3TVTA 5I22A 1K76A 4RTXA 2EYXA 1RI9A 2FPEA 2W10A 1E7OA 2A08A 3H41A 2MOXA 1M30A 2A37A 2DE0X 3JV3A 4RTUA 3VRYA 1MUZA 3VS3A 2F2XA 4QT7A 1T0JA 2JS0A 3UF4A 1M27C 4M4ZA 1TUCA 2KR3A 5GJVB 2NWMA 3EHQA 2LRJA 4J9CA 1ARKA 3A2ZA 1SRMA 4OMPA 2LCSA 4OMNA 1H3HA 3VS2A 2VWFA 2KE9A 1X69A 2BZ8A 1N5ZA 2JMCA 4Z88A 2RMOA 4WCIA 1GL5A 5IHKA 4DEYA 1G83A 2LNHB 4CC2A 2GNCA 1ABOA 4IIOA 1FYNA 2RQVA 2L0AA 4J9GA 4CT3A 2EYYA 2JM9A 1M3AA 4FGEA 2IO8A 3FJ5A 1K9AA 2O31A 1T3SA 2RQWA 1UDLA 1UHCA 1X6BA 3O98A 3QWYA 2DL4A 4LUEA 1GFCA 1RLPC 2XMFA 1PNJA 4RTWA 4HVWA 2FO0A 3M1UA 2LJ3A 1JXOA 4X1VA 4Z89A 1I0CA 2CH4A 2EBPA 4FQAA 2DBMA 2GTJA 3VS5A 2GBQA 5IXFA 4Y92A 1TUDA 1VYVA 1JO8A 4CSHA 5L23A 3NHNA 1AZEA 1GRIA 2J06A 3ZL7C 1ZUYA 1HJDA 1SEMA 1CSKA 1UUEA 4KRTA 1X27A 1JQQA 1ZUKA 1M3BA 1PHTA 2LJ0A 4LJ1A 2CH4W 1WXUA 2NUZA 2YUQA 4Q4GX 2J6KA 1PWTA 1XOVA 3C0CA 3VS7A 1K0SA 4J9IA 2O88A 2J05A 1H92A 1U06A 2FEIA 5FWCA 3EG0A 2JTEA 1ABQA 2DVJA 1KJWA 4K11A 1W6XA 2X3XD 3VS0A 2DL8A 3KW0A 4CC3A 1SRLA 3M0PA 2M51A 2V1QA 3KFVA 3TSZA 2CSQA 4F17A 2KXDA 3SEMA 2GGRA 1WDXA 4EQAA 1K0XA 1PKSA 2L3SA 1GBRA 1WXTA 3I35A 4HVVA 3PBCA 1Y57A 5EC7A 4JJDA 4OMMA 1A0NB 3PBIA 5IH2A 2OI3A 4J9BA 1ZUUA 2KT8A 1JU5C 1QLYA 2CUDA 1RLQC 2K2MA 2LJ1A 4J9FA 2J6OA 2KROA 3EG1A 1OPLA 5ECAA 4JXBA 2FRYA 4EQ8A 2ED1A 4LUDA 1NG2A 1NEBA 1OEBA 1TG0A 3UATA 2CSIA 2CUBA 1U5SA 2CREA 2EKHA 2IO9A 2LQNA 3PVQA 1MV3A 2DMOA 2FPDA 2CT4A 4ZNXA 3VS1A 3VRZA 2KEAA 1OOTA 4CC4B 2HDAA 2DRKA 2QDLA 1S1NA 2HCKA 4AFSC 3I86A 4HVUA 4FGIA 2I0NA 4GBQA 2JS2A 2DL7A 2LQWA 2EW3A 1BK2A 1JEGA 1YP5A 2W0ZA 4EOBA 3M0UA 2KYBA 1SPKA 2KXCA 4CGKA 2DILA 1FMKA 1BB9A 1NLOC 2RN8A 1X43A 2YDLA 2MCNA 3VPJA 1E6GA 1VA7A 5GJWB 2RQUA 1IO6A 1W70A 3PE0A 1NYGA 1RUWA 4LE9A 3H0FA 4AFQC 2KBTA 2DJQA 2A36A 1UGVA 1WA7A 1E6HA 4F0VA 4RTVA 4EIKA 2GTOA 1K1ZA 2L2PA 2D1XA 4J9EA 4OMQA 1QKWA 1YWPA 2AZVA 2KYMA 1NYFA 1BBZA 2K6DA 4JZ4A 3UA6A 1WI7A 1YCSB 2RQTA 1QWFA 2K3BA 2YSQA 3A2YA 1UJ0A 1CKBA 4RUGA 2ABLA 2BZYA 2FRWA 1WFWA 4JZ3A 2VOBA 3U23A 4F4MA 2D8JA 2MIOA 4FGDA 3NMZC 1PRLC 2PNIA 3LH5A 4D8DA 4ORZA 1GCQA 4HPEA 1MV0B 1T0HA 1EFNA 4Z8AA 1WX6A 2J6FA 2V1RA 1AWJA 2KNBB 3NGPA 1AWOA 2OAWA 2LMJA 3REAB 3PVLA 1ZSGA 4HXJA 2EGAA 4Q4NA 4F0WA 2ECZA 2X3WD 1PKTA 3RNJA 1Z9ZA 2ROLA 2YUNA 1NM7A 1U3OA 1VYUA 2JW4A 1SSHA 2K1GA 4HZ9A 2KRNA 1PRMC 1YN8A 2J7IA 4IIMA 4R0KA 2DNUA 3EG2A 2AKLA 1QWEA 2D8HA 2LP5A 2BTTA 1GCQC 4GLMA 1CKAA 4OMLA 3GT2A 1AOJA 1UECA 1G2BA 2P4RA 2C0IA 2F2VA 4E6RA 1NLPC 1T3LA 2KRMA 1QKXA 1I1JA 3GBQA 4LNPA 2EYWA 4D8KA 3I5RA 3ULRB 3IQLA 2DX1A 1VYTA 4AG1C 3THKA 2F2WA 2DM1A 3S0QA 2KT1A 5I11A 1WYXA 2AK5A 3CQTA 2JM8A 2VPSA 1UFFA 2K7AA 2DBKA 1KSWA 3M0SA 3RBBB 1KIKA 2AZSA 5IHIA 2VPMA 2ROTA 2IOBA 2FG0A 2KRSA 2DRMA 2DLPA 2LZ6B 2DA9A 3SHWA 1JXMA 2IO7A 1X2QA 1LCKA 4FSSA 2BZXA 3EG3A 4OLKA 2JMAA 5FW9A 2VKNA 3I9QA 1OPKA 3REBB 1AWXA 4AFZC 3VS6A 1AEYA 2ESWA 1SHGA 2OJ2A 1ZX6A 2B86A 1M3CA 2DF6A 2XIVA 1HSQA 2JXBA 2HSPA 1GBQA 1QCFA 4RTTA 3H0HA 2EGEA 2G6FX 2EPDA 3A30A 4RTZA 4J9DA 1X6GA 1UHFA 2K79A 1KFZA 1OV3A 4FQBA 3EHRA 3H0IA 1GFDA 1AZGB 2SRCA 2JT4A 1I07A 4HZBA 4LN2A 5FWBA 2C0OA 2YUOA 3NE0A 1Z9QA 2RF0A 2H8HA 3TSWA 3UA7A 1WLPB 2ENMA 2DYBA 4AG2C 2SEMA 1GCPA 3VS4A 2O9VA 2FPFA 5HCKA 2AKKA 3EGUA 2YT6A 3QWXX 2EGCA 2L3PA 1Y0MA 2M0YA 4FDYA 2E5KA 2KGTA 4JJCA 1AWWA 1AD5A 1AVZC 2O2OA 1UE9A 2PTKA 2RQRA 2EQIA 1ZBJA 3O5ZA 1X2KA 4JPBW 2CT3A 2K9GA 4JJBA 1ZLMA 3A98A 4ESRA 5IHNA 2GQIA 1SHFA 1UJYA 1K4US 4RTYA 4DEXA 3M0RA 2EYZA 1UG1A 4OMOA 1J3TA 2A28A 1H8KA 4F16A 2VVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8M A;  2LX7 A;  3I5S A;  1UTI A;  3R6N A;  3VPI A;  1HD3 A;  1V1C A;  4AFU C;  1B07 A;  1WXB A;  4F14 A;  2IF6 A;  2CDT A;  1B3Q A;  1NEG A;  2HEQ A;  2DL3 A;  4HCK A;  1W1F A;  2K3A A;  2PZ1 A;  4J9H A;  4CC7 A;  4Q4T A;  2RNA A;  2IOA A;  2EVR A;  1YNZ A;  3NPF A;  2DL5 A;  2HBW A;  2ED0 A;  4A63 B;  2IIM A;  2YUP A;  2D0N A;  1BU1 A;  1WIE A;  2L3Q A;  2RPN A;  3M0Q A;  3M0T A;  5IXB A;  1YWO A;  2O9S A;  2C0T A;  3TVT A;  5I22 A;  1K76 A;  4RTX A;  2EYX A;  1RI9 A;  2FPE A;  2W10 A;  1E7O A;  2A08 A;  3H41 A;  2MOX A;  1M30 A;  2A37 A;  2DE0 X;  3JV3 A;  4RTU A;  3VRY A;  1MUZ A;  3VS3 A;  2F2X A;  4QT7 A;  1T0J A;  2JS0 A;  3UF4 A;  1M27 C;  4M4Z A;  1TUC A;  2KR3 A;  5GJV B;  2NWM A;  3EHQ A;  2LRJ A;  4J9C A;  1ARK A;  3A2Z A;  1SRM A;  4OMP A;  2LCS A;  4OMN A;  1H3H A;  3VS2 A;  2VWF A;  2KE9 A;  1X69 A;  2BZ8 A;  1N5Z A;  2JMC A;  4Z88 A;  2RMO A;  4WCI A;  1GL5 A;  5IHK A;  4DEY A;  1G83 A;  2LNH B;  4CC2 A;  2GNC A;  1ABO A;  4IIO A;  1FYN A;  2RQV A;  2L0A A;  4J9G A;  4CT3 A;  2EYY A;  2JM9 A;  1M3A A;  4FGE A;  2IO8 A;  3FJ5 A;  1K9A A;  2O31 A;  1T3S A;  2RQW A;  1UDL A;  1UHC A;  1X6B A;  3O98 A;  3QWY A;  2DL4 A;  4LUE A;  1GFC A;  1RLP C;  2XMF A;  1PNJ A;  4RTW A;  4HVW A;  2FO0 A;  3M1U A;  2LJ3 A;  1JXO A;  4X1V A;  4Z89 A;  1I0C A;  2CH4 A;  2EBP A;  4FQA A;  2DBM A;  2GTJ A;  3VS5 A;  2GBQ A;  5IXF A;  4Y92 A;  1TUD A;  1VYV A;  1JO8 A;  4CSH A;  5L23 A;  3NHN A;  1AZE A;  1GRI A;  2J06 A;  3ZL7 C;  1ZUY A;  1HJD A;  1SEM A;  1CSK A;  1UUE A;  4KRT A;  1X27 A;  1JQQ A;  1ZUK A;  1M3B A;  1PHT A;  2LJ0 A;  4LJ1 A;  2CH4 W;  1WXU A;  2NUZ A;  2YUQ A;  4Q4G X;  2J6K A;  1PWT A;  1XOV A;  3C0C A;  3VS7 A;  1K0S A;  4J9I A;  2O88 A;  2J05 A;  1H92 A;  1U06 A;  2FEI A;  5FWC A;  3EG0 A;  2JTE A;  1ABQ A;  2DVJ A;  1KJW A;  4K11 A;  1W6X A;  2X3X D;  3VS0 A;  2DL8 A;  3KW0 A;  4CC3 A;  1SRL A;  3M0P A;  2M51 A;  2V1Q A;  3KFV A;  3TSZ A;  2CSQ A;  4F17 A;  2KXD A;  3SEM A;  2GGR A;  1WDX A;  4EQA A;  1K0X A;  1PKS A;  2L3S A;  1GBR A;  1WXT A;  3I35 A;  4HVV A;  3PBC A;  1Y57 A;  5EC7 A;  4JJD A;  4OMM A;  1A0N B;  3PBI A;  5IH2 A;  2OI3 A;  4J9B A;  1ZUU A;  2KT8 A;  1JU5 C;  1QLY A;  2CUD A;  1RLQ C;  2K2M A;  2LJ1 A;  4J9F A;  2J6O A;  2KRO A;  3EG1 A;  1OPL A;  5ECA A;  4JXB A;  2FRY A;  4EQ8 A;  2ED1 A;  4LUD A;  1NG2 A;  1NEB A;  1OEB A;  1TG0 A;  3UAT A;  2CSI A;  2CUB A;  1U5S A;  2CRE A;  2EKH A;  2IO9 A;  2LQN A;  3PVQ A;  1MV3 A;  2DMO A;  2FPD A;  2CT4 A;  4ZNX A;  3VS1 A;  3VRZ A;  2KEA A;  1OOT A;  4CC4 B;  2HDA A;  2DRK A;  2QDL A;  1S1N A;  2HCK A;  4AFS C;  3I86 A;  4HVU A;  4FGI A;  2I0N A;  4GBQ A;  2JS2 A;  2DL7 A;  2LQW A;  2EW3 A;  1BK2 A;  1JEG A;  1YP5 A;  2W0Z A;  4EOB A;  3M0U A;  2KYB A;  1SPK A;  2KXC A;  4CGK A;  2DIL A;  1FMK A;  1BB9 A;  1NLO C;  2RN8 A;  1X43 A;  2YDL A;  2MCN A;  3VPJ A;  1E6G A;  1VA7 A;  5GJW B;  2RQU A;  1IO6 A;  1W70 A;  3PE0 A;  1NYG A;  1RUW A;  4LE9 A;  3H0F A;  4AFQ C;  2KBT A;  2DJQ A;  2A36 A;  1UGV A;  1WA7 A;  1E6H A;  4F0V A;  4RTV A;  4EIK A;  2GTO A;  1K1Z A;  2L2P A;  2D1X A;  4J9E A;  4OMQ A;  1QKW A;  1YWP A;  2AZV A;  2KYM A;  1NYF A;  1BBZ A;  2K6D A;  4JZ4 A;  3UA6 A;  1WI7 A;  1YCS B;  2RQT A;  1QWF A;  2K3B A;  2YSQ A;  3A2Y A;  1UJ0 A;  1CKB A;  4RUG A;  2ABL A;  2BZY A;  2FRW A;  1WFW A;  4JZ3 A;  2VOB A;  3U23 A;  4F4M A;  2D8J A;  2MIO A;  4FGD A;  3NMZ C;  1PRL C;  2PNI A;  3LH5 A;  4D8D A;  4ORZ A;  1GCQ A;  4HPE A;  1MV0 B;  1T0H A;  1EFN A;  4Z8A A;  1WX6 A;  2J6F A;  2V1R A;  1AWJ A;  2KNB B;  3NGP A;  1AWO A;  2OAW A;  2LMJ A;  3REA B;  3PVL A;  1ZSG A;  4HXJ A;  2EGA A;  4Q4N A;  4F0W A;  2ECZ A;  2X3W D;  1PKT A;  3RNJ A;  1Z9Z A;  2ROL A;  2YUN A;  1NM7 A;  1U3O A;  1VYU A;  2JW4 A;  1SSH A;  2K1G A;  4HZ9 A;  2KRN A;  1PRM C;  1YN8 A;  2J7I A;  4IIM A;  4R0K A;  2DNU A;  3EG2 A;  2AKL A;  1QWE A;  2D8H A;  2LP5 A;  2BTT A;  1GCQ C;  4GLM A;  1CKA A;  4OML A;  3GT2 A;  1AOJ A;  1UEC A;  1G2B A;  2P4R A;  2C0I A;  2F2V A;  4E6R A;  1NLP C;  1T3L A;  2KRM A;  1QKX A;  1I1J A;  3GBQ A;  4LNP A;  2EYW A;  4D8K A;  3I5R A;  3ULR B;  3IQL A;  2DX1 A;  1VYT A;  4AG1 C;  3THK A;  2F2W A;  2DM1 A;  3S0Q A;  2KT1 A;  5I11 A;  1WYX A;  2AK5 A;  3CQT A;  2JM8 A;  2VPS A;  1UFF A;  2K7A A;  2DBK A;  1KSW A;  3M0S A;  3RBB B;  1KIK A;  2AZS A;  5IHI A;  2VPM A;  2ROT A;  2IOB A;  2FG0 A;  2KRS A;  2DRM A;  2DLP A;  2LZ6 B;  2DA9 A;  3SHW A;  1JXM A;  2IO7 A;  1X2Q A;  1LCK A;  4FSS A;  2BZX A;  3EG3 A;  4OLK A;  2JMA A;  5FW9 A;  2VKN A;  3I9Q A;  1OPK A;  3REB B;  1AWX A;  4AFZ C;  3VS6 A;  1AEY A;  2ESW A;  1SHG A;  2OJ2 A;  1ZX6 A;  2B86 A;  1M3C A;  2DF6 A;  2XIV A;  1HSQ A;  2JXB A;  2HSP A;  1GBQ A;  1QCF A;  4RTT A;  3H0H A;  2EGE A;  2G6F X;  2EPD A;  3A30 A;  4RTZ A;  4J9D A;  1X6G A;  1UHF A;  2K79 A;  1KFZ A;  1OV3 A;  4FQB A;  3EHR A;  3H0I A;  1GFD A;  1AZG B;  2SRC A;  2JT4 A;  1I07 A;  4HZB A;  4LN2 A;  5FWB A;  2C0O A;  2YUO A;  3NE0 A;  1Z9Q A;  2RF0 A;  2H8H A;  3TSW A;  3UA7 A;  1WLP B;  2ENM A;  2DYB A;  4AG2 C;  2SEM A;  1GCP A;  3VS4 A;  2O9V A;  2FPF A;  5HCK A;  2AKK A;  3EGU A;  2YT6 A;  3QWX X;  2EGC A;  2L3P A;  1Y0M A;  2M0Y A;  4FDY A;  2E5K A;  2KGT A;  4JJC A;  1AWW A;  1AD5 A;  1AVZ C;  2O2O A;  1UE9 A;  2PTK A;  2RQR A;  2EQI A;  1ZBJ A;  3O5Z A;  1X2K A;  4JPB W;  2CT3 A;  2K9G A;  4JJB A;  1ZLM A;  3A98 A;  4ESR A;  5IHN A;  2GQI A;  1SHF A;  1UJY A;  1K4U S;  4RTY A;  4DEX A;  3M0R A;  2EYZ A;  1UG1 A;  4OMO A;  1J3T A;  2A28 A;  1H8K A;  4F16 A;  2VVK A; 
#chains in the Genus database with same CATH topology
 3E9G A;  3QO3 A;  4F04 B;  1UTI A;  5I2S A;  3WVE B;  1HD3 A;  1V1C A;  2QAZ A;  2ZZD A;  2PVO B;  1YIJ Q;  8AT1 B;  2MYS A;  4QVD A;  4F14 A;  2CDT A;  5GAN 7;  2RHU A;  1VQL Q;  4J9H A;  4CC7 A;  3F70 A;  3TU4 K;  4BE0 A;  1M90 U;  4OGE A;  2HQH A;  3A8G B;  1OU8 A;  3CCL A;  3KXT A;  2D0N A;  3LWI A;  1WIE A;  4M7A B;  2EJ9 A;  1NE8 A;  2V26 A;  1D3B B;  3QII A;  1LOJ A;  2O9S A;  2C0T A;  3V7C A;  5IXB A;  4M7D G;  2HZY A;  4RTX A;  4ZN3 A;  4EMK B;  2W10 A;  2JNG A;  2A08 A;  2RJE A;  3M56 A;  3CC2 T;  2A37 A;  1YHQ A;  1MUZ A;  4FT4 A;  3VS3 A;  5DM7 R;  3HP9 A;  3CPW A;  2RK1 A;  1TS9 A;  2LRJ A;  4C8Q E;  4EMK A;  3VS2 A;  4NS5 A;  3CC4 Q;  3CCV T;  2K3Y A;  1N5Z A;  2CP6 A;  3MEA A;  4E7J A;  4HT8 A;  4FYV B;  4Z88 A;  1BI2 A;  4WCI A;  4C8Q C;  2M16 A;  4IUR A;  1VQM Q;  2XIC A;  4FL6 A;  1FYN A;  3ZFJ A;  1VQ4 A;  1Y96 B;  2L0A A;  3BDU A;  1XJW B;  1O75 A;  4FGE A;  1U1S A;  1UDL A;  3O98 A;  2RA2 A;  2RH2 A;  2XMF A;  1KK7 A;  4RTW A;  1FXX A;  2FO0 A;  2EQJ A;  2QG9 B;  1VQ6 Q;  2DBM A;  3VS5 A;  3INZ A;  4KGX B;  3I55 Q;  4LD9 K;  3CCL Q;  1VQN A;  2E4H A;  3NHN A;  3MCA B;  1JBM A;  1N8R U;  3ZL7 C;  1VQ4 T;  4LDU A;  5GAM d;  3HL8 A;  1RAB B;  3CCM T;  2DTO A;  2WAC A;  3OMG A;  3MJX A;  3A8O B;  4L6V 5;  3OS5 A;  1X27 A;  4M78 A;  4L5G A;  2CZ0 B;  2EQM A;  5CKF A;  1G5V A;  1ZUK A;  1YJW T;  1WXU A;  3L2Z A;  1BKB A;  1BI3 A;  4M7D E;  1R0C B;  1VQ5 Q;  3VU3 C;  1XOV A;  4PJM A;  1W4S A;  3VS7 A;  2RI5 A;  5GAM e;  2O88 A;  2FVU A;  1B7T A;  4MDX A;  2GF7 A;  1U06 A;  1WHL A;  2FEI A;  2VYT A;  1N9R A;  1VQN T;  1QCO A;  3G4S T;  4KH0 B;  3SD4 A;  2DVJ A;  3CMA A;  3P8B B;  2HAX A;  1RAD B;  3X28 B;  1KG1 A;  1KC8 U;  4PJO D;  4N4H A;  1W6X A;  1WQW A;  1QVF P;  3C94 A;  2AT1 B;  2ZGW A;  2DYI A;  5CVI A;  4CC3 A;  1SRL A;  2DVE A;  3M0P A;  3CCR T;  2QA4 T;  1N27 A;  2QYZ A;  1SF9 A;  2KXD A;  3SEM A;  1WDX A;  3OYA A;  1PKS A;  4OB1 B;  3PFS A;  5LJ5 h;  1GBR A;  1NJI U;  3I35 A;  4HVV A;  4XTZ A;  1Y57 A;  4OVA A;  3CMA T;  1WJQ A;  5KYY B;  2MI6 A;  1ZHI A;  3MP1 A;  2A0F B;  3HSB A;  2OI3 A;  2CZ7 B;  5FRO A;  2CUD A;  3HRT A;  1VQK Q;  4M7A E;  1OX8 A;  4J9F A;  2J6O A;  1VQO A;  4JXB A;  4EQ8 A;  2ED1 A;  2HL5 C;  3NTI A;  4XTW A;  2BE9 B;  5D6W A;  5KYU B;  5LL6 S;  1VQ9 Q;  3C4S A;  1TG0 A;  3A8L B;  5AYF A;  4PJL A;  1Q82 U;  3JCM d;  1MV3 A;  1D09 B;  4F7U A;  4NL2 A;  4A4F A;  4CC4 B;  2HDA A;  3DB4 A;  2QDL A;  1S1N A;  4PK4 A;  3X24 B;  3EG9 A;  4HVU A;  4FGI A;  2I0N A;  1BK2 A;  3CBM A;  2HQE A;  3BFM A;  1BCM A;  4OB0 B;  2KXC A;  2L3R A;  5D6Y A;  1NJI C;  1FMK A;  2X51 A;  2RN8 A;  2EJF A;  2E65 A;  1E6G A;  3SWN B;  3G6E T;  1Q82 R;  2NUP B;  2F5K A;  4AFQ C;  2KBT A;  3OS0 A;  2QA4 Q;  1PC0 A;  4EPC A;  1UGV A;  1VQ9 A;  2CZ6 B;  4F0V A;  4EIK A;  2L2P A;  4J9E A;  4OMQ A;  3CME A;  2QEX Q;  2KDS A;  4DBQ A;  1QKW A;  1YWP A;  2KYM A;  3QZ9 B;  2ZPI B;  1Q82 C;  1QWF A;  1BCO A;  1UJ0 A;  1Y7X A;  2P4T A;  1UGR B;  2K5L A;  2VB6 A;  2FRW A;  2VOB A;  2EKO A;  3PNW C;  1VQK T;  2D8J A;  3OY9 A;  4HCZ A;  1RAF B;  1RAI B;  4PJO C;  3JCM Q;  4HPE A;  1G3Y A;  4OF1 A;  3RIR A;  5DLO A;  1T0H A;  2PUK B;  4M75 G;  2J6F A;  3CCJ Q;  3FJP A;  2MK5 A;  2LMJ A;  5GAN g;  4QVC A;  4FSX A;  4PFP A;  5KCO A;  3E19 A;  5GAN j;  3RMQ A;  4QQG A;  3RNJ A;  3I55 T;  1Z9Z A;  1U3O A;  2JW4 A;  1SSH A;  4XQ3 A;  2OTL T;  2KRN A;  5KE2 A;  2KY9 A;  2DNU A;  2GFA A;  2AKL A;  4AT1 B;  5KCH A;  3JB9 J;  2FZC B;  1MHN A;  3JCM h;  3OYH A;  2H3J A;  3MEV A;  3MP6 A;  1S72 A;  5KYN A;  2E6Z A;  3V7R A;  2K2V A;  3KUF A;  2BKD N;  5C6S A;  1IZ6 A;  1N8R R;  5CIU A;  5KYX B;  1TSF A;  1Q86 U;  3OYK A;  4HCB A;  3H8Z A;  1KHC A;  2EYW A;  3JCM J;  3H9N A;  2LCL A;  1JJ2 P;  3I5R A;  3IQL A;  2OTJ T;  1VYT A;  2PVG B;  3THK A;  3PMT A;  2DM1 A;  1WYX A;  1VIE A;  1X01 A;  2HKN A;  1KQS A;  1QQJ A;  4KBM B;  5KE3 A;  3V7S A;  2VPM A;  2ROT A;  3OYD A;  3NTH A;  2DD4 A;  4JJN K;  2DRM A;  2DLP A;  2DA9 A;  2JZ2 A;  2ZPH B;  1JXM A;  1LCK A;  3I9Q A;  1N6A A;  3DLL A;  1OPK A;  2BUD A;  2FB7 A;  2DF6 A;  3CC7 A;  2XIV A;  4BD3 A;  4RTT A;  3J80 E;  5D7U A;  3UWN A;  2E1H A;  2EGE A;  2G6F X;  4N4G A;  5CKH A;  1UHF A;  2K79 A;  3OYL A;  4FQB A;  2R5M A;  3H0I A;  4R55 A;  3CCS Q;  1GFD A;  3GLX A;  2SRC A;  5I2M A;  2JT4 A;  1I07 A;  5LJ5 g;  5FWB A;  2YRC A;  3E1S A;  1Z9Q A;  5GAN h;  1MND A;  2H3E B;  3LGL A;  2XKO C;  2DYB A;  1VQM A;  2SEM A;  1M1K R;  4M7D A;  2RM4 A;  4ANJ A;  4M75 E;  2JTF A;  1ZA1 B;  3CC2 A;  3MEW A;  1WGS A;  3OW2 S;  4EMK C;  2E5K A;  2KGT A;  2CYZ B;  4BE1 A;  1AT1 B;  5KYW A;  2RB6 A;  1DJ7 B;  1UE9 A;  4IUP A;  4JPB W;  2Y4Y A;  3E2U A;  1ZLM A;  2LQK A;  4RTY A;  1VQM T;  3WXM B;  1J3T A;  3RKW A;  1H8K A;  3C95 A;  3OYG A;  3LLR A;  2DER A;  2LX7 A;  3N5B B;  2P0P A;  1QVG S;  4F7U B;  3BY7 A;  2MWP A;  4M78 C;  4C5E A;  6AT1 B;  3EGX A;  1B07 A;  2RHI A;  1WXB A;  2DTH A;  2HBP A;  2RJF A;  3FIF A;  4PJJ A;  2R57 A;  2IPO B;  1NEG A;  2QQR A;  3GP8 A;  4M7A A;  5GAO n;  4HCK A;  1W1F A;  1WJR A;  2MF2 A;  3CPW S;  2PZ1 A;  4Q4T A;  2RD1 A;  4BE2 A;  2IOA A;  2EVR A;  3AHU A;  1YNZ A;  3NPF A;  2DL5 A;  4LDW A;  1RAE B;  3H6Z A;  3GPL A;  2A3L A;  5CQY A;  1YCY A;  4C92 D;  1OUL A;  3BW1 A;  2RPN A;  5FRM A;  1VIF A;  1YWO A;  2DZ9 A;  3SDZ A;  1RI9 A;  3PTA A;  1WHH A;  3EFS A;  1C6V X;  2DE0 X;  4M7A D;  3CCM A;  1WNL A;  3R6O A;  1JRI A;  3RUX A;  2F2X A;  2EWN A;  2JS0 A;  1M27 C;  4M4Z A;  1Q7Y C;  1TUC A;  4PFZ A;  1K73 C;  4JUV A;  3L2R A;  2Z0W A;  4Y28 E;  1EZZ B;  3EHQ A;  2QDY B;  3G4S Q;  3G71 A;  4XU2 A;  1G3W A;  2HL3 A;  1SRM A;  4OMN A;  4A4E A;  3CCE Q;  3RER A;  4RG2 A;  4LXC A;  5GMK i;  1X69 A;  2BZ8 A;  2QEX T;  5C0M A;  2RMO A;  1M2V A;  1BI1 A;  4MZP A;  1YI2 Q;  4CC2 A;  4IIO A;  5FU6 C;  2RQV A;  4PJO E;  4ATO A;  4E47 A;  2HMA A;  2JOY A;  2ZPE B;  4CT3 A;  1RL2 A;  2VAS A;  2EJG A;  3FJ5 A;  2O4X B;  4P5N A;  2CKK A;  2R58 A;  4E2F B;  1PNJ A;  1V76 A;  2CGH A;  4IUT A;  2LJ3 A;  2EBP A;  4FQA A;  5IXF A;  3JAM E;  2DXC A;  2PQW A;  1VYV A;  4X9D A;  3CCU Q;  3CC4 A;  2XDB A;  3QYG B;  1VQO T;  1HJD A;  2CP3 A;  4ZGJ B;  2LDM A;  5GAM h;  3E9F A;  3D7S B;  1M3B A;  1HXD A;  1N8R C;  1ZSZ C;  4QKU A;  1YHQ Q;  2IVW A;  5J39 A;  5LJ5 e;  3C0C A;  3GOX A;  2RK2 A;  4CRI A;  2CP5 A;  3SWN A;  2FHD A;  5CK9 A;  1KJW A;  5GAN 6;  4K11 A;  4DBF A;  3PT9 A;  3KW0 A;  4F7U E;  1MMN A;  2DD5 A;  4BDZ A;  3GIB A;  5D6X A;  3OBY A;  2CSQ A;  5CR2 A;  3EG9 B;  2GGR A;  4GY5 A;  3EGD B;  2X35 A;  2L3S A;  2X4Y A;  1WXT A;  4IKF A;  4UC4 A;  5EC7 A;  4JJD A;  1A0N B;  2P0K A;  3M9Q A;  1ZUU A;  3I56 Q;  1QLY A;  3QSU A;  2LJ1 A;  4RCB A;  2GFU A;  2KRO A;  3EFO B;  1VQP Q;  1Q95 G;  4JLI A;  1I5L A;  2D6F A;  4JRK A;  1M1G A;  1NEB A;  2QTV A;  3BE3 A;  2R5A A;  1D1A A;  3UPU A;  3RKY A;  2CZ1 B;  2VV5 A;  3MKD A;  2CT4 A;  4ZNX A;  1VQP A;  3J81 E;  4C0Z A;  2DRK A;  2RO0 A;  4C8Q F;  4FYW B;  3HHT B;  2K5F A;  2QQ9 A;  3MP8 A;  2LT4 A;  2IG0 A;  4GBQ A;  2JS2 A;  2DL7 A;  2EW3 A;  2LQW A;  3URG A;  1JEG A;  3CCQ Q;  1EX4 A;  3I55 A;  3M0U A;  1KD1 C;  1SPK A;  1NPP A;  1BB9 A;  4BY6 B;  1X75 C;  1X43 A;  1IO6 A;  1MGQ A;  1NYG A;  1Q81 U;  4NOY A;  2A36 A;  4WTO B;  1WA7 A;  1TU0 B;  2XID A;  2GTO A;  1K1Z A;  3M58 A;  4OP0 A;  5GAN 8;  4JZ4 A;  3UA6 A;  2QXF A;  1WI7 A;  4XU1 A;  2YSQ A;  3S3M A;  2E6N A;  4M77 D;  1YI2 T;  1QVP A;  1TUG B;  2ABL A;  2Y4X A;  2BZY A;  4JZ3 A;  4FW1 A;  1VUB A;  1PRL C;  3QJ6 A;  3CCV A;  4ORZ A;  1M1F A;  1ZQ1 A;  3QDR B;  3L2W A;  1MV0 B;  4F7U G;  4N4I A;  1V29 B;  2V1R A;  1AWJ A;  1AWO A;  2XU8 A;  5CKB A;  2E41 A;  3P8D A;  1WJS A;  3NFC A;  5GAN 2;  3LWH A;  2ECZ A;  1PKT A;  2DIQ A;  1Y96 A;  2FZK B;  2YUN A;  1NM7 A;  1VYU A;  2K1G A;  4C92 E;  3EFO A;  1K9M U;  3GF5 A;  4XU3 A;  3CCQ A;  3A8H B;  1VQO Q;  2AHJ B;  2HD0 A;  4C8Q G;  1NPR A;  2QK0 A;  4MML A;  3JCM f;  5GAO q;  4GLM A;  1D0Y A;  1CKA A;  3JCM g;  2DXU A;  5LJ3 g;  2DKG A;  1G2B A;  3G6E Q;  2LRQ A;  4O6J A;  2P4R A;  1HYO A;  2QAS A;  4JRQ A;  3CCE T;  1W2B S;  1NLP C;  1PCX A;  3GNF B;  1QKX A;  4KUI A;  1G3T A;  3HPW A;  2HNI A;  5HK3 A;  1UEB A;  4LNP A;  4XTX A;  4D8K A;  1YIJ A;  1WQ7 A;  4DOV A;  2DX1 A;  1YJW A;  2V8I A;  1KC8 C;  3EH2 A;  1WHM A;  2F2W A;  2DK3 A;  3EBQ A;  4R56 A;  3CQT A;  2VPS A;  3CD6 T;  2K7A A;  4QQ6 A;  5FRN A;  1TXQ A;  1B34 B;  5I21 A;  4PJO A;  2AZS A;  1Q7Y R;  4FYX B;  5FLX E;  2O01 E;  3A5Z B;  1YJN Q;  4M75 A;  3OYE A;  1K8A R;  1HK9 A;  3BDL A;  1VQ6 T;  4FSS A;  3VJP A;  2JMA A;  4C5G A;  2G3R A;  4DA4 A;  1YIJ T;  1YJ9 T;  4AFZ C;  4BI3 A;  3VS6 A;  2ESW A;  3L42 A;  2COW A;  2OJ2 A;  1OZ3 A;  2RHY A;  3VYH B;  1QCF A;  3H0H A;  3CXC A;  2YLC A;  1XTD A;  3OS1 A;  2XHC A;  4RTZ A;  5J26 A;  1X6G A;  3HKS A;  3FB9 A;  1O9S A;  3J7A F;  4A53 A;  1NBE B;  2CP2 A;  3M55 A;  4E7Z A;  4RCC A;  3EAE A;  1VQ6 A;  1M1K U;  9ATC B;  1JJ2 A;  4LN2 A;  2M02 A;  1MMG A;  1KQS P;  1VQN Q;  5CAI A;  1WLP B;  3CC2 Q;  1YJ9 A;  4DOW A;  4JUR A;  1YFN A;  4M77 G;  3VS4 A;  3EGU A;  3V8J A;  4M7D C;  4LDV A;  4ZN1 A;  1C0M A;  1FMV A;  5CO7 A;  2X4W A;  2YRD A;  4FDY A;  5HY6 A;  4PL6 A;  1AWW A;  1AD5 A;  1RAA B;  1AVZ C;  3OS2 A;  1OI1 A;  3O5Z A;  2CT3 A;  4L59 A;  3V8L A;  2DFU A;  1UB4 A;  3CD6 Q;  4KUL A;  2QA4 A;  5IHN A;  2F1L A;  2EIF A;  1SHF A;  1K4U S;  3M0R A;  2EYZ A;  2A28 A;  4F16 A;  2VVK A;  5IN1 A;  1M8M A;  3I5S A;  3L1A A;  1VQ8 T;  1PM3 A;  3R6N A;  3S6W A;  3VPI A;  3ASK A;  3SFM A;  3V8K A;  4EMH A;  5LJ3 e;  1VQ9 T;  3M54 A;  1YJ9 Q;  5CKE A;  2DL3 A;  2K3A A;  2MAM A;  1IHW A;  4M7A C;  2RNA A;  1OYX A;  4M78 G;  1QW1 A;  2VC8 A;  2BE7 D;  2HBW A;  2ED0 A;  4A63 B;  2YUP A;  2E64 A;  1X6O A;  4JRI A;  2E5Q A;  1QVG A;  3M0Q A;  3M0T A;  4B9W A;  3CCM Q;  1VQK A;  4C0G A;  4C5I A;  5I22 A;  3PGG A;  2WP7 A;  3EGD A;  3H41 A;  1M30 A;  4BY6 C;  4E7H A;  1MNE A;  5LJ5 j;  3VRY A;  4QT7 A;  1T0J A;  3M53 A;  4J30 A;  4RMO A;  5GJV B;  1VOM A;  4J9C A;  3DLM A;  4KUD K;  1OZ2 A;  3VKI A;  1H3H A;  3I56 A;  2OTL A;  1D3B A;  3A8M B;  5KYW B;  4IUU A;  5IAY A;  5KH6 A;  2MPX C;  3CCR Q;  1M1K C;  1GL5 A;  4DEY A;  1G83 A;  2LNH B;  3GNG A;  2GNC A;  2DTI A;  3CME T;  4M7D B;  1S72 T;  2JN0 A;  2EYY A;  2JM9 A;  3MET A;  1VQ7 T;  3RDV A;  4M7A G;  1K9A A;  2RQW A;  1T3S A;  1UHC A;  1X6B A;  4A4H A;  2DL4 A;  2E10 A;  4LUE A;  1TH7 A;  2LVM A;  2V8K A;  2LX9 A;  3JRZ A;  3I56 T;  1M90 C;  3OB9 A;  1JXO A;  4C92 B;  4FT2 A;  3S3N A;  4Y92 A;  2JUF A;  5GMK e;  4PJO F;  3AT1 B;  1JO8 A;  4CSH A;  2DIG A;  1AZE A;  3OQ5 A;  2DXB A;  3JB9 D;  1M2O A;  1SG5 A;  3OYF A;  1ZBX A;  1ZUY A;  4KRT A;  3RMS A;  5GAM f;  2LCC A;  1JQQ A;  1P92 A;  3FRN A;  1N9S A;  2YRV A;  3SWN C;  3QZ5 B;  1D0X A;  2KI7 A;  3QDF A;  1K9M C;  1K0S A;  4V2S A;  2P0Q A;  1M2V B;  2J05 A;  5FWC A;  1EIF A;  3JCM P;  3CC7 T;  2JTE A;  1ABQ A;  3MHX A;  1ZSZ B;  4II1 A;  3NTK A;  3CXC P;  3G7Z A;  3CCV Q;  3OMC A;  1R8O B;  2X3X D;  4HCC A;  1QVF A;  4OB2 B;  2DL8 A;  1OU9 A;  3CBP A;  4Q5W A;  2M51 A;  4E7S A;  4F17 A;  1XQH A;  4EQA A;  4M77 E;  1K0X A;  1D1B A;  2ZPB B;  1YJN T;  4AMC A;  1VQ7 Q;  4PNO A;  4PFO A;  5GAO r;  5LJ3 h;  2ZAE A;  1NJI R;  1PD1 A;  4J9B A;  1R0B G;  2KT8 A;  1JU5 C;  2LQ8 A;  3FEO A;  1RLQ C;  3RES A;  4C92 F;  4M75 B;  5GMK l;  2WSE E;  2GCX A;  4M77 B;  2VXF A;  3EG1 A;  4EDU A;  3JCM W;  1OPL A;  3G1J A;  2FRY A;  1NG2 A;  4M77 F;  3CCL T;  1B34 A;  1OEB A;  4ZGD B;  3UAT A;  3FDR A;  2CSI A;  1I4K 1;  2CUB A;  2CRE A;  4QQD A;  2NYS A;  2LQN A;  3PVQ A;  1ZA2 B;  2DMO A;  3OBW A;  1KC8 R;  4PJO G;  3VRZ A;  4HFK A;  2FL7 A;  2Y90 A;  4AFS C;  2B8A A;  1YHQ T;  2KVQ G;  3QBY A;  4JLG A;  1YP5 A;  2W0Z A;  4JRP A;  4PKC C;  2YDL A;  3OYN A;  1IGQ A;  2MCN A;  1I8F A;  1PD0 A;  2COY A;  5GJW B;  3CPW P;  2RQU A;  5HK0 A;  5DY9 A;  2M0O A;  2YHT A;  1LJO A;  3JB9 I;  3QKJ A;  3PE0 A;  3CEY A;  4BUG A;  3LYI A;  2HSE B;  4MDW A;  4A4K A;  3JB9 H;  1Q7Y U;  2DJQ A;  1KQ1 A;  2CS7 A;  2QI2 A;  3PIP A;  2D1X A;  4J5Y A;  2K6D A;  1BBZ A;  2DZC A;  4ELY C;  3EFR A;  3M5A A;  5GAN 5;  1LNX A;  2WSC E;  3A2Y A;  1LPL A;  4BAC A;  2EAY A;  2PUO B;  1CKB A;  4BI4 A;  2RJD A;  1JB0 E;  1WFW A;  3U23 A;  4C8Q D;  3G71 T;  4F4M A;  2MIO A;  4HT9 A;  2D0Q B;  4D8D A;  4BB7 A;  4Z8A A;  4C92 G;  2KNB B;  4C8Q B;  3REA B;  3PVL A;  5LJ5 d;  1ZSG A;  2CP7 A;  2EGA A;  2CP0 A;  4J7I A;  3QYH B;  3QHS A;  4Q4N A;  4OGC A;  1KQ2 A;  4F0W A;  2X3W D;  3JCM b;  4CI0 C;  1K9M R;  4HZ9 A;  1UGP B;  1PRM C;  2J7I A;  1RAH B;  3EG2 A;  1M5Q 1;  1QWE A;  2K57 A;  3QG1 A;  4KGZ B;  3QPH A;  2D8H A;  2LP5 A;  2BTT A;  1QP2 A;  1SKU B;  1GCQ C;  2X9H A;  4OML A;  3GT2 A;  5GAN e;  1UEC A;  2COZ A;  2EQK A;  2F2V A;  3CC4 T;  1PSE A;  2KAF A;  5CQX A;  4E6R A;  1T3L A;  2KMT A;  2L8D A;  3JCM c;  1I1J A;  3CC7 Q;  2EFI A;  1BI0 A;  1M90 R;  1IRE B;  3ULR B;  3OA6 A;  2E3I A;  2WSF E;  5I11 A;  2AK5 A;  1KD1 U;  3HTR A;  1UFF A;  2QQS A;  4J8O A;  2OX7 A;  3OYC A;  3RBB B;  5EG2 A;  1BIA A;  1RAC B;  3M57 A;  5IHI A;  3G71 Q;  4BDY A;  1KQS S;  3L2U A;  4LDX A;  1NZ9 A;  2IO7 A;  3EG3 A;  5FW9 A;  2VKN A;  3A1P A;  1BYM A;  3EGX B;  4C8Q A;  1AEY A;  1TOV A;  2L5Q A;  3JCM X;  3CPF A;  4RKU E;  1ZX6 A;  1VQ8 A;  2B86 A;  3ER0 A;  1HSQ A;  2DJZ A;  2HSP A;  1GBQ A;  2EYQ A;  5A2Q E;  4M78 E;  4B9X A;  4FCY A;  3A30 A;  4J9D A;  4C92 A;  3EHR A;  1H64 1;  1AZG B;  2FYK A;  4M77 C;  2V8J A;  2VUB A;  4M75 D;  4HZB A;  5GAN d;  2C0O A;  3JCM e;  3NE0 A;  5IT9 E;  3UA7 A;  2H8H A;  3G6E A;  2ENM A;  2E70 A;  2O9V A;  2FPF A;  3M4G A;  3CXC S;  1D1C A;  1M4Z A;  4NL3 A;  3OW2 A;  2L3P A;  2RHZ A;  3VUB A;  4HA8 A;  1K73 R;  2QQA A;  2O2O A;  2PTK A;  2RQR A;  3PMI A;  1X2K A;  1G3S A;  2K3X A;  2K9G A;  1D0Z A;  2VXE A;  4WF2 A;  3A98 A;  4GLK A;  4ESR A;  2P84 A;  5M9O A;  2GQI A;  1UJY A;  2ZPG B;  5FU7 C;  4C92 C;  1UG1 A;  4OMO A;  5GAO m;  3CCS A;  2EQU A;  2DO3 A;  3L2Q A;  3JB9 F;  2XDP A;  4AFU C;  1W2B A;  2O4X A;  2IF6 A;  2K4Y A;  2HQX A;  1B3Q A;  2HEQ A;  2XG8 D;  4A4G A;  4J32 A;  4OMF B;  4FIB A;  1H3Z A;  4A54 A;  2IIM A;  4XTU A;  1QVG P;  1BU1 A;  3CCS T;  1YI2 A;  2L3Q A;  8ATC B;  3TVT A;  1YIT Q;  1K76 A;  2EYX A;  2FPE A;  4Y91 A;  1I81 A;  5GMK h;  3X20 B;  1MMA A;  1E7O A;  2MOX A;  5GAN 3;  2PU9 B;  1C1A A;  2BIV A;  3JV3 A;  4RTU A;  4HKE A;  4F7U F;  5GAM j;  4EMG A;  3UF4 A;  2LNV A;  4E7L A;  2KR3 A;  2F5T X;  2NWM A;  2E3H A;  1JJ2 S;  1KHI A;  4XK8 E;  1ARK A;  3A2Z A;  4OMP A;  3MEU A;  2LCS A;  4BI8 B;  2VWF A;  4XTV A;  2KE9 A;  3LW5 E;  4FW2 A;  2JMC A;  2PVD B;  4M75 F;  5IHK A;  1G8X A;  1K8A U;  1QVF S;  3C12 A;  2X4J A;  4LD6 A;  3DB3 A;  3X26 B;  1ABO A;  3OSS C;  4J9G A;  1M3A A;  3CCE A;  1YBY A;  2IO8 A;  4M78 B;  3VV0 A;  2O31 A;  3PIO A;  3QWY A;  2XK0 A;  1PSF A;  3M59 A;  1GFC A;  1RLP C;  1IGU A;  2NLU A;  4ME7 A;  1YJN A;  2DEU A;  7AT1 B;  3CCJ T;  3OSV A;  4HVW A;  3M1U A;  4Z89 A;  4X1V A;  1I0C A;  2CH4 A;  4KGV B;  2OAU A;  2GTJ A;  2GBQ A;  2JTM A;  2KK4 A;  1TUD A;  5L23 A;  2OTL Q;  1GRI A;  1IB8 A;  2J06 A;  4JS4 A;  3TQ7 P;  4HFF A;  1RAG B;  1SEM A;  1CSK A;  1UUE A;  3X25 B;  1YIT T;  1R77 A;  3JSC A;  4C0D B;  5A0L A;  1PHT A;  2LJ0 A;  4LJ1 A;  2CH4 W;  3CCJ A;  1WHG A;  2NUZ A;  4M75 C;  2YUQ A;  4Q4G X;  1QCN A;  2ZCF B;  2DET A;  4DBH A;  1UGS B;  2J6K A;  1PWT A;  3CCQ T;  1TWB A;  3OYB A;  1Q86 C;  4J9I A;  3M4Y A;  1H92 A;  2LTO A;  2XD0 A;  3EG0 A;  2C06 A;  2RI3 A;  3OYI A;  3T9N A;  4E7I A;  2KSS A;  2MWO A;  2KQW A;  3SB2 A;  3VS0 A;  2F69 A;  1RI0 A;  1YIT A;  2DAQ A;  2V1Q A;  3KFV A;  3TSZ A;  2A7Y A;  4B6M A;  2GQV A;  5A0G A;  3OYY A;  1FX7 A;  5LJ5 f;  2FZG B;  5GAN 4;  4HFL A;  3PBC A;  1IRX A;  3CD6 A;  1FWZ A;  4OMM A;  3PBI A;  5LJ3 f;  5IH2 A;  5KYU A;  2K2M A;  3MO8 A;  5ECA A;  4PLI A;  3L2V A;  4LUD A;  4J6W A;  3WVD B;  1K8A C;  4QW2 A;  5KYY A;  4XTY A;  1Q81 R;  1WHJ A;  2DPP B;  3KBG A;  2MMP A;  5LJ3 d;  1U5S A;  5GAO p;  5AT1 B;  2EKH A;  2IO9 A;  4ZGE B;  1ACM B;  4O5V A;  3VS1 A;  2FPD A;  2LC4 A;  3HRS A;  4ELZ C;  2KEA A;  4LDY A;  1OOT A;  3Q1J A;  2QTX A;  4RG8 A;  3HFN A;  3DKM A;  2HCK A;  3I86 A;  3G4S A;  3FC3 A;  4FM4 B;  1VQ5 T;  5KYX A;  4EOB A;  1OX9 A;  3MPU B;  4ZTJ A;  2KYB A;  4CGK A;  2DIL A;  1NLO C;  4OB3 B;  3VPJ A;  3CCR A;  4PLL A;  4X34 A;  1VA7 A;  4KH1 B;  5HKC A;  5LJ3 j;  1W70 A;  2JVV A;  3EH1 A;  1RUW A;  2ZPF B;  4XU0 A;  4LE9 A;  3H0F A;  3ME9 A;  3FLG A;  4MZM A;  3JB9 G;  2X4X A;  1WZO A;  1VQL A;  1E6H A;  4IUV A;  4M7D F;  2RHX A;  4RTV A;  4C0F A;  1I5O B;  1VQ5 A;  2AZV A;  1NYF A;  1YCS B;  2RQT A;  4C5H A;  1IXD A;  2K3B A;  2I2L A;  3JCM V;  3P8H A;  1VQ8 Q;  2K5I A;  1SSF A;  4MMK A;  4RUG A;  2VGM A;  1Q86 R;  4KT0 E;  4JS5 A;  3NMZ C;  3HRU A;  2PNI A;  3LH5 A;  1VQL T;  4TVR A;  3OYM A;  1GCQ A;  2NUT B;  3HFO A;  4VUB A;  5DLQ E;  3RR6 A;  1F1B B;  1U8R A;  4N0A C;  1EFN A;  1TTH B;  1WX6 A;  3VUZ A;  3NGP A;  1UGQ B;  2OAW A;  3VYG A;  2QQB A;  2E12 A;  4HXJ A;  3TEE A;  2ROL A;  1W2B P;  1VQ7 A;  3CCU T;  4M7A F;  4J6X A;  2QEX A;  2YXY A;  1YN8 A;  3LH0 A;  4IIM A;  3TRE A;  4R0K A;  1VQ4 Q;  4D6W A;  4PJO B;  5A0D A;  1IHV A;  2NUP A;  4ZTF A;  4PJN A;  2JJ9 A;  2XDD A;  1YJW Q;  3LX7 A;  5CKD A;  3OW2 P;  2QGG A;  1AOJ A;  1Q81 C;  2C0I A;  2DXT A;  3LGF A;  1Y07 A;  2RJC A;  4M78 D;  1PG5 B;  2KRM A;  4YTL A;  4E7K A;  2ATC B;  4C0D C;  1WPY A;  3GBQ A;  3CCU A;  5GMK j;  5GMK m;  1Y71 A;  1KD1 R;  1QP3 A;  1GXI E;  5GAO l;  4AG1 C;  3QXE B;  3CME Q;  3S0Q A;  2KT1 A;  2JM8 A;  5GAM g;  2DBK A;  1KSW A;  3M0S A;  1M8V A;  4J83 A;  1KIK A;  4M77 A;  3TCJ A;  2IOB A;  3OYJ A;  2FG0 A;  5CCA A;  2KRS A;  2LZ6 B;  3SHW A;  3QJY A;  1X2Q A;  3UT1 A;  3CBO A;  2BZX A;  3ZBD A;  4OLK A;  4M78 F;  4X9C A;  1U1T A;  5FU7 B;  3O8V A;  3REB B;  1AWX A;  4M7D D;  1SHG A;  1M3C A;  4FYY B;  4J6Y A;  2M9U A;  2JXB A;  1VQP T;  1K73 U;  2NUT A;  1OQK A;  2EPD A;  4Z02 A;  2QGF B;  5J3B A;  1KFZ A;  1OV3 A;  3QUI A;  4QVZ A;  2YLB A;  4XAX B;  1BIB A;  3RKX A;  3ZEH A;  4DBR A;  1WHK A;  2YUO A;  4N0A A;  2M1H A;  1ZSZ A;  2RF0 A;  3TSW A;  5GAN f;  4MZT A;  4AG2 C;  4FU6 A;  2AIR B;  1AHJ B;  1GCP A;  5HCK A;  2OTJ A;  2AKK A;  2YT6 A;  2RI2 A;  5FU6 B;  3QWX X;  2LT1 A;  2EGC A;  1FMW A;  1Y0M A;  2M0Y A;  2OTJ Q;  4JJC A;  1MMD A;  2D9T A;  4J7F A;  5L8R E;  1LVK A;  4JDS A;  2L89 A;  2HKQ B;  2VGN A;  2YWW A;  3S3O A;  2EQI A;  1XNI A;  1ZBJ A;  3UDC A;  1M9S A;  2XI9 A;  4JJB A;  3CMA Q;  4IUQ A;  4DEX A;  4DQ2 A;  2DEQ A;  1S72 Q;  4FGD A;  1QMC A; 
#chains in the Genus database with same CATH homology
 1M8M A;  2LX7 A;  3I5S A;  1UTI A;  3R6N A;  3VPI A;  1HD3 A;  1V1C A;  4AFU C;  1B07 A;  1WXB A;  4F14 A;  2IF6 A;  2CDT A;  1B3Q A;  1NEG A;  2HEQ A;  2DL3 A;  4HCK A;  1W1F A;  2K3A A;  2PZ1 A;  4J9H A;  4CC7 A;  4Q4T A;  2RNA A;  2IOA A;  2EVR A;  1YNZ A;  3NPF A;  2DL5 A;  2HBW A;  2ED0 A;  4A63 B;  2IIM A;  2YUP A;  2D0N A;  1BU1 A;  1WIE A;  2L3Q A;  2RPN A;  3M0Q A;  3M0T A;  5IXB A;  1YWO A;  2O9S A;  2C0T A;  3TVT A;  5I22 A;  1K76 A;  4RTX A;  2EYX A;  1RI9 A;  2FPE A;  2W10 A;  1E7O A;  2A08 A;  3H41 A;  2MOX A;  1M30 A;  2A37 A;  2DE0 X;  3JV3 A;  4RTU A;  3VRY A;  1MUZ A;  3VS3 A;  2F2X A;  4QT7 A;  1T0J A;  2JS0 A;  3UF4 A;  1M27 C;  4M4Z A;  1TUC A;  2KR3 A;  5GJV B;  2NWM A;  3EHQ A;  2LRJ A;  4J9C A;  1ARK A;  3A2Z A;  1SRM A;  4OMP A;  2LCS A;  4OMN A;  1H3H A;  3VS2 A;  2VWF A;  2KE9 A;  1X69 A;  2BZ8 A;  1N5Z A;  2JMC A;  4Z88 A;  2RMO A;  4WCI A;  1GL5 A;  5IHK A;  4DEY A;  1G83 A;  2LNH B;  4CC2 A;  2GNC A;  1ABO A;  4IIO A;  1FYN A;  2RQV A;  2L0A A;  4J9G A;  4CT3 A;  2EYY A;  2JM9 A;  1M3A A;  4FGE A;  2IO8 A;  3FJ5 A;  1K9A A;  2O31 A;  1T3S A;  2RQW A;  1UDL A;  1UHC A;  1X6B A;  3O98 A;  3QWY A;  2DL4 A;  4LUE A;  1GFC A;  1RLP C;  2XMF A;  1PNJ A;  4RTW A;  4HVW A;  2FO0 A;  3M1U A;  2LJ3 A;  1JXO A;  4X1V A;  4Z89 A;  1I0C A;  2CH4 A;  2EBP A;  4FQA A;  2DBM A;  2GTJ A;  3VS5 A;  2GBQ A;  5IXF A;  4Y92 A;  1TUD A;  1VYV A;  1JO8 A;  4CSH A;  5L23 A;  3NHN A;  1AZE A;  1GRI A;  2J06 A;  3ZL7 C;  1ZUY A;  1HJD A;  1SEM A;  1CSK A;  1UUE A;  4KRT A;  1X27 A;  1JQQ A;  1ZUK A;  1M3B A;  1PHT A;  2LJ0 A;  4LJ1 A;  2CH4 W;  1WXU A;  2NUZ A;  2YUQ A;  4Q4G X;  2J6K A;  1PWT A;  1XOV A;  3C0C A;  3VS7 A;  1K0S A;  4J9I A;  2O88 A;  2J05 A;  1H92 A;  1U06 A;  2FEI A;  5FWC A;  3EG0 A;  2JTE A;  1ABQ A;  2DVJ A;  1KJW A;  4K11 A;  1W6X A;  2X3X D;  3VS0 A;  2DL8 A;  3KW0 A;  4CC3 A;  1SRL A;  3M0P A;  2M51 A;  2V1Q A;  3KFV A;  3TSZ A;  2CSQ A;  4F17 A;  2KXD A;  3SEM A;  2GGR A;  1WDX A;  4EQA A;  1K0X A;  1PKS A;  2L3S A;  1GBR A;  1WXT A;  3I35 A;  4HVV A;  3PBC A;  1Y57 A;  5EC7 A;  4JJD A;  4OMM A;  1A0N B;  3PBI A;  5IH2 A;  2OI3 A;  4J9B A;  1ZUU A;  2KT8 A;  1JU5 C;  1QLY A;  2CUD A;  1RLQ C;  2K2M A;  2LJ1 A;  4J9F A;  2J6O A;  2KRO A;  3EG1 A;  1OPL A;  5ECA A;  4JXB A;  2FRY A;  4EQ8 A;  2ED1 A;  4LUD A;  1NG2 A;  1NEB A;  1OEB A;  1TG0 A;  3UAT A;  2CSI A;  2CUB A;  1U5S A;  2CRE A;  2EKH A;  2IO9 A;  2LQN A;  3PVQ A;  1MV3 A;  2DMO A;  2FPD A;  2CT4 A;  4ZNX A;  3VS1 A;  3VRZ A;  2KEA A;  1OOT A;  4CC4 B;  2HDA A;  2DRK A;  2QDL A;  1S1N A;  2HCK A;  4AFS C;  3I86 A;  4HVU A;  4FGI A;  2I0N A;  4GBQ A;  2JS2 A;  2DL7 A;  2LQW A;  2EW3 A;  1BK2 A;  1JEG A;  1YP5 A;  2W0Z A;  4EOB A;  3M0U A;  2KYB A;  1SPK A;  2KXC A;  4CGK A;  2DIL A;  1FMK A;  1BB9 A;  1NLO C;  2RN8 A;  1X43 A;  2YDL A;  2MCN A;  3VPJ A;  1E6G A;  1VA7 A;  5GJW B;  2RQU A;  1IO6 A;  1W70 A;  3PE0 A;  1NYG A;  1RUW A;  4LE9 A;  3H0F A;  4AFQ C;  2KBT A;  2DJQ A;  2A36 A;  1UGV A;  1WA7 A;  1E6H A;  4F0V A;  4RTV A;  4EIK A;  2GTO A;  1K1Z A;  2L2P A;  2D1X A;  4J9E A;  4OMQ A;  1QKW A;  1YWP A;  2AZV A;  2KYM A;  1NYF A;  1BBZ A;  2K6D A;  4JZ4 A;  3UA6 A;  1WI7 A;  1YCS B;  2RQT A;  1QWF A;  2K3B A;  2YSQ A;  3A2Y A;  1UJ0 A;  1CKB A;  4RUG A;  2ABL A;  2BZY A;  2FRW A;  1WFW A;  4JZ3 A;  2VOB A;  3U23 A;  4F4M A;  2D8J A;  2MIO A;  4FGD A;  3NMZ C;  1PRL C;  2PNI A;  3LH5 A;  4D8D A;  4ORZ A;  1GCQ A;  4HPE A;  1MV0 B;  1T0H A;  1EFN A;  4Z8A A;  1WX6 A;  2J6F A;  2V1R A;  1AWJ A;  2KNB B;  3NGP A;  1AWO A;  2OAW A;  2LMJ A;  3REA B;  3PVL A;  1ZSG A;  4HXJ A;  2EGA A;  4Q4N A;  4F0W A;  2ECZ A;  2X3W D;  1PKT A;  3RNJ A;  1Z9Z A;  2ROL A;  2YUN A;  1NM7 A;  1U3O A;  1VYU A;  2JW4 A;  1SSH A;  2K1G A;  4HZ9 A;  2KRN A;  1PRM C;  1YN8 A;  2J7I A;  4IIM A;  4R0K A;  2DNU A;  3EG2 A;  2AKL A;  1QWE A;  2D8H A;  2LP5 A;  2BTT A;  1GCQ C;  4GLM A;  1CKA A;  4OML A;  3GT2 A;  1AOJ A;  1UEC A;  1G2B A;  2P4R A;  2C0I A;  2F2V A;  4E6R A;  1NLP C;  1T3L A;  2KRM A;  1QKX A;  1I1J A;  3GBQ A;  4LNP A;  2EYW A;  4D8K A;  3I5R A;  3ULR B;  3IQL A;  2DX1 A;  1VYT A;  4AG1 C;  3THK A;  2F2W A;  2DM1 A;  3S0Q A;  2KT1 A;  5I11 A;  1WYX A;  2AK5 A;  3CQT A;  2JM8 A;  2VPS A;  1UFF A;  2K7A A;  2DBK A;  1KSW A;  3M0S A;  3RBB B;  1KIK A;  2AZS A;  5IHI A;  2VPM A;  2ROT A;  2IOB A;  2FG0 A;  2KRS A;  2DRM A;  2DLP A;  2LZ6 B;  2DA9 A;  3SHW A;  1JXM A;  2IO7 A;  1X2Q A;  1LCK A;  4FSS A;  2BZX A;  3EG3 A;  4OLK A;  2JMA A;  5FW9 A;  2VKN A;  3I9Q A;  1OPK A;  3REB B;  1AWX A;  4AFZ C;  3VS6 A;  1AEY A;  2ESW A;  1SHG A;  2OJ2 A;  1ZX6 A;  2B86 A;  1M3C A;  2DF6 A;  2XIV A;  1HSQ A;  2JXB A;  2HSP A;  1GBQ A;  1QCF A;  4RTT A;  3H0H A;  2EGE A;  2G6F X;  2EPD A;  3A30 A;  4RTZ A;  4J9D A;  1X6G A;  1UHF A;  2K79 A;  1KFZ A;  1OV3 A;  4FQB A;  3EHR A;  3H0I A;  1GFD A;  1AZG B;  2SRC A;  2JT4 A;  1I07 A;  4HZB A;  4LN2 A;  5FWB A;  2C0O A;  2YUO A;  3NE0 A;  1Z9Q A;  2RF0 A;  2H8H A;  3TSW A;  3UA7 A;  1WLP B;  2ENM A;  2DYB A;  4AG2 C;  2SEM A;  1GCP A;  3VS4 A;  2O9V A;  2FPF A;  5HCK A;  2AKK A;  3EGU A;  2YT6 A;  3QWX X;  2EGC A;  2L3P A;  1Y0M A;  2M0Y A;  4FDY A;  2E5K A;  2KGT A;  4JJC A;  1AWW A;  1AD5 A;  1AVZ C;  2O2O A;  1UE9 A;  2PTK A;  2RQR A;  2EQI A;  1ZBJ A;  3O5Z A;  1X2K A;  4JPB W;  2CT3 A;  2K9G A;  4JJB A;  1ZLM A;  3A98 A;  4ESR A;  5IHN A;  2GQI A;  1SHF A;  1UJY A;  1K4U S;  4RTY A;  4DEX A;  3M0R A;  2EYZ A;  1UG1 A;  4OMO A;  1J3T A;  2A28 A;  1H8K A;  4F16 A;  2VVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...