4R0KA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
303
structure length
301
Chain Sequence
PMPADSAYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Dipeptidyl-peptidase VI
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from Bacteroides thetaiotaomicron VPI-5482 at 1.75 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
total genus 84
structure length 301
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 4r0kA03
2LX7A 2OI3A 3EGUA 1GCQC 4J9CA 2BZYA 2A37A 2DVJA 4FGDA 2DM1A 1G2BA 1PRMC 2H8HA 5GJWB 2DILA 2RN8A 1OV3A 4HVUA 1HSQA 1NEBA 2X3XD 3NPFA 1AZGB 1SEMA 4JJBA 2MCNA 3VS7A 3VS1A 2M0YA 2KGTA 3VS6A 2C0TA 1NM7A 3A98A 3NGPA 3EG1A 1CKBA 3EG0A 5L23A 1M3AA 2IOAA 1AWWA 4X1VA 4FDYA 2LMJA 4Z8AA 2G6FX 4CC4B 1QWEA 1WDXA 1XOVA 1M3BA 1LCKA 1RLPC 2KR3A 4DEYA 1RUWA 2FG0A 2MIOA 2KRMA 1UECA 1QKWA 3ULRB 2RQUA 4HPEA 3TSZA 2LQNA 1VA7A 2EYYA 2ENMA 1UFFA 1CSKA 2JM9A 3VS2A 2EGEA 1ZUKA 1T0HA 2RQRA 5FW9A 1BBZA 2OAWA 1X6BA 4RTXA 1IO6A 2DLPA 4R0KA 2O9VA 1SHGA 4E6RA 1E7OA 2CSQA 2YUPA 3LH5A 1U06A 4RTWA 4IIOA 2KEAA 2YT6A 3CQTA 3S0QA 2KXCA 4HZ9A 2YUQA 1SRLA 2HSPA 2K9GA 1PNJA 1VYTA 2ED0A 1NEGA 3VS3A 3VRYA 2KNBB 1YCSB 1CKAA 1JO8A 4OMOA 4OMNA 1NYGA 2FPEA 4D8DA 2RQTA 3JV3A 1Z9ZA 4ZNXA 2ABLA 2DNUA 2KROA 3IQLA 2I0NA 4J9IA 3REAB 2CSIA 3TVTA 4J9DA 2V1QA 1ZX6A 2EYZA 1QWFA 1I1JA 4F14A 1T0JA 2RF0A 2O2OA 1H8KA 1BB9A 3UF4A 1X27A 5IXFA 4A63B 2E5KA 1WFWA 2OJ2A 4EOBA 2RQWA 2C0IA 2C0OA 1B3QA 3VPJA 3EG3A 2O88A 1JU5C 3M0RA 4JPBW 2KT1A 2F2VA 4Z89A 3NE0A 3VS4A 1PRLC 1X43A 1MV0B 1BU1A 1WXBA 1PWTA 4K11A 2D1XA 4DEXA 2YSQA 4FSSA 2DRMA 2KE9A 2ROLA 2DE0X 1JEGA 3QWXX 4LUEA 3EHRA 1G83A 4CSHA 2NUZA 2PTKA 4JZ3A 2O9SA 2GNCA 4LN2A 4FGIA 4M4ZA 3RBBB 5FWCA 4CC2A 4JXBA 1YWPA 1HD3A 2CH4W 2EW3A 2ECZA 3VS5A 1HJDA 4ORZA 1B07A 3VRZA 2JM8A 2FPFA 2D8HA 3A2ZA 2VVKA 4JZ4A 1Z9QA 2RPNA 1GBRA 4Q4NA 2KRSA 4OMMA 2J6KA 1WI7A 4AFZC 1T3SA 2W10A 5EC7A 5IHNA 2B86A 1GFCA 5I22A 1GL5A 1X69A 3PBCA 4RTVA 1NLPC 1WXUA 1A0NB 1WXTA 2NWMA 3THKA 1ZUUA 2JMAA 2GGRA 5IXBA 3H41A 2LZ6B 1AZEA 1K1ZA 1RI9A 1N5ZA 2GTOA 4J9BA 1MV3A 1M3CA 2VPSA 2J7IA 2BTTA 1KIKA 2HBWA 2YUNA 1UUEA 1H92A 2KXDA 4LJ1A 1UE9A 2EYWA 5ECAA 4GBQA 2L3QA 3UA7A 3FJ5A 2CT3A 1M27C 1NLOC 1AEYA 1ABQA 2EQIA 4Y92A 1AWJA 2JTEA 2LQWA 1OPLA 1PKSA 2M51A 4KRTA 2AZSA 2CREA 2FO0A 3PVLA 1JXMA 1UDLA 2DBKA 1M30A 3UA6A 1U5SA 5HCKA 2VKNA 1ZUYA 2GTJA 1YWOA 4Z88A 1S1NA 1PKTA 1JXOA 3I5RA 4OMPA 2K2MA 1QKXA 1SSHA 2L2PA 2QDLA 4RUGA 1PHTA 2K6DA 2DL4A 4AFQC 1K9AA 2D0NA 1JQQA 4HZBA 1OEBA 1FYNA 2A08A 3UATA 3O98A 2RQVA 3I35A 5FWBA 3I86A 3QWYA 1TUCA 1UTIA 2JS2A 4AFSC 3M1UA 1I0CA 3R6NA 2IO7A 1VYUA 5I11A 4RTTA 2BZXA 3H0FA 2IF6A 3EHQA 4FQAA 2DYBA 1YN8A 2CUDA 3I5SA 1UJYA 3M0TA 4CGKA 4RTZA 2F2WA 2EGAA 2VPMA 1SPKA 2IO9A 4J9FA 1SRMA 1E6HA 1I07A 2KBTA 5IHKA 1UHFA 2DRKA 2GBQA 2EVRA 2AKKA 2CUBA 2JW4A 5IH2A 3GBQA 2L3SA 2ED1A 4EQ8A 2DF6A 2DL3A 4D8KA 3PBIA 4JJDA 2DL7A 2PNIA 1WA7A 1AWOA 4F4MA 2J6FA 4J9EA 4QT7A 3M0SA 4F0VA 2HEQA 2K3BA 2YUOA 2HDAA 4AFUC 3VPIA 2SEMA 4IIMA 3M0QA 2CT4A 3O5ZA 2K3AA 3KW0A 2LRJA 4OLKA 4ESRA 2EBPA 2FRYA 1RLQC 5GJVB 4AG2C 2DBMA 3GT2A 1W1FA 1AVZC 4F0WA 2AK5A 2CDTA 2ESWA 2JT4A 1BK2A 2PZ1A 2V1RA 1AWXA 3U23A 1YNZA 2X3WD 2EGCA 4J9HA 3RNJA 3SHWA 4HCKA 1J3TA 1WX6A 1ZBJA 1OOTA 4EQAA 1NYFA 2KT8A 1EFNA 2ROTA 1VYVA 4LE9A 2DX1A 2KYMA 3H0IA 2MOXA 2XIVA 1KSWA 1T3LA 2DA9A 2K7AA 3I9QA 1WYXA 1Y0MA 2IIMA 4Q4GX 2AKLA 1K0SA 4F17A 2HCKA 2J06A 2RMOA 3EG2A 4OMLA 1TG0A 1K4US 2LP5A 3SEMA 4GLMA 2P4RA 1GCPA 3NMZC 1M8MA 1ARKA 1K0XA 4J9GA 2L3PA 3REBB 4LUDA 1GFDA 1KJWA 2LCSA 3M0PA 2F2XA 3PVQA 1ZLMA 4CC3A 4CT3A 3M0UA 4HVWA 2DL5A 1GBQA 1UG1A 4HVVA 4CC7A 2LJ0A 1MUZA 2GQIA 3TSWA 2VOBA 2KYBA 4RTUA 3PE0A 4OMQA 2AZVA 4FQBA 4LNPA 1TUDA 2KRNA 1X2QA 4EIKA 3NHNA 1ABOA 2VWFA 1GRIA 4WCIA 2DJQA 2IO8A 2O31A 3KFVA 1QLYA 1KFZA 1NG2A 1UJ0A 4HXJA 1W70A 1E6GA 4F16A 1U3OA 1W6XA 2K79A 2A28A 1ZSGA 2XMFA 2EKHA 2JMCA 4RTYA 2K1GA 1UGVA 2A36A 1UHCA 4JJCA 1Y57A 2D8JA 1OPKA 2W0ZA 3C0CA 1QCFA 5IHIA 1WIEA 1FMKA 1AOJA 3A30A 3A2YA 2DMOA 4AG1C 2BZ8A 2IOBA 2JS0A 1WLPB 1GCQA 1H3HA 4FGEA 2J6OA 2LJ3A 2EPDA 2FRWA 2J05A 3H0HA 2LNHB 4Q4TA 1K76A 2EYXA 2FPDA 1YP5A 3VS0A 1SHFA 2SRCA 2YDLA 2FEIA 2JXBA 2RNAA 2DL8A 2CH4A 1X2KA 2L0AA 1V1CA 2LJ1A 3ZL7C 1X6GA 1AD5A
chains in the Genus database with same CATH superfamily
2BZYA 2DM1A 2QGGA 1G2BA 3BFMA 1WNLA 5GJWB 2DILA 2DTIA 2RN8A 4HVUA 5LJ3j 2X3XD 3OS2A 2MCNA 1N27A 1HK9A 3E1SA 4MMKA 2KGTA 4C8QB 5I2SA 4HCCA 1TXQA 2QA4Q 1CKBA 4ZTJA 1VQNT 3CD6Q 4X1VA 2LT4A 3OYKA 1M2OA 4C8QC 4Z8AA 4XU2A 1XQHA 2KR3A 3TREA 4J30A 3A1PA 2HAXA 2L3RA 2FG0A 1Y71A 1IGQA 1UECA 1QKWA 1VQMT 3QYHB 3FLGA 4HPEA 2LQNA 1ZSZC 3NTHA 4QW2A 4M7AA 1KHCA 4M75F 5GAMj 2CGHA 4HCBA 1WHKA 2RJCA 3V7SA 5FW9A 4FT2A 3SD4A 1M5Q1 2JNGA 2O9VA 4LDVA 1RADB 1W2BA 2BE7D 4XQ3A 2F69A 1U06A 3MHXA 3S6WA 4RTWA 2YT6A 3SDZA 4OGEA 2ZPGB 4M7AB 3A8OB 2K9GA 1ZQ1A 4E47A 5KE2A 1D1BA 4B9WA 3VRYA 2RI2A 1YCSB 4F7UA 1CKAA 2D9TA 2OTJQ 4OMOA 3OS5A 3JAME 1N9RA 4M7AC 4B9XA 4D8DA 4XTWA 4X34A 4PK4A 2KROA 3CCEA 4J9IA 1G3SA 4E7ZA 5LJ5g 5CAIA 5KH6A 2COYA 1WJQA 4OGCA 1JJ2A 4F7UB 2QXFA 1T0JA 2CZ6B 3CCST 3OYDA 3CMEA 1YJNA 3UF4A 4D6WA 3CCQQ 1BI1A 4A63B 4C92C 4BDYA 2C0OA 4RG8A 5LJ3f 5FU6B 3X26B 4M78A 4FYYB 3BE3A 5CKFA 3VS4A 1X43A 3OA6A 3CPWA 2D1XA 4DEXA 1OQKA 2YSQA 4A4HA 3OYGA 1AT1B 2DTOA 1VQKA 4M7DB 1VQLA 2LC4A 5FWCA 4CC2A 3JB9G 4JXBA 2EW3A 4C0FA 4FU6A 3VS5A 1M1GA 2EYQA 4DBRA 1D09B 4PJLA 5DM7R 4XAXB 1QVGA 1U8RA 3A8GB 2D8HA 3EG9A 4M78C 4M75G 3LWIA 5GANe 3NTKA 2XKOC 4OMMA 5KYWA 1KC8U 1WI7A 1LNXA 4AFZC 1T3SA 4BDZA 1VQPQ 3OMCA 3URGA 3RKYA 1A0NB 3MKDA 4IUQA 4M75E 1G3TA 2E6ZA 2XIDA 4OB0B 2JMAA 2GGRA 5IXBA 1KC8C 2AT1B 3EG9B 1AZEA 2NUPA 1Q86R 1RI9A 3RMQA 2H3JA 1M3CA 2RH2A 3QG1A 4A54A 5KYWB 1SF9A 2HBWA 2YUNA 2YLBA 2QGFB 2EYWA 1FX7A 2HQEA 1PD0A 1BI3A 3UA7A 2HKNA 1YITQ 2QEXQ 3OYHA 1AEYA 1K9MR 2NUPB 4M7DD 4DA4A 4Y92A 3LH0A 3OS1A 5KYYA 3CD6A 3OW2P 3M4GA 2FO0A 3PVLA 1S72T 3CC2Q 3JCMJ 2DAQA 2DBKA 1ZUYA 1JXOA 2K2MA 5KYUB 1QKXA 3FC3A 2QDLA 2DL4A 1MNDA 3BDUA 5KYYB 1WHLA 1OU9A 1TH7A 3I86A 5LL6S 2QYZA 3QWYA 2GF7A 2IVWA 3M1UA 5GAOn 2IO7A 3LGLA 3CXCA 5I11A 3H0FA 4J6YA 3LX7A 2LT1A 3EHQA 1PC0A 4ZN3A 5A0DA 4FQAA 2CUDA 3FJPA 4N4GA 4XU3A 4C0ZA 3EBQA 2EGAA 4AMCA 3CCVT 1E6HA 2KBTA 5IHKA 2DRKA 5HK3A 2GBQA 2OTJA 3G7ZA 2EVRA 2AKKA 3INZA 2CUBA 1G8XA 3LW5E 4E7JA 3CCLQ 3CBMA 2DL7A 3RIRA 3L2QA 3A5ZB 1WA7A 1AWOA 3M58A 4KUIA 3LGFA 3M0SA 2RHXA 1HXDA 2HEQA 4IUTA 1MMGA 3QKJA 3VU3C 3VPIA 2FYKA 4JRQA 2JOYA 4BB7A 1HYOA 4M77B 4JRKA 3V8LA 3OYYA 2DEUA 5GMKj 3O5ZA 2K3AA 1LVKA 3GNFB 1VQOT 3QDFA 3ZEHA 2FRYA 4KBMB 3CCQA 1W4SA 2BE9B 4AG2C 4KULA 2WSEE 5FU7B 2DO3A 2ESWA 1WHJA 4KGZB 2JT4A 3RMSA 1WZOA 2QQSA 2RJDA 1AWXA 3U23A 1YNZA 4JJNK 5FU7C 3HRUA 3RNJA 1VQKT 4HCKA 3SWNC 1VQLT 4J7IA 3S3MA 3UWNA 3CCJT 2KYMA 1BI2A 1BKBA 2MOXA 3I55T 4OF1A 4BE1A 3RESA 2QQAA 3EAEA 1WJSA 1WYXA 3PTAA 2IIMA 2AKLA 2LRQA 4F17A 4PJOA 3E2UA 4OMLA 3QIIA 1VQ6Q 2X4WA 1M4ZA 4M77D 3Q1JA 1ARKA 1UGQB 4LUDA 1VQPA 1G3WA 1GFDA 5J26A 2DK3A 1I4K1 2Y90A 1Q7YR 3HP9A 1OX8A 1RI0A 1ZLMA 2QQRA 4HVWA 1UG1A 5LJ3e 4LDXA 1MUZA 2GQIA 2XDPA 4FCYA 4IUUA 2VOBA 2ZZDA 4PJOC 2DD5A 5C0MA 2QA4T 4C92F 1X2QA 3PGGA 2DJZA 2LDMA 1YITA 2ZCFB 2HMAA 1GRIA 2V26A 2IO8A 1OI1A 2KMTA 1KFZA 1NG2A 5A0GA 1W70A 3VJPA 4F16A 5GAMe 3PIOA 3CC2A 3CCUT 3HFNA 1ZSGA 2XMFA 2JMCA 3L1AA 4JJCA 2M1HA 2RHZA 3C0CA 1QCFA 4LDWA 3A2YA 2DMOA 4XTYA 3JCMP 3ER0A 2E4HA 1ZBXA 2BZ8A 2CZ0B 3FEOA 1WLPB 1FXXA 2J6OA 1MMAA 2DXTA 3EH1A 3H8ZA 2LJ3A 5GAOm 3OSSC 2FRWA 3EGDA 3X20B 2EYXA 3QXEB 3QPHA 4N0AA 2Y4YA 5D6YA 8ATCB 3CCLA 2K3YA 3C12A 2K5LA 2CH4A 2L0AA 2E5QA 2LJ1A 1AD5A 4PNOA 3V8JA 3EGDB 5LJ5j 2LX7A 2OI3A 3EGUA 3CCRQ 1KD1U 1X75C 1QCNA 2EKOA 4JLGA 4FGDA 2MK5A 4M75D 1RAGB 1QP3A 2X4JA 2AIRB 3E9GA 1RL2A 3NPFA 5AYFA 5A0LA 2A3LA 3BW1A 2MWOA 3HL8A 4QQGA 1KD1C 3MEAA 2C0TA 1NM7A 3M55A 3L2WA 4C92G 3V7RA 2DXUA 4OVAA 2G6FX 1QWEA 4DEYA 1YIJQ 1RUWA 1W2BP 3JCMc 2FB7A 2EQUA 2O4XA 2XI9A 4C92E 2DZ9A 1SSFA 2YHTA 2JM9A 2EGEA 3CCMQ 3BDLA 1T0HA 2RQRA 5GANf 1X6BA 2DLPA 2WSCE 3OYEA 2GFUA 1E7OA 2CSQA 1PG5B 3LH5A 4MMLA 1QVGS 1TUGB 3A8MB 1VQ6A 2YUQA 1O9SA 4M78G 1JJ2P 3JCMf 1YJ9Q 1JO8A 1PCXA 3EFOA 4DOVA 3CEYA 4ZNXA 3JB9I 1ACMB 4M78E 2B8AA 2I0NA 2RK2A 5HKCA 1BIAA 1Q95G 2V1QA 2EQJA 1YITT 4V2SA 4KH1B 2EJFA 1QWFA 3FDRA 2RHUA 2QEXT 2RF0A 4Z02A 3EFOB 1RAIB 1YFNA 2RD1A 1BB9A 5LJ5f 3CPWP 2CP7A 3R6OA 4HCZA 4JRIA 1X27A 3F70A 5IXFA 2QK0A 4C0DC 3CC2T 5D7UA 5I2MA 1FMWA 3VUBA 2C0IA 2RO0A 3VPJA 2LQKA 2O88A 4JS5A 4A4FA 3H9NA 4Z89A 1XNIA 4AT1B 2QDYB 1PRLC 4C5EA 2WACA 4K11A 1PWTA 3VYHB 5J3BA 1QVGP 3AT1B 4FSSA 2DRMA 2ROLA 4FIBA 3QWXX 4CSHA 2E3IA 2PTKA 5GAN8 4LN2A 3RDVA 2PUOB 4M4ZA 5GMKi 2XDBA 2ECZA 2XG8D 1HJDA 2V8IA 2O01E 2JM8A 3A2ZA 5M9OA 2RPNA 1GBRA 4RMOA 3CCLT 2VXEA 5IHNA 3LYIA 1DJ7B 5GAN3 4RTVA 5GMKm 4LXCA 1WXTA 2NWMA 5GMKe 1KQSA 4O5VA 3JB9F 3H41A 2LZ6B 3DB4A 4XU1A 1KHIA 1JRIA 1MV3A 2HBPA 2J7IA 2CZ1B 4LJ1A 1S72A 3CCUQ 1VQ8Q 4Q5WA 1I5OB 1OYXA 2BUDA 4E7KA 5KYXA 4E2FB 1M27C 2OX7A 1MMDA 1R0BG 2KI7A 3EGXA 3QDRB 2M51A 3L42A 1UDLA 4PLIA 1YIJA 3OYJA 3CXCP 2GTJA 5KYXB 2F1LA 3O8VA 4OMPA 1SSHA 1U1SA 2RHYA 4AFQC 3CCVA 4KGVB 4FL6A 3MP8A 4HZBA 1FYNA 3EGXB 4HA8A 2A08A 3UATA 2NYSA 3O98A 1VQ6T 2E70A 2QQ9A 3MCAB 2LCCA 3PIPA 4AFSC 4RCBA 3R6NA 1VYUA 4RTTA 2IF6A 2XICA 2E3HA 4L6V5 4MDWA 2CYZB 1YN8A 3I5SA 1ZHIA 2F2WA 1M90U 4J9FA 2PVGB 1I07A 1YJ9A 3QBYA 5LJ3h 2RI5A 3M54A 1IHVA 2JW4A 5IH2A 4M7DA 3GBQA 1VQOA 1WQWA 3KBGA 4LD6A 1YHQQ 2PNIA 1K8AU 1KQ2A 1M90C 2P84A 4F4MA 4NL3A 4NL2A 1PSEA 2JN0A 5FU6C 1VQ7T 2DIGA 1K8AC 2LRJA 4OLKA 6AT1B 4ESRA 2EBPA 4OB1B 3V7CA 2LTOA 4QQDA 5GJVB 1K8AR 2CP0A 3OW2S 3CCJA 4HFFA 1W1FA 1AVZC 2YLCA 5GAMf 4M7DC 3I55A 2YRVA 5GAOr 1BK2A 3GP8A 2DYIA 2MYSA 2JVVA 2LVMA 1RAEB 2X3WD 2GCXA 4J32A 3E9FA 3SHWA 2ZPHB 1IRXA 1SG5A 1NYFA 3A8HB 4L59A 2ROTA 1VYVA 4LE9A 3JCMe 2WP7A 1TU0B 4C5GA 2XIVA 1KSWA 4KGXB 4VUBA 3DKMA 1KC8R 1VQ5Q 1Y0MA 3I56Q 4C92D 5KE3A 4ZTFA 5GAOp 3EG2A 3X28B 4B6MA 1UGPB 1TOVA 2FL7A 1TG0A 2LP5A 5KYUA 4XK8E 1K0XA 2QA4A 4A4EA 3HKSA 3REBB 5LJ5e 3HRSA 1KJWA 4OMFB 3KUFA 3CCRT 2LCSA 2HSEB 1IB8A 3M0PA 3H6ZA 1Q81U 1RAHB 4HVVA 3M4YA 3OSVA 2FVUA 3PE0A 2MAMA 4QVCA 4OMQA 3CCUA 1VQ8A 2AZVA 3VUZA 1TUDA 1Q81C 3M59A 3MEVA 3NHNA 4PJJA 3FB9A 1Q81R 1YIJT 1QLYA 1UJ0A 5HK0A 1QCOA 2KDSA 3ZBDA 2X9HA 1E6GA 2E65A 3FRNA 1QVFA 3MEUA 1W6XA 4M77A 3FIFA 4DQ2A 3ME9A 4N4HA 3CCMT 1UHCA 2D8JA 1OPKA 4QQ6A 1WIEA 4FW2A 4KH0B 3P8BB 2JJ9A 4BI4A 4FGEA 1YJ9T 4WF2A 1B7TA 3J7AF 3L2RA 4BI3A 4Y28E 2LNVA 1H641 4M77C 3DLLA 1I81A 1K76A 1ZA1B 4C8QF 3TU4K 2CKKA 1YP5A 1SHFA 3OBYA 3META 2YDLA 3G6EQ 2DVEA 5I21A 1X2KA 1KQ1A 5D6WA 2ATCB 1LJOA 4J6WA 5CVIA 2A37A 1RAAB 2K57A 2DVJA 2L5QA 2XK0A 1PRMC 3VKIA 4QVZA 1OV3A 1HSQA 1G3YA 4E7SA 1NEBA 1AZGB 1SEMA 3N5BB 3VS7A 2M0YA 3PFSA 4BI8B 1PD1A 2DFUA 3VS6A 3A98A 3NGPA 3EG1A 5GAN4 5L23A 1MGQA 2IOAA 4M7AF 1AWWA 1WGSA 4FDYA 4N4IA 1WDXA 1M3BA 2DZCA 2MIOA 3JSCA 2KRMA 3ULRB 2RQUA 1OZ2A 3TSZA 1TSFA 2EYYA 2ENMA 4FYVB 1CSKA 3RKXA 1NJIU 2EWNA 1P92A 1VQ5A 3JB9H 3CC4Q 4F7UF 2OAWA 3I56A 4J5YA 4RTXA 4XU0A 4R0KA 2ZPBB 1SHGA 2KQWA 2E64A 2YUPA 4IUVA 4M75A 2FZKB 1D3BA 5FROA 3CQTA 2KXCA 1SRLA 1UEBA 2HSPA 1NJIC 2QEXA 1VYTA 1VQ7Q 2K5IA 1KK7A 4JS4A 2VXFA 1K73U 4FW1A 2DNUA 4M75B 1VQ8T 1D3BB 3IQLA 5IN1A 1C0MA 3REAB 3GIBA 3OYIA 4C8QG 3TVTA 3HRTA 2EYZA 5DLOA 8AT1B 5GANd 1VQ9Q 1I8FA 5L8RE 1K73C 4HFKA 1I5LA 3OYMA 4M78F 2Z0WA 3QZ9B 4C8QE 3G1JA 2E5KA 3CMAQ 1C6VX 2OJ2A 3OMGA 1YJWT 5EG2A 4IKFA 1B3QA 2MWPA 2CP2A 1JU5C 4IUPA 1W2BS 2G3RA 1EIFA 3J80E 3M0RA 4JPBW 2F2VA 1UGSB 2FZGB 3NE0A 2L89A 1MV0B 4E7HA 3G4ST 3G71Q 2KE9A 2DE0X 1JEGA 3VV0A 2M9UA 4LUEA 5D6XA 1G83A 4M7AG 2NUZA 3JB9D 1YWPA 2CH4W 3DB3A 2HKQB 3RUXA 2D6FA 4ORZA 1B07A 1JJ2S 1VOMA 4C5HA 2DEQA 1KQSP 2NUTA 4M7AE 4JZ4A 1Z9QA 1YHQT 2Y4XA 1Y07A 2W10A 2VGNA 4N0AC 4F7UG 1FWZA 3AHUA 3MO8A 1GFCA 5I22A 1TTHB 3PBCA 3G6EA 4FM4B 5KYNA 1KD1R 2XU8A 3QO3A 1N9SA 4GLKA 3OBWA 1RACB 1ZUUA 4JLIA 2NUTB 4J8OA 3M9QA 1K1ZA 2LQ8A 2GTOA 1BCOA 3CPWS 4F7UE 2VPSA 2BTTA 1KIKA 1H92A 1R77A 1WJRA 2DXCA 5ECAA 2CS7A 2H3EB 2RJEA 4GBQA 3QHSA 2QTVA 2RK1A 3BY7A 3FJ5A 5GANh 2CT3A 2RI3A 2VUBA 2XD0A 1R8OB 1X6OA 2IG0A 5KCOA 1ABQA 2EQIA 2JTEA 4M7DG 3OYAA 1N8RU 3JCMh 4GY5A 2AZSA 2YRCA 1VUBA 3CCEQ 3OYNA 1JXMA 4BUGA 5AT1B 2BIVA 5GAN2 5HCKA 1YWOA 4Z88A 1S1NA 3I5RA 1VQ5T 2L2PA 3I56T 4M7DE 1PHTA 2K6DA 4PJNA 1N8RC 2K3XA 3TQ7P 3CMEQ 2R5AA 3I35A 1YJNQ 2ZAEA 3E19A 1UTIA 2COWA 4HFLA 2JS2A 1I0CA 5LJ5h 3CPFA 5C6SA 4F04B 1VQ7A 1SPKA 2IO9A 2ZPEB 1AHJB 2KAFA 2ZPFB 3HSBA 2L3SA 2ED1A 3OYBA 2DL3A 1KG1A 2P4TA 1OX9A 3UT1A 3PBIA 3GLXA 3QYGB 2DPPB 3PMIA 4QT7A 1YBYA 2CZ7B 4F0VA 2K3BA 2HDAA 1VQ9A 1WHHA 1RAFB 4IIMA 3EH2A 3M0QA 3JCMW 2P0KA 3JB9J 2YXYA 4ZGDB 3J81E 2A0FB 3GT2A 2GFAA 2HL3A 4PL6A 5LJ3d 3CXCS 3RERA 4J6XA 4PFZA 2PZ1A 2JUFA 2V1RA 4LDUA 1NZ9A 2K4YA 3QJ6A 1J3TA 1WX6A 1ZBJA 1D0XA 1OOTA 4EQAA 4PJOF 3WVEB 2PU9B 1ZSZA 2VASA 3OYLA 5A2QE 2DA9A 2K7AA 4QKUA 4MZMA 3CCRA 3L2UA 4DOWA 4BY6B 1K0SA 5GAMd 1V29B 5CK9A 2J06A 2QAZA 3GPLA 3G6ET 2E41A 3DLMA 1K4US 5CIUA 4BY6C 2P4RA 1ZSZB 1O75A 2VV5A 4J9GA 4M77G 3PT9A 2L3PA 3QJYA 4EMGA 5GANg 5CKDA 4RCCA 2X4YA 1NBEB 2V8KA 2F2XA 3PVQA 4QVDA 2L8DA 4CT3A 2FZCB 3M0UA 2DL5A 1GBQA 1YJWQ 2LJ0A 3QZ5B 3RKWA 4M77E 4BD3A 3KXTA 3JCMg 3PMTA 1QVFP 1WHMA 4FQBA 4LNPA 1VQ4T 3HFOA 3G4SQ 5GAN6 3CCMA 2VWFA 3OS0A 5FLXE 4A53A 4C92A 3JCMX 3C4SA 4HXJA 2MMPA 1U3OA 1GXIE 3GNGA 3WXMB 4C8QD 2K79A 3JRZA 4A4GA 4RTYA 2EKHA 1UGVA 1Y57A 4CRIA 3CC4T 4ELYC 4LDYA 4X9CA 5IHIA 1QW1A 1AOJA 2QG9B 3A30A 5IAYA 2E10A 4C92B 4PFPA 1M90R 1ZA2B 3TCJA 2JS0A 4JRPA 1GCQA 1UB4A 5CQYA 4PJOG 2EPDA 1QVPA 4KUDK 2KY9A 2J05A 3H0HA 5GAMh 3CC7Q 1YI2Q 2FPDA 3ZFJA 4R55A 3VS0A 1M1FA 2SRCA 2XHCA 2FEIA 3OYCA 1VQ9T 4M7AD 3JCMV 4PJOE 2RNAA 4OB3B 2EJGA 5GAN5 1V76A 3OYFA 3V8KA 2CP5A 2HNIA 4M78B 9ATCB 1GCQC 4J9CA 3UPUA 1Q82U 3CMAT 2E12A 4DBFA 3M53A 1M2VA 2H8HA 2F5KA 3P8DA 1Q86U 5IT9E 4JJBA 2DTHA 3VS1A 2DD4A 1VIFA 5DY9A 1Q82C 3G71T 4PJMA 3EG0A 1M3AA 2R5MA 1Q82R 1D0YA 1Q86C 2K2VA 2LMJA 1D1CA 4CC4B 1XOVA 1M2VB 2HQHA 1LCKA 1RLPC 1M8VA 1K9MU 5GAOl 3X25B 4HT8A 2R57A 2EIFA 4JURA 2OTLQ 1VA7A 1UFFA 5CO7A 3VS2A 1ZUKA 1K9MC 1XJWB 2F5TX 3HTRA 1BBZA 1IO6A 5J39A 4JUVA 4E6RA 1R0CB 2RM4A 2QQBA 3PNWC 4LD9K 4IIOA 4M78D 2KEAA 4FYXB 3S0QA 4HZ9A 4HKEA 1C1AA 1PNJA 2JTMA 2ED0A 1NEGA 1RABB 4MDXA 3VS3A 2KNBB 1EX4A 2RJFA 4OMNA 1NYGA 2E6NA 2FPEA 2AHJB 5FRNA 3P8HA 2RQTA 3JV3A 1Z9ZA 2ABLA 4C0GA 1YJWA 4TVRA 2X4XA 2CSIA 4J9DA 1ZX6A 1I1JA 4F14A 4ELZC 3HPWA 4UC4A 1M1KU 3WVDB 1NPPA 3G4SA 2O2OA 1H8KA 4BE0A 5LJ3g 2VB6A 5CKBA 3SFMA 3C95A 3CCET 1TWBA 1WFWA 4EOBA 2RQWA 1M1KC 3EG3A 2DERA 2KT1A 3L2VA 1M1KR 1WQ7A 1OZ3A 1BU1A 1WXBA 3CMET 1YJNT 3SWNA 1YHQA 1VQNQ 1UGRB 4RG2A 1M9SA 3EHRA 2EQKA 2V8JA 4II1A 5GAMg 4JZ3A 2O9SA 1MNEA 2GNCA 3EFSA 4FGIA 2KVQG 3RBBB 1FMVA 1HD3A 4A4KA 1MMNA 1VQMQ 2C06A 3VRZA 3QUIA 3QSUA 2FPFA 3SWNB 2VVKA 1IHWA 2QASA 4Q4NA 4R56A 1BYMA 2KRSA 3CC7A 4XTZA 2J6KA 1YI2A 3MJXA 5EC7A 1MHNA 2B86A 3M5AA 1GL5A 1X69A 2EAYA 1VQ4Q 4CI0C 2CP6A 1LPLA 1NLPC 1WXUA 2VYTA 4JDSA 1QMCA 2BKDN 3THKA 4E7IA 2FHDA 4EDUA 7AT1B 1IZ6A 1N5ZA 4J9BA 2A7YA 3LWHA 2PUKB 1UUEA 2KXDA 1Q7YU 2YWWA 1UE9A 3NFCA 3M56A 2COZA 4J7FA 5CKHA 2L3QA 2EFIA 4OP0A 4DBHA 1NLOC 2RA2A 2D0QB 2EJ9A 2EQMA 4C5IA 1Q7YC 1AWJA 3CCSQ 2M16A 4RKUE 4EMHA 4Y91A 4FYWB 2LQWA 1YCYA 1OPLA 5GMKh 1PKSA 3M57A 4KRTA 2CREA 4PJOB 4PLLA 1M30A 3UA6A 1U5SA 2VKNA 1NJIR 1D0ZA 1PKTA 2OTLA 4RUGA 5CCAA 2IPOB 1K9AA 2D0NA 1JQQA 1OEBA 1KQSS 4EPCA 2RQVA 5GMKl 5FWBA 3OW2A 3CD6T 1Y96A 4NOYA 1TUCA 4OB2B 4ZGJB 2QTXA 4J83A 3NTIA 3OY9A 4M75C 3MPUB 1NPRA 4M7DF 1EZZB 2BZXA 2DYBA 5GAOq 4FSXA 1UJYA 3M0TA 2DIQA 4CGKA 4RTZA 1K73R 4E7LA 2VPMA 1IGUA 1SRMA 3OQ5A 2MI6A 2M02A 3JCMd 4HT9A 1UHFA 2RHIA 3JCMQ 2E1HA 1G5VA 1Y96B 2DF6A 4EQ8A 4D8KA 4JJDA 5GANj 3GF5A 2J6FA 4X9DA 4J9EA 2X51A 4O6JA 1JB0E 2YUOA 4AFUC 4EMKA 2SEMA 4BE2A 4PJOD 2OTJT 2CT4A 3CBOA 3KW0A 1Y7XA 5LJ5d 1B34A 3UDCA 1RLQC 1BIBA 3CBPA 4MZTA 4WTOB 2DBMA 3SB2A 4F0WA 2AK5A 2CDTA 4EMKB 1XTDA 5GAN7 2DKGA 1WPYA 2EGCA 4J9HA 2MF2A 4ME7A 3MP6A 1B34B 2QI2A 1JBMA 4EMKC 4BACA 3CCQT 1VQNA 2KT8A 1EFNA 2K5FA 1N6AA 2DX1A 2LCLA 1S72Q 2HQXA 3H0IA 4XTVA 1T3LA 3I9QA 1VQMA 5CKEA 3CC7T 3D7SB 1YI2T 4Q4GX 4XTUA 1BCMA 2HCKA 2M0OA 2RMOA 2VGMA 4NS5A 3L2ZA 3S3NA 5FRMA 1VIEA 2ZGWA 4XTXA 3SEMA 4GLMA 1GCPA 1OU8A 2MPXC 3NMZC 1M8MA 1QQJA 4DBQA 1VQ4A 5CQXA 2PVDB 3A8LB 4MZPA 5CR2A 2R58A 2HZYA 2DXBA 3MP1A 3CCVQ 4CC3A 2JTFA 1LOJA 2HL5C 4CC7A 1D1AA 1F1BB 4FT4A 1PM3A 2P0QA 3TSWA 3RR6A 2KYBA 4RTUA 3X24B 2PVOB 2LX9A 1X01A 3EFRA 1VQPT 4YTLA 2KRNA 2KSSA 4EIKA 2JZ2A 2O4XB 4IURA 1N8RR 3CC4A 1ABOA 4P5NA 3VYGA 4M77F 2P0PA 3T9NA 4WCIA 2DJQA 2O31A 3CCSA 2X35A 3KFVA 3LLRA 5DLQE 2GQVA 1VQOQ 3JCMb 4KT0E 3ASKA 3HHTB 4PKCC 2OTLT 2A28A 2VC8A 1OULA 5HY6A 5KCHA 2K1GA 2A36A 2NLUA 1BI0A 2RB6A 1WHGA 2W0ZA 2OAUA 4ANJA 4C0DB 1FMKA 1IXDA 3S3OA 1NE8A 1VQKQ 2XDDA 4AG1C 2CP3A 1VQLQ 1QP2A 2I2LA 2IOBA 2PQWA 2KK4A 3CCJQ 1H3HA 4PFOA 3MEWA 4ATOA 3C94A 3I55Q 1SKUB 1U1TA 3GOXA 1TS9A 2LNHB 4Q4TA 3CMAA 2ZPIB 4ZGEB 2WSFE 1H3ZA 2JXBA 1IREB 2DL8A 2YRDA 4L5GA 2DETA 3OB9A 1V1CA 3G71A 1QVFS 4C8QA 3ZL7C 1X6GA 1PSFA 3TEEA 4ZN1A 2HD0A
chains in the Genus database with same CATH topology
2LX7A 2OI3A 3EGUA 1GCQC 4J9CA 2BZYA 2A37A 2DVJA 4FGDA 2DM1A 1G2BA 1PRMC 2H8HA 5GJWB 2DILA 2RN8A 1OV3A 4HVUA 1HSQA 1NEBA 2X3XD 3NPFA 1AZGB 1SEMA 4JJBA 2MCNA 3VS7A 3VS1A 2M0YA 2KGTA 3VS6A 2C0TA 1NM7A 3A98A 3NGPA 3EG1A 1CKBA 3EG0A 5L23A 1M3AA 2IOAA 1AWWA 4X1VA 4FDYA 2LMJA 4Z8AA 2G6FX 4CC4B 1QWEA 1WDXA 1XOVA 1M3BA 1LCKA 1RLPC 2KR3A 4DEYA 1RUWA 2FG0A 2MIOA 2KRMA 1UECA 1QKWA 3ULRB 2RQUA 4HPEA 3TSZA 2LQNA 1VA7A 2EYYA 2ENMA 1UFFA 1CSKA 2JM9A 3VS2A 2EGEA 1ZUKA 1T0HA 2RQRA 5FW9A 1BBZA 2OAWA 1X6BA 4RTXA 1IO6A 2DLPA 4R0KA 2O9VA 1SHGA 4E6RA 1E7OA 2CSQA 2YUPA 3LH5A 1U06A 4RTWA 4IIOA 2KEAA 2YT6A 3CQTA 3S0QA 2KXCA 4HZ9A 2YUQA 1SRLA 2HSPA 2K9GA 1PNJA 1VYTA 2ED0A 1NEGA 3VS3A 3VRYA 2KNBB 1YCSB 1CKAA 1JO8A 4OMOA 4OMNA 1NYGA 2FPEA 4D8DA 2RQTA 3JV3A 1Z9ZA 4ZNXA 2ABLA 2DNUA 2KROA 3IQLA 2I0NA 4J9IA 3REAB 2CSIA 3TVTA 4J9DA 2V1QA 1ZX6A 2EYZA 1QWFA 1I1JA 4F14A 1T0JA 2RF0A 2O2OA 1H8KA 1BB9A 3UF4A 1X27A 5IXFA 4A63B 2E5KA 1WFWA 2OJ2A 4EOBA 2RQWA 2C0IA 2C0OA 1B3QA 3VPJA 3EG3A 2O88A 1JU5C 3M0RA 4JPBW 2KT1A 2F2VA 4Z89A 3NE0A 3VS4A 1PRLC 1X43A 1MV0B 1BU1A 1WXBA 1PWTA 4K11A 2D1XA 4DEXA 2YSQA 4FSSA 2DRMA 2KE9A 2ROLA 2DE0X 1JEGA 3QWXX 4LUEA 3EHRA 1G83A 4CSHA 2NUZA 2PTKA 4JZ3A 2O9SA 2GNCA 4LN2A 4FGIA 4M4ZA 3RBBB 5FWCA 4CC2A 4JXBA 1YWPA 1HD3A 2CH4W 2EW3A 2ECZA 3VS5A 1HJDA 4ORZA 1B07A 3VRZA 2JM8A 2FPFA 2D8HA 3A2ZA 2VVKA 4JZ4A 1Z9QA 2RPNA 1GBRA 4Q4NA 2KRSA 4OMMA 2J6KA 1WI7A 4AFZC 1T3SA 2W10A 5EC7A 5IHNA 2B86A 1GFCA 5I22A 1GL5A 1X69A 3PBCA 4RTVA 1NLPC 1WXUA 1A0NB 1WXTA 2NWMA 3THKA 1ZUUA 2JMAA 2GGRA 5IXBA 3H41A 2LZ6B 1AZEA 1K1ZA 1RI9A 1N5ZA 2GTOA 4J9BA 1MV3A 1M3CA 2VPSA 2J7IA 2BTTA 1KIKA 2HBWA 2YUNA 1UUEA 1H92A 2KXDA 4LJ1A 1UE9A 2EYWA 5ECAA 4GBQA 2L3QA 3UA7A 3FJ5A 2CT3A 1M27C 1NLOC 1AEYA 1ABQA 2EQIA 4Y92A 1AWJA 2JTEA 2LQWA 1OPLA 1PKSA 2M51A 4KRTA 2AZSA 2CREA 2FO0A 3PVLA 1JXMA 1UDLA 2DBKA 1M30A 3UA6A 1U5SA 5HCKA 2VKNA 1ZUYA 2GTJA 1YWOA 4Z88A 1S1NA 1PKTA 1JXOA 3I5RA 4OMPA 2K2MA 1QKXA 1SSHA 2L2PA 2QDLA 4RUGA 1PHTA 2K6DA 2DL4A 4AFQC 1K9AA 2D0NA 1JQQA 4HZBA 1OEBA 1FYNA 2A08A 3UATA 3O98A 2RQVA 3I35A 5FWBA 3I86A 3QWYA 1TUCA 1UTIA 2JS2A 4AFSC 3M1UA 1I0CA 3R6NA 2IO7A 1VYUA 5I11A 4RTTA 2BZXA 3H0FA 2IF6A 3EHQA 4FQAA 2DYBA 1YN8A 2CUDA 3I5SA 1UJYA 3M0TA 4CGKA 4RTZA 2F2WA 2EGAA 2VPMA 1SPKA 2IO9A 4J9FA 1SRMA 1E6HA 1I07A 2KBTA 5IHKA 1UHFA 2DRKA 2GBQA 2EVRA 2AKKA 2CUBA 2JW4A 5IH2A 3GBQA 2L3SA 2ED1A 4EQ8A 2DF6A 2DL3A 4D8KA 3PBIA 4JJDA 2DL7A 2PNIA 1WA7A 1AWOA 4F4MA 2J6FA 4J9EA 4QT7A 3M0SA 4F0VA 2HEQA 2K3BA 2YUOA 2HDAA 4AFUC 3VPIA 2SEMA 4IIMA 3M0QA 2CT4A 3O5ZA 2K3AA 3KW0A 2LRJA 4OLKA 4ESRA 2EBPA 2FRYA 1RLQC 5GJVB 4AG2C 2DBMA 3GT2A 1W1FA 1AVZC 4F0WA 2AK5A 2CDTA 2ESWA 2JT4A 1BK2A 2PZ1A 2V1RA 1AWXA 3U23A 1YNZA 2X3WD 2EGCA 4J9HA 3RNJA 3SHWA 4HCKA 1J3TA 1WX6A 1ZBJA 1OOTA 4EQAA 1NYFA 2KT8A 1EFNA 2ROTA 1VYVA 4LE9A 2DX1A 2KYMA 3H0IA 2MOXA 2XIVA 1KSWA 1T3LA 2DA9A 2K7AA 3I9QA 1WYXA 1Y0MA 2IIMA 4Q4GX 2AKLA 1K0SA 4F17A 2HCKA 2J06A 2RMOA 3EG2A 4OMLA 1TG0A 1K4US 2LP5A 3SEMA 4GLMA 2P4RA 1GCPA 3NMZC 1M8MA 1ARKA 1K0XA 4J9GA 2L3PA 3REBB 4LUDA 1GFDA 1KJWA 2LCSA 3M0PA 2F2XA 3PVQA 1ZLMA 4CC3A 4CT3A 3M0UA 4HVWA 2DL5A 1GBQA 1UG1A 4HVVA 4CC7A 2LJ0A 1MUZA 2GQIA 3TSWA 2VOBA 2KYBA 4RTUA 3PE0A 4OMQA 2AZVA 4FQBA 4LNPA 1TUDA 2KRNA 1X2QA 4EIKA 3NHNA 1ABOA 2VWFA 1GRIA 4WCIA 2DJQA 2IO8A 2O31A 3KFVA 1QLYA 1KFZA 1NG2A 1UJ0A 4HXJA 1W70A 1E6GA 4F16A 1U3OA 1W6XA 2K79A 2A28A 1ZSGA 2XMFA 2EKHA 2JMCA 4RTYA 2K1GA 1UGVA 2A36A 1UHCA 4JJCA 1Y57A 2D8JA 1OPKA 2W0ZA 3C0CA 1QCFA 5IHIA 1WIEA 1FMKA 1AOJA 3A30A 3A2YA 2DMOA 4AG1C 2BZ8A 2IOBA 2JS0A 1WLPB 1GCQA 1H3HA 4FGEA 2J6OA 2LJ3A 2EPDA 2FRWA 2J05A 3H0HA 2LNHB 4Q4TA 1K76A 2EYXA 2FPDA 1YP5A 3VS0A 1SHFA 2SRCA 2YDLA 2FEIA 2JXBA 2RNAA 2DL8A 2CH4A 1X2KA 2L0AA 1V1CA 2LJ1A 3ZL7C 1X6GA 1AD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LX7 A;  2OI3 A;  3EGU A;  1GCQ C;  4J9C A;  2BZY A;  2A37 A;  2DVJ A;  4FGD A;  2DM1 A;  1G2B A;  1PRM C;  2H8H A;  5GJW B;  2DIL A;  2RN8 A;  1OV3 A;  4HVU A;  1HSQ A;  1NEB A;  2X3X D;  3NPF A;  1AZG B;  1SEM A;  4JJB A;  2MCN A;  3VS7 A;  3VS1 A;  2M0Y A;  2KGT A;  3VS6 A;  2C0T A;  1NM7 A;  3A98 A;  3NGP A;  3EG1 A;  1CKB A;  3EG0 A;  5L23 A;  1M3A A;  2IOA A;  1AWW A;  4X1V A;  4FDY A;  2LMJ A;  4Z8A A;  2G6F X;  4CC4 B;  1QWE A;  1WDX A;  1XOV A;  1M3B A;  1LCK A;  1RLP C;  2KR3 A;  4DEY A;  1RUW A;  2FG0 A;  2MIO A;  2KRM A;  1UEC A;  1QKW A;  3ULR B;  2RQU A;  4HPE A;  3TSZ A;  2LQN A;  1VA7 A;  2EYY A;  2ENM A;  1UFF A;  1CSK A;  2JM9 A;  3VS2 A;  2EGE A;  1ZUK A;  1T0H A;  2RQR A;  5FW9 A;  1BBZ A;  2OAW A;  1X6B A;  4RTX A;  1IO6 A;  2DLP A;  4R0K A;  2O9V A;  1SHG A;  4E6R A;  1E7O A;  2CSQ A;  2YUP A;  3LH5 A;  1U06 A;  4RTW A;  4IIO A;  2KEA A;  2YT6 A;  3CQT A;  3S0Q A;  2KXC A;  4HZ9 A;  2YUQ A;  1SRL A;  2HSP A;  2K9G A;  1PNJ A;  1VYT A;  2ED0 A;  1NEG A;  3VS3 A;  3VRY A;  2KNB B;  1YCS B;  1CKA A;  1JO8 A;  4OMO A;  4OMN A;  1NYG A;  2FPE A;  4D8D A;  2RQT A;  3JV3 A;  1Z9Z A;  4ZNX A;  2ABL A;  2DNU A;  2KRO A;  3IQL A;  2I0N A;  4J9I A;  3REA B;  2CSI A;  3TVT A;  4J9D A;  2V1Q A;  1ZX6 A;  2EYZ A;  1QWF A;  1I1J A;  4F14 A;  1T0J A;  2RF0 A;  2O2O A;  1H8K A;  1BB9 A;  3UF4 A;  1X27 A;  5IXF A;  4A63 B;  2E5K A;  1WFW A;  2OJ2 A;  4EOB A;  2RQW A;  2C0I A;  2C0O A;  1B3Q A;  3VPJ A;  3EG3 A;  2O88 A;  1JU5 C;  3M0R A;  4JPB W;  2KT1 A;  2F2V A;  4Z89 A;  3NE0 A;  3VS4 A;  1PRL C;  1X43 A;  1MV0 B;  1BU1 A;  1WXB A;  1PWT A;  4K11 A;  2D1X A;  4DEX A;  2YSQ A;  4FSS A;  2DRM A;  2KE9 A;  2ROL A;  2DE0 X;  1JEG A;  3QWX X;  4LUE A;  3EHR A;  1G83 A;  4CSH A;  2NUZ A;  2PTK A;  4JZ3 A;  2O9S A;  2GNC A;  4LN2 A;  4FGI A;  4M4Z A;  3RBB B;  5FWC A;  4CC2 A;  4JXB A;  1YWP A;  1HD3 A;  2CH4 W;  2EW3 A;  2ECZ A;  3VS5 A;  1HJD A;  4ORZ A;  1B07 A;  3VRZ A;  2JM8 A;  2FPF A;  2D8H A;  3A2Z A;  2VVK A;  4JZ4 A;  1Z9Q A;  2RPN A;  1GBR A;  4Q4N A;  2KRS A;  4OMM A;  2J6K A;  1WI7 A;  4AFZ C;  1T3S A;  2W10 A;  5EC7 A;  5IHN A;  2B86 A;  1GFC A;  5I22 A;  1GL5 A;  1X69 A;  3PBC A;  4RTV A;  1NLP C;  1WXU A;  1A0N B;  1WXT A;  2NWM A;  3THK A;  1ZUU A;  2JMA A;  2GGR A;  5IXB A;  3H41 A;  2LZ6 B;  1AZE A;  1K1Z A;  1RI9 A;  1N5Z A;  2GTO A;  4J9B A;  1MV3 A;  1M3C A;  2VPS A;  2J7I A;  2BTT A;  1KIK A;  2HBW A;  2YUN A;  1UUE A;  1H92 A;  2KXD A;  4LJ1 A;  1UE9 A;  2EYW A;  5ECA A;  4GBQ A;  2L3Q A;  3UA7 A;  3FJ5 A;  2CT3 A;  1M27 C;  1NLO C;  1AEY A;  1ABQ A;  2EQI A;  4Y92 A;  1AWJ A;  2JTE A;  2LQW A;  1OPL A;  1PKS A;  2M51 A;  4KRT A;  2AZS A;  2CRE A;  2FO0 A;  3PVL A;  1JXM A;  1UDL A;  2DBK A;  1M30 A;  3UA6 A;  1U5S A;  5HCK A;  2VKN A;  1ZUY A;  2GTJ A;  1YWO A;  4Z88 A;  1S1N A;  1PKT A;  1JXO A;  3I5R A;  4OMP A;  2K2M A;  1QKX A;  1SSH A;  2L2P A;  2QDL A;  4RUG A;  1PHT A;  2K6D A;  2DL4 A;  4AFQ C;  1K9A A;  2D0N A;  1JQQ A;  4HZB A;  1OEB A;  1FYN A;  2A08 A;  3UAT A;  3O98 A;  2RQV A;  3I35 A;  5FWB A;  3I86 A;  3QWY A;  1TUC A;  1UTI A;  2JS2 A;  4AFS C;  3M1U A;  1I0C A;  3R6N A;  2IO7 A;  1VYU A;  5I11 A;  4RTT A;  2BZX A;  3H0F A;  2IF6 A;  3EHQ A;  4FQA A;  2DYB A;  1YN8 A;  2CUD A;  3I5S A;  1UJY A;  3M0T A;  4CGK A;  4RTZ A;  2F2W A;  2EGA A;  2VPM A;  1SPK A;  2IO9 A;  4J9F A;  1SRM A;  1E6H A;  1I07 A;  2KBT A;  5IHK A;  1UHF A;  2DRK A;  2GBQ A;  2EVR A;  2AKK A;  2CUB A;  2JW4 A;  5IH2 A;  3GBQ A;  2L3S A;  2ED1 A;  4EQ8 A;  2DF6 A;  2DL3 A;  4D8K A;  3PBI A;  4JJD A;  2DL7 A;  2PNI A;  1WA7 A;  1AWO A;  4F4M A;  2J6F A;  4J9E A;  4QT7 A;  3M0S A;  4F0V A;  2HEQ A;  2K3B A;  2YUO A;  2HDA A;  4AFU C;  3VPI A;  2SEM A;  4IIM A;  3M0Q A;  2CT4 A;  3O5Z A;  2K3A A;  3KW0 A;  2LRJ A;  4OLK A;  4ESR A;  2EBP A;  2FRY A;  1RLQ C;  5GJV B;  4AG2 C;  2DBM A;  3GT2 A;  1W1F A;  1AVZ C;  4F0W A;  2AK5 A;  2CDT A;  2ESW A;  2JT4 A;  1BK2 A;  2PZ1 A;  2V1R A;  1AWX A;  3U23 A;  1YNZ A;  2X3W D;  2EGC A;  4J9H A;  3RNJ A;  3SHW A;  4HCK A;  1J3T A;  1WX6 A;  1ZBJ A;  1OOT A;  4EQA A;  1NYF A;  2KT8 A;  1EFN A;  2ROT A;  1VYV A;  4LE9 A;  2DX1 A;  2KYM A;  3H0I A;  2MOX A;  2XIV A;  1KSW A;  1T3L A;  2DA9 A;  2K7A A;  3I9Q A;  1WYX A;  1Y0M A;  2IIM A;  4Q4G X;  2AKL A;  1K0S A;  4F17 A;  2HCK A;  2J06 A;  2RMO A;  3EG2 A;  4OML A;  1TG0 A;  1K4U S;  2LP5 A;  3SEM A;  4GLM A;  2P4R A;  1GCP A;  3NMZ C;  1M8M A;  1ARK A;  1K0X A;  4J9G A;  2L3P A;  3REB B;  4LUD A;  1GFD A;  1KJW A;  2LCS A;  3M0P A;  2F2X A;  3PVQ A;  1ZLM A;  4CC3 A;  4CT3 A;  3M0U A;  4HVW A;  2DL5 A;  1GBQ A;  1UG1 A;  4HVV A;  4CC7 A;  2LJ0 A;  1MUZ A;  2GQI A;  3TSW A;  2VOB A;  2KYB A;  4RTU A;  3PE0 A;  4OMQ A;  2AZV A;  4FQB A;  4LNP A;  1TUD A;  2KRN A;  1X2Q A;  4EIK A;  3NHN A;  1ABO A;  2VWF A;  1GRI A;  4WCI A;  2DJQ A;  2IO8 A;  2O31 A;  3KFV A;  1QLY A;  1KFZ A;  1NG2 A;  1UJ0 A;  4HXJ A;  1W70 A;  1E6G A;  4F16 A;  1U3O A;  1W6X A;  2K79 A;  2A28 A;  1ZSG A;  2XMF A;  2EKH A;  2JMC A;  4RTY A;  2K1G A;  1UGV A;  2A36 A;  1UHC A;  4JJC A;  1Y57 A;  2D8J A;  1OPK A;  2W0Z A;  3C0C A;  1QCF A;  5IHI A;  1WIE A;  1FMK A;  1AOJ A;  3A30 A;  3A2Y A;  2DMO A;  4AG1 C;  2BZ8 A;  2IOB A;  2JS0 A;  1WLP B;  1GCQ A;  1H3H A;  4FGE A;  2J6O A;  2LJ3 A;  2EPD A;  2FRW A;  2J05 A;  3H0H A;  2LNH B;  4Q4T A;  1K76 A;  2EYX A;  2FPD A;  1YP5 A;  3VS0 A;  1SHF A;  2SRC A;  2YDL A;  2FEI A;  2JXB A;  2RNA A;  2DL8 A;  2CH4 A;  1X2K A;  2L0A A;  1V1C A;  2LJ1 A;  3ZL7 C;  1X6G A;  1AD5 A; 
#chains in the Genus database with same CATH topology
 2BZY A;  2DM1 A;  2QGG A;  1G2B A;  3BFM A;  1WNL A;  5GJW B;  2DIL A;  2DTI A;  2RN8 A;  4HVU A;  5LJ3 j;  2X3X D;  3OS2 A;  2MCN A;  1N27 A;  1HK9 A;  3E1S A;  4MMK A;  2KGT A;  4C8Q B;  5I2S A;  4HCC A;  1TXQ A;  2QA4 Q;  1CKB A;  4ZTJ A;  1VQN T;  3CD6 Q;  4X1V A;  2LT4 A;  3OYK A;  1M2O A;  4C8Q C;  4Z8A A;  4XU2 A;  1XQH A;  2KR3 A;  3TRE A;  4J30 A;  3A1P A;  2HAX A;  2L3R A;  2FG0 A;  1Y71 A;  1IGQ A;  1UEC A;  1QKW A;  1VQM T;  3QYH B;  3FLG A;  4HPE A;  2LQN A;  1ZSZ C;  3NTH A;  4QW2 A;  4M7A A;  1KHC A;  4M75 F;  5GAM j;  2CGH A;  4HCB A;  1WHK A;  2RJC A;  3V7S A;  5FW9 A;  4FT2 A;  3SD4 A;  1M5Q 1;  2JNG A;  2O9V A;  4LDV A;  1RAD B;  1W2B A;  2BE7 D;  4XQ3 A;  2F69 A;  1U06 A;  3MHX A;  3S6W A;  4RTW A;  2YT6 A;  3SDZ A;  4OGE A;  2ZPG B;  4M7A B;  3A8O B;  2K9G A;  1ZQ1 A;  4E47 A;  5KE2 A;  1D1B A;  4B9W A;  3VRY A;  2RI2 A;  1YCS B;  4F7U A;  1CKA A;  2D9T A;  2OTJ Q;  4OMO A;  3OS5 A;  3JAM E;  1N9R A;  4M7A C;  4B9X A;  4D8D A;  4XTW A;  4X34 A;  4PK4 A;  2KRO A;  3CCE A;  4J9I A;  1G3S A;  4E7Z A;  5LJ5 g;  5CAI A;  5KH6 A;  2COY A;  1WJQ A;  4OGC A;  1JJ2 A;  4F7U B;  2QXF A;  1T0J A;  2CZ6 B;  3CCS T;  3OYD A;  3CME A;  1YJN A;  3UF4 A;  4D6W A;  3CCQ Q;  1BI1 A;  4A63 B;  4C92 C;  4BDY A;  2C0O A;  4RG8 A;  5LJ3 f;  5FU6 B;  3X26 B;  4M78 A;  4FYY B;  3BE3 A;  5CKF A;  3VS4 A;  1X43 A;  3OA6 A;  3CPW A;  2D1X A;  4DEX A;  1OQK A;  2YSQ A;  4A4H A;  3OYG A;  1AT1 B;  2DTO A;  1VQK A;  4M7D B;  1VQL A;  2LC4 A;  5FWC A;  4CC2 A;  3JB9 G;  4JXB A;  2EW3 A;  4C0F A;  4FU6 A;  3VS5 A;  1M1G A;  2EYQ A;  4DBR A;  1D09 B;  4PJL A;  5DM7 R;  4XAX B;  1QVG A;  1U8R A;  3A8G B;  2D8H A;  3EG9 A;  4M78 C;  4M75 G;  3LWI A;  5GAN e;  3NTK A;  2XKO C;  4OMM A;  5KYW A;  1KC8 U;  1WI7 A;  1LNX A;  4AFZ C;  1T3S A;  4BDZ A;  1VQP Q;  3OMC A;  3URG A;  3RKY A;  1A0N B;  3MKD A;  4IUQ A;  4M75 E;  1G3T A;  2E6Z A;  2XID A;  4OB0 B;  2JMA A;  2GGR A;  5IXB A;  1KC8 C;  2AT1 B;  3EG9 B;  1AZE A;  2NUP A;  1Q86 R;  1RI9 A;  3RMQ A;  2H3J A;  1M3C A;  2RH2 A;  3QG1 A;  4A54 A;  5KYW B;  1SF9 A;  2HBW A;  2YUN A;  2YLB A;  2QGF B;  2EYW A;  1FX7 A;  2HQE A;  1PD0 A;  1BI3 A;  3UA7 A;  2HKN A;  1YIT Q;  2QEX Q;  3OYH A;  1AEY A;  1K9M R;  2NUP B;  4M7D D;  4DA4 A;  4Y92 A;  3LH0 A;  3OS1 A;  5KYY A;  3CD6 A;  3OW2 P;  3M4G A;  2FO0 A;  3PVL A;  1S72 T;  3CC2 Q;  3JCM J;  2DAQ A;  2DBK A;  1ZUY A;  1JXO A;  2K2M A;  5KYU B;  1QKX A;  3FC3 A;  2QDL A;  2DL4 A;  1MND A;  3BDU A;  5KYY B;  1WHL A;  1OU9 A;  1TH7 A;  3I86 A;  5LL6 S;  2QYZ A;  3QWY A;  2GF7 A;  2IVW A;  3M1U A;  5GAO n;  2IO7 A;  3LGL A;  3CXC A;  5I11 A;  3H0F A;  4J6Y A;  3LX7 A;  2LT1 A;  3EHQ A;  1PC0 A;  4ZN3 A;  5A0D A;  4FQA A;  2CUD A;  3FJP A;  4N4G A;  4XU3 A;  4C0Z A;  3EBQ A;  2EGA A;  4AMC A;  3CCV T;  1E6H A;  2KBT A;  5IHK A;  2DRK A;  5HK3 A;  2GBQ A;  2OTJ A;  3G7Z A;  2EVR A;  2AKK A;  3INZ A;  2CUB A;  1G8X A;  3LW5 E;  4E7J A;  3CCL Q;  3CBM A;  2DL7 A;  3RIR A;  3L2Q A;  3A5Z B;  1WA7 A;  1AWO A;  3M58 A;  4KUI A;  3LGF A;  3M0S A;  2RHX A;  1HXD A;  2HEQ A;  4IUT A;  1MMG A;  3QKJ A;  3VU3 C;  3VPI A;  2FYK A;  4JRQ A;  2JOY A;  4BB7 A;  1HYO A;  4M77 B;  4JRK A;  3V8L A;  3OYY A;  2DEU A;  5GMK j;  3O5Z A;  2K3A A;  1LVK A;  3GNF B;  1VQO T;  3QDF A;  3ZEH A;  2FRY A;  4KBM B;  3CCQ A;  1W4S A;  2BE9 B;  4AG2 C;  4KUL A;  2WSE E;  5FU7 B;  2DO3 A;  2ESW A;  1WHJ A;  4KGZ B;  2JT4 A;  3RMS A;  1WZO A;  2QQS A;  2RJD A;  1AWX A;  3U23 A;  1YNZ A;  4JJN K;  5FU7 C;  3HRU A;  3RNJ A;  1VQK T;  4HCK A;  3SWN C;  1VQL T;  4J7I A;  3S3M A;  3UWN A;  3CCJ T;  2KYM A;  1BI2 A;  1BKB A;  2MOX A;  3I55 T;  4OF1 A;  4BE1 A;  3RES A;  2QQA A;  3EAE A;  1WJS A;  1WYX A;  3PTA A;  2IIM A;  2AKL A;  2LRQ A;  4F17 A;  4PJO A;  3E2U A;  4OML A;  3QII A;  1VQ6 Q;  2X4W A;  1M4Z A;  4M77 D;  3Q1J A;  1ARK A;  1UGQ B;  4LUD A;  1VQP A;  1G3W A;  1GFD A;  5J26 A;  2DK3 A;  1I4K 1;  2Y90 A;  1Q7Y R;  3HP9 A;  1OX8 A;  1RI0 A;  1ZLM A;  2QQR A;  4HVW A;  1UG1 A;  5LJ3 e;  4LDX A;  1MUZ A;  2GQI A;  2XDP A;  4FCY A;  4IUU A;  2VOB A;  2ZZD A;  4PJO C;  2DD5 A;  5C0M A;  2QA4 T;  4C92 F;  1X2Q A;  3PGG A;  2DJZ A;  2LDM A;  1YIT A;  2ZCF B;  2HMA A;  1GRI A;  2V26 A;  2IO8 A;  1OI1 A;  2KMT A;  1KFZ A;  1NG2 A;  5A0G A;  1W70 A;  3VJP A;  4F16 A;  5GAM e;  3PIO A;  3CC2 A;  3CCU T;  3HFN A;  1ZSG A;  2XMF A;  2JMC A;  3L1A A;  4JJC A;  2M1H A;  2RHZ A;  3C0C A;  1QCF A;  4LDW A;  3A2Y A;  2DMO A;  4XTY A;  3JCM P;  3ER0 A;  2E4H A;  1ZBX A;  2BZ8 A;  2CZ0 B;  3FEO A;  1WLP B;  1FXX A;  2J6O A;  1MMA A;  2DXT A;  3EH1 A;  3H8Z A;  2LJ3 A;  5GAO m;  3OSS C;  2FRW A;  3EGD A;  3X20 B;  2EYX A;  3QXE B;  3QPH A;  4N0A A;  2Y4Y A;  5D6Y A;  8ATC B;  3CCL A;  2K3Y A;  3C12 A;  2K5L A;  2CH4 A;  2L0A A;  2E5Q A;  2LJ1 A;  1AD5 A;  4PNO A;  3V8J A;  3EGD B;  5LJ5 j;  2LX7 A;  2OI3 A;  3EGU A;  3CCR Q;  1KD1 U;  1X75 C;  1QCN A;  2EKO A;  4JLG A;  4FGD A;  2MK5 A;  4M75 D;  1RAG B;  1QP3 A;  2X4J A;  2AIR B;  3E9G A;  1RL2 A;  3NPF A;  5AYF A;  5A0L A;  2A3L A;  3BW1 A;  2MWO A;  3HL8 A;  4QQG A;  1KD1 C;  3MEA A;  2C0T A;  1NM7 A;  3M55 A;  3L2W A;  4C92 G;  3V7R A;  2DXU A;  4OVA A;  2G6F X;  1QWE A;  4DEY A;  1YIJ Q;  1RUW A;  1W2B P;  3JCM c;  2FB7 A;  2EQU A;  2O4X A;  2XI9 A;  4C92 E;  2DZ9 A;  1SSF A;  2YHT A;  2JM9 A;  2EGE A;  3CCM Q;  3BDL A;  1T0H A;  2RQR A;  5GAN f;  1X6B A;  2DLP A;  2WSC E;  3OYE A;  2GFU A;  1E7O A;  2CSQ A;  1PG5 B;  3LH5 A;  4MML A;  1QVG S;  1TUG B;  3A8M B;  1VQ6 A;  2YUQ A;  1O9S A;  4M78 G;  1JJ2 P;  3JCM f;  1YJ9 Q;  1JO8 A;  1PCX A;  3EFO A;  4DOV A;  3CEY A;  4ZNX A;  3JB9 I;  1ACM B;  4M78 E;  2B8A A;  2I0N A;  2RK2 A;  5HKC A;  1BIA A;  1Q95 G;  2V1Q A;  2EQJ A;  1YIT T;  4V2S A;  4KH1 B;  2EJF A;  1QWF A;  3FDR A;  2RHU A;  2QEX T;  2RF0 A;  4Z02 A;  3EFO B;  1RAI B;  1YFN A;  2RD1 A;  1BB9 A;  5LJ5 f;  3CPW P;  2CP7 A;  3R6O A;  4HCZ A;  4JRI A;  1X27 A;  3F70 A;  5IXF A;  2QK0 A;  4C0D C;  3CC2 T;  5D7U A;  5I2M A;  1FMW A;  3VUB A;  2C0I A;  2RO0 A;  3VPJ A;  2LQK A;  2O88 A;  4JS5 A;  4A4F A;  3H9N A;  4Z89 A;  1XNI A;  4AT1 B;  2QDY B;  1PRL C;  4C5E A;  2WAC A;  4K11 A;  1PWT A;  3VYH B;  5J3B A;  1QVG P;  3AT1 B;  4FSS A;  2DRM A;  2ROL A;  4FIB A;  3QWX X;  4CSH A;  2E3I A;  2PTK A;  5GAN 8;  4LN2 A;  3RDV A;  2PUO B;  4M4Z A;  5GMK i;  2XDB A;  2ECZ A;  2XG8 D;  1HJD A;  2V8I A;  2O01 E;  2JM8 A;  3A2Z A;  5M9O A;  2RPN A;  1GBR A;  4RMO A;  3CCL T;  2VXE A;  5IHN A;  3LYI A;  1DJ7 B;  5GAN 3;  4RTV A;  5GMK m;  4LXC A;  1WXT A;  2NWM A;  5GMK e;  1KQS A;  4O5V A;  3JB9 F;  3H41 A;  2LZ6 B;  3DB4 A;  4XU1 A;  1KHI A;  1JRI A;  1MV3 A;  2HBP A;  2J7I A;  2CZ1 B;  4LJ1 A;  1S72 A;  3CCU Q;  1VQ8 Q;  4Q5W A;  1I5O B;  1OYX A;  2BUD A;  4E7K A;  5KYX A;  4E2F B;  1M27 C;  2OX7 A;  1MMD A;  1R0B G;  2KI7 A;  3EGX A;  3QDR B;  2M51 A;  3L42 A;  1UDL A;  4PLI A;  1YIJ A;  3OYJ A;  3CXC P;  2GTJ A;  5KYX B;  2F1L A;  3O8V A;  4OMP A;  1SSH A;  1U1S A;  2RHY A;  4AFQ C;  3CCV A;  4KGV B;  4FL6 A;  3MP8 A;  4HZB A;  1FYN A;  3EGX B;  4HA8 A;  2A08 A;  3UAT A;  2NYS A;  3O98 A;  1VQ6 T;  2E70 A;  2QQ9 A;  3MCA B;  2LCC A;  3PIP A;  4AFS C;  4RCB A;  3R6N A;  1VYU A;  4RTT A;  2IF6 A;  2XIC A;  2E3H A;  4L6V 5;  4MDW A;  2CYZ B;  1YN8 A;  3I5S A;  1ZHI A;  2F2W A;  1M90 U;  4J9F A;  2PVG B;  1I07 A;  1YJ9 A;  3QBY A;  5LJ3 h;  2RI5 A;  3M54 A;  1IHV A;  2JW4 A;  5IH2 A;  4M7D A;  3GBQ A;  1VQO A;  1WQW A;  3KBG A;  4LD6 A;  1YHQ Q;  2PNI A;  1K8A U;  1KQ2 A;  1M90 C;  2P84 A;  4F4M A;  4NL3 A;  4NL2 A;  1PSE A;  2JN0 A;  5FU6 C;  1VQ7 T;  2DIG A;  1K8A C;  2LRJ A;  4OLK A;  6AT1 B;  4ESR A;  2EBP A;  4OB1 B;  3V7C A;  2LTO A;  4QQD A;  5GJV B;  1K8A R;  2CP0 A;  3OW2 S;  3CCJ A;  4HFF A;  1W1F A;  1AVZ C;  2YLC A;  5GAM f;  4M7D C;  3I55 A;  2YRV A;  5GAO r;  1BK2 A;  3GP8 A;  2DYI A;  2MYS A;  2JVV A;  2LVM A;  1RAE B;  2X3W D;  2GCX A;  4J32 A;  3E9F A;  3SHW A;  2ZPH B;  1IRX A;  1SG5 A;  1NYF A;  3A8H B;  4L59 A;  2ROT A;  1VYV A;  4LE9 A;  3JCM e;  2WP7 A;  1TU0 B;  4C5G A;  2XIV A;  1KSW A;  4KGX B;  4VUB A;  3DKM A;  1KC8 R;  1VQ5 Q;  1Y0M A;  3I56 Q;  4C92 D;  5KE3 A;  4ZTF A;  5GAO p;  3EG2 A;  3X28 B;  4B6M A;  1UGP B;  1TOV A;  2FL7 A;  1TG0 A;  2LP5 A;  5KYU A;  4XK8 E;  1K0X A;  2QA4 A;  4A4E A;  3HKS A;  3REB B;  5LJ5 e;  3HRS A;  1KJW A;  4OMF B;  3KUF A;  3CCR T;  2LCS A;  2HSE B;  1IB8 A;  3M0P A;  3H6Z A;  1Q81 U;  1RAH B;  4HVV A;  3M4Y A;  3OSV A;  2FVU A;  3PE0 A;  2MAM A;  4QVC A;  4OMQ A;  3CCU A;  1VQ8 A;  2AZV A;  3VUZ A;  1TUD A;  1Q81 C;  3M59 A;  3MEV A;  3NHN A;  4PJJ A;  3FB9 A;  1Q81 R;  1YIJ T;  1QLY A;  1UJ0 A;  5HK0 A;  1QCO A;  2KDS A;  3ZBD A;  2X9H A;  1E6G A;  2E65 A;  3FRN A;  1QVF A;  3MEU A;  1W6X A;  4M77 A;  3FIF A;  4DQ2 A;  3ME9 A;  4N4H A;  3CCM T;  1UHC A;  2D8J A;  1OPK A;  4QQ6 A;  1WIE A;  4FW2 A;  4KH0 B;  3P8B B;  2JJ9 A;  4BI4 A;  4FGE A;  1YJ9 T;  4WF2 A;  1B7T A;  3J7A F;  3L2R A;  4BI3 A;  4Y28 E;  2LNV A;  1H64 1;  4M77 C;  3DLL A;  1I81 A;  1K76 A;  1ZA1 B;  4C8Q F;  3TU4 K;  2CKK A;  1YP5 A;  1SHF A;  3OBY A;  3MET A;  2YDL A;  3G6E Q;  2DVE A;  5I21 A;  1X2K A;  1KQ1 A;  5D6W A;  2ATC B;  1LJO A;  4J6W A;  5CVI A;  2A37 A;  1RAA B;  2K57 A;  2DVJ A;  2L5Q A;  2XK0 A;  1PRM C;  3VKI A;  4QVZ A;  1OV3 A;  1HSQ A;  1G3Y A;  4E7S A;  1NEB A;  1AZG B;  1SEM A;  3N5B B;  3VS7 A;  2M0Y A;  3PFS A;  4BI8 B;  1PD1 A;  2DFU A;  3VS6 A;  3A98 A;  3NGP A;  3EG1 A;  5GAN 4;  5L23 A;  1MGQ A;  2IOA A;  4M7A F;  1AWW A;  1WGS A;  4FDY A;  4N4I A;  1WDX A;  1M3B A;  2DZC A;  2MIO A;  3JSC A;  2KRM A;  3ULR B;  2RQU A;  1OZ2 A;  3TSZ A;  1TSF A;  2EYY A;  2ENM A;  4FYV B;  1CSK A;  3RKX A;  1NJI U;  2EWN A;  1P92 A;  1VQ5 A;  3JB9 H;  3CC4 Q;  4F7U F;  2OAW A;  3I56 A;  4J5Y A;  4RTX A;  4XU0 A;  4R0K A;  2ZPB B;  1SHG A;  2KQW A;  2E64 A;  2YUP A;  4IUV A;  4M75 A;  2FZK B;  1D3B A;  5FRO A;  3CQT A;  2KXC A;  1SRL A;  1UEB A;  2HSP A;  1NJI C;  2QEX A;  1VYT A;  1VQ7 Q;  2K5I A;  1KK7 A;  4JS4 A;  2VXF A;  1K73 U;  4FW1 A;  2DNU A;  4M75 B;  1VQ8 T;  1D3B B;  3IQL A;  5IN1 A;  1C0M A;  3REA B;  3GIB A;  3OYI A;  4C8Q G;  3TVT A;  3HRT A;  2EYZ A;  5DLO A;  8AT1 B;  5GAN d;  1VQ9 Q;  1I8F A;  5L8R E;  1K73 C;  4HFK A;  1I5L A;  3OYM A;  4M78 F;  2Z0W A;  3QZ9 B;  4C8Q E;  3G1J A;  2E5K A;  3CMA Q;  1C6V X;  2OJ2 A;  3OMG A;  1YJW T;  5EG2 A;  4IKF A;  1B3Q A;  2MWP A;  2CP2 A;  1JU5 C;  4IUP A;  1W2B S;  2G3R A;  1EIF A;  3J80 E;  3M0R A;  4JPB W;  2F2V A;  1UGS B;  2FZG B;  3NE0 A;  2L89 A;  1MV0 B;  4E7H A;  3G4S T;  3G71 Q;  2KE9 A;  2DE0 X;  1JEG A;  3VV0 A;  2M9U A;  4LUE A;  5D6X A;  1G83 A;  4M7A G;  2NUZ A;  3JB9 D;  1YWP A;  2CH4 W;  3DB3 A;  2HKQ B;  3RUX A;  2D6F A;  4ORZ A;  1B07 A;  1JJ2 S;  1VOM A;  4C5H A;  2DEQ A;  1KQS P;  2NUT A;  4M7A E;  4JZ4 A;  1Z9Q A;  1YHQ T;  2Y4X A;  1Y07 A;  2W10 A;  2VGN A;  4N0A C;  4F7U G;  1FWZ A;  3AHU A;  3MO8 A;  1GFC A;  5I22 A;  1TTH B;  3PBC A;  3G6E A;  4FM4 B;  5KYN A;  1KD1 R;  2XU8 A;  3QO3 A;  1N9S A;  4GLK A;  3OBW A;  1RAC B;  1ZUU A;  4JLI A;  2NUT B;  4J8O A;  3M9Q A;  1K1Z A;  2LQ8 A;  2GTO A;  1BCO A;  3CPW S;  4F7U E;  2VPS A;  2BTT A;  1KIK A;  1H92 A;  1R77 A;  1WJR A;  2DXC A;  5ECA A;  2CS7 A;  2H3E B;  2RJE A;  4GBQ A;  3QHS A;  2QTV A;  2RK1 A;  3BY7 A;  3FJ5 A;  5GAN h;  2CT3 A;  2RI3 A;  2VUB A;  2XD0 A;  1R8O B;  1X6O A;  2IG0 A;  5KCO A;  1ABQ A;  2EQI A;  2JTE A;  4M7D G;  3OYA A;  1N8R U;  3JCM h;  4GY5 A;  2AZS A;  2YRC A;  1VUB A;  3CCE Q;  3OYN A;  1JXM A;  4BUG A;  5AT1 B;  2BIV A;  5GAN 2;  5HCK A;  1YWO A;  4Z88 A;  1S1N A;  3I5R A;  1VQ5 T;  2L2P A;  3I56 T;  4M7D E;  1PHT A;  2K6D A;  4PJN A;  1N8R C;  2K3X A;  3TQ7 P;  3CME Q;  2R5A A;  3I35 A;  1YJN Q;  2ZAE A;  3E19 A;  1UTI A;  2COW A;  4HFL A;  2JS2 A;  1I0C A;  5LJ5 h;  3CPF A;  5C6S A;  4F04 B;  1VQ7 A;  1SPK A;  2IO9 A;  2ZPE B;  1AHJ B;  2KAF A;  2ZPF B;  3HSB A;  2L3S A;  2ED1 A;  3OYB A;  2DL3 A;  1KG1 A;  2P4T A;  1OX9 A;  3UT1 A;  3PBI A;  3GLX A;  3QYG B;  2DPP B;  3PMI A;  4QT7 A;  1YBY A;  2CZ7 B;  4F0V A;  2K3B A;  2HDA A;  1VQ9 A;  1WHH A;  1RAF B;  4IIM A;  3EH2 A;  3M0Q A;  3JCM W;  2P0K A;  3JB9 J;  2YXY A;  4ZGD B;  3J81 E;  2A0F B;  3GT2 A;  2GFA A;  2HL3 A;  4PL6 A;  5LJ3 d;  3CXC S;  3RER A;  4J6X A;  4PFZ A;  2PZ1 A;  2JUF A;  2V1R A;  4LDU A;  1NZ9 A;  2K4Y A;  3QJ6 A;  1J3T A;  1WX6 A;  1ZBJ A;  1D0X A;  1OOT A;  4EQA A;  4PJO F;  3WVE B;  2PU9 B;  1ZSZ A;  2VAS A;  3OYL A;  5A2Q E;  2DA9 A;  2K7A A;  4QKU A;  4MZM A;  3CCR A;  3L2U A;  4DOW A;  4BY6 B;  1K0S A;  5GAM d;  1V29 B;  5CK9 A;  2J06 A;  2QAZ A;  3GPL A;  3G6E T;  2E41 A;  3DLM A;  1K4U S;  5CIU A;  4BY6 C;  2P4R A;  1ZSZ B;  1O75 A;  2VV5 A;  4J9G A;  4M77 G;  3PT9 A;  2L3P A;  3QJY A;  4EMG A;  5GAN g;  5CKD A;  4RCC A;  2X4Y A;  1NBE B;  2V8K A;  2F2X A;  3PVQ A;  4QVD A;  2L8D A;  4CT3 A;  2FZC B;  3M0U A;  2DL5 A;  1GBQ A;  1YJW Q;  2LJ0 A;  3QZ5 B;  3RKW A;  4M77 E;  4BD3 A;  3KXT A;  3JCM g;  3PMT A;  1QVF P;  1WHM A;  4FQB A;  4LNP A;  1VQ4 T;  3HFO A;  3G4S Q;  5GAN 6;  3CCM A;  2VWF A;  3OS0 A;  5FLX E;  4A53 A;  4C92 A;  3JCM X;  3C4S A;  4HXJ A;  2MMP A;  1U3O A;  1GXI E;  3GNG A;  3WXM B;  4C8Q D;  2K79 A;  3JRZ A;  4A4G A;  4RTY A;  2EKH A;  1UGV A;  1Y57 A;  4CRI A;  3CC4 T;  4ELY C;  4LDY A;  4X9C A;  5IHI A;  1QW1 A;  1AOJ A;  2QG9 B;  3A30 A;  5IAY A;  2E10 A;  4C92 B;  4PFP A;  1M90 R;  1ZA2 B;  3TCJ A;  2JS0 A;  4JRP A;  1GCQ A;  1UB4 A;  5CQY A;  4PJO G;  2EPD A;  1QVP A;  4KUD K;  2KY9 A;  2J05 A;  3H0H A;  5GAM h;  3CC7 Q;  1YI2 Q;  2FPD A;  3ZFJ A;  4R55 A;  3VS0 A;  1M1F A;  2SRC A;  2XHC A;  2FEI A;  3OYC A;  1VQ9 T;  4M7A D;  3JCM V;  4PJO E;  2RNA A;  4OB3 B;  2EJG A;  5GAN 5;  1V76 A;  3OYF A;  3V8K A;  2CP5 A;  2HNI A;  4M78 B;  9ATC B;  1GCQ C;  4J9C A;  3UPU A;  1Q82 U;  3CMA T;  2E12 A;  4DBF A;  3M53 A;  1M2V A;  2H8H A;  2F5K A;  3P8D A;  1Q86 U;  5IT9 E;  4JJB A;  2DTH A;  3VS1 A;  2DD4 A;  1VIF A;  5DY9 A;  1Q82 C;  3G71 T;  4PJM A;  3EG0 A;  1M3A A;  2R5M A;  1Q82 R;  1D0Y A;  1Q86 C;  2K2V A;  2LMJ A;  1D1C A;  4CC4 B;  1XOV A;  1M2V B;  2HQH A;  1LCK A;  1RLP C;  1M8V A;  1K9M U;  5GAO l;  3X25 B;  4HT8 A;  2R57 A;  2EIF A;  4JUR A;  2OTL Q;  1VA7 A;  1UFF A;  5CO7 A;  3VS2 A;  1ZUK A;  1K9M C;  1XJW B;  2F5T X;  3HTR A;  1BBZ A;  1IO6 A;  5J39 A;  4JUV A;  4E6R A;  1R0C B;  2RM4 A;  2QQB A;  3PNW C;  4LD9 K;  4IIO A;  4M78 D;  2KEA A;  4FYX B;  3S0Q A;  4HZ9 A;  4HKE A;  1C1A A;  1PNJ A;  2JTM A;  2ED0 A;  1NEG A;  1RAB B;  4MDX A;  3VS3 A;  2KNB B;  1EX4 A;  2RJF A;  4OMN A;  1NYG A;  2E6N A;  2FPE A;  2AHJ B;  5FRN A;  3P8H A;  2RQT A;  3JV3 A;  1Z9Z A;  2ABL A;  4C0G A;  1YJW A;  4TVR A;  2X4X A;  2CSI A;  4J9D A;  1ZX6 A;  1I1J A;  4F14 A;  4ELZ C;  3HPW A;  4UC4 A;  1M1K U;  3WVD B;  1NPP A;  3G4S A;  2O2O A;  1H8K A;  4BE0 A;  5LJ3 g;  2VB6 A;  5CKB A;  3SFM A;  3C95 A;  3CCE T;  1TWB A;  1WFW A;  4EOB A;  2RQW A;  1M1K C;  3EG3 A;  2DER A;  2KT1 A;  3L2V A;  1M1K R;  1WQ7 A;  1OZ3 A;  1BU1 A;  1WXB A;  3CME T;  1YJN T;  3SWN A;  1YHQ A;  1VQN Q;  1UGR B;  4RG2 A;  1M9S A;  3EHR A;  2EQK A;  2V8J A;  4II1 A;  5GAM g;  4JZ3 A;  2O9S A;  1MNE A;  2GNC A;  3EFS A;  4FGI A;  2KVQ G;  3RBB B;  1FMV A;  1HD3 A;  4A4K A;  1MMN A;  1VQM Q;  2C06 A;  3VRZ A;  3QUI A;  3QSU A;  2FPF A;  3SWN B;  2VVK A;  1IHW A;  2QAS A;  4Q4N A;  4R56 A;  1BYM A;  2KRS A;  3CC7 A;  4XTZ A;  2J6K A;  1YI2 A;  3MJX A;  5EC7 A;  1MHN A;  2B86 A;  3M5A A;  1GL5 A;  1X69 A;  2EAY A;  1VQ4 Q;  4CI0 C;  2CP6 A;  1LPL A;  1NLP C;  1WXU A;  2VYT A;  4JDS A;  1QMC A;  2BKD N;  3THK A;  4E7I A;  2FHD A;  4EDU A;  7AT1 B;  1IZ6 A;  1N5Z A;  4J9B A;  2A7Y A;  3LWH A;  2PUK B;  1UUE A;  2KXD A;  1Q7Y U;  2YWW A;  1UE9 A;  3NFC A;  3M56 A;  2COZ A;  4J7F A;  5CKH A;  2L3Q A;  2EFI A;  4OP0 A;  4DBH A;  1NLO C;  2RA2 A;  2D0Q B;  2EJ9 A;  2EQM A;  4C5I A;  1Q7Y C;  1AWJ A;  3CCS Q;  2M16 A;  4RKU E;  4EMH A;  4Y91 A;  4FYW B;  2LQW A;  1YCY A;  1OPL A;  5GMK h;  1PKS A;  3M57 A;  4KRT A;  2CRE A;  4PJO B;  4PLL A;  1M30 A;  3UA6 A;  1U5S A;  2VKN A;  1NJI R;  1D0Z A;  1PKT A;  2OTL A;  4RUG A;  5CCA A;  2IPO B;  1K9A A;  2D0N A;  1JQQ A;  1OEB A;  1KQS S;  4EPC A;  2RQV A;  5GMK l;  5FWB A;  3OW2 A;  3CD6 T;  1Y96 A;  4NOY A;  1TUC A;  4OB2 B;  4ZGJ B;  2QTX A;  4J83 A;  3NTI A;  3OY9 A;  4M75 C;  3MPU B;  1NPR A;  4M7D F;  1EZZ B;  2BZX A;  2DYB A;  5GAO q;  4FSX A;  1UJY A;  3M0T A;  2DIQ A;  4CGK A;  4RTZ A;  1K73 R;  4E7L A;  2VPM A;  1IGU A;  1SRM A;  3OQ5 A;  2MI6 A;  2M02 A;  3JCM d;  4HT9 A;  1UHF A;  2RHI A;  3JCM Q;  2E1H A;  1G5V A;  1Y96 B;  2DF6 A;  4EQ8 A;  4D8K A;  4JJD A;  5GAN j;  3GF5 A;  2J6F A;  4X9D A;  4J9E A;  2X51 A;  4O6J A;  1JB0 E;  2YUO A;  4AFU C;  4EMK A;  2SEM A;  4BE2 A;  4PJO D;  2OTJ T;  2CT4 A;  3CBO A;  3KW0 A;  1Y7X A;  5LJ5 d;  1B34 A;  3UDC A;  1RLQ C;  1BIB A;  3CBP A;  4MZT A;  4WTO B;  2DBM A;  3SB2 A;  4F0W A;  2AK5 A;  2CDT A;  4EMK B;  1XTD A;  5GAN 7;  2DKG A;  1WPY A;  2EGC A;  4J9H A;  2MF2 A;  4ME7 A;  3MP6 A;  1B34 B;  2QI2 A;  1JBM A;  4EMK C;  4BAC A;  3CCQ T;  1VQN A;  2KT8 A;  1EFN A;  2K5F A;  1N6A A;  2DX1 A;  2LCL A;  1S72 Q;  2HQX A;  3H0I A;  4XTV A;  1T3L A;  3I9Q A;  1VQM A;  5CKE A;  3CC7 T;  3D7S B;  1YI2 T;  4Q4G X;  4XTU A;  1BCM A;  2HCK A;  2M0O A;  2RMO A;  2VGM A;  4NS5 A;  3L2Z A;  3S3N A;  5FRM A;  1VIE A;  2ZGW A;  4XTX A;  3SEM A;  4GLM A;  1GCP A;  1OU8 A;  2MPX C;  3NMZ C;  1M8M A;  1QQJ A;  4DBQ A;  1VQ4 A;  5CQX A;  2PVD B;  3A8L B;  4MZP A;  5CR2 A;  2R58 A;  2HZY A;  2DXB A;  3MP1 A;  3CCV Q;  4CC3 A;  2JTF A;  1LOJ A;  2HL5 C;  4CC7 A;  1D1A A;  1F1B B;  4FT4 A;  1PM3 A;  2P0Q A;  3TSW A;  3RR6 A;  2KYB A;  4RTU A;  3X24 B;  2PVO B;  2LX9 A;  1X01 A;  3EFR A;  1VQP T;  4YTL A;  2KRN A;  2KSS A;  4EIK A;  2JZ2 A;  2O4X B;  4IUR A;  1N8R R;  3CC4 A;  1ABO A;  4P5N A;  3VYG A;  4M77 F;  2P0P A;  3T9N A;  4WCI A;  2DJQ A;  2O31 A;  3CCS A;  2X35 A;  3KFV A;  3LLR A;  5DLQ E;  2GQV A;  1VQO Q;  3JCM b;  4KT0 E;  3ASK A;  3HHT B;  4PKC C;  2OTL T;  2A28 A;  2VC8 A;  1OUL A;  5HY6 A;  5KCH A;  2K1G A;  2A36 A;  2NLU A;  1BI0 A;  2RB6 A;  1WHG A;  2W0Z A;  2OAU A;  4ANJ A;  4C0D B;  1FMK A;  1IXD A;  3S3O A;  1NE8 A;  1VQK Q;  2XDD A;  4AG1 C;  2CP3 A;  1VQL Q;  1QP2 A;  2I2L A;  2IOB A;  2PQW A;  2KK4 A;  3CCJ Q;  1H3H A;  4PFO A;  3MEW A;  4ATO A;  3C94 A;  3I55 Q;  1SKU B;  1U1T A;  3GOX A;  1TS9 A;  2LNH B;  4Q4T A;  3CMA A;  2ZPI B;  4ZGE B;  2WSF E;  1H3Z A;  2JXB A;  1IRE B;  2DL8 A;  2YRD A;  4L5G A;  2DET A;  3OB9 A;  1V1C A;  3G71 A;  1QVF S;  4C8Q A;  3ZL7 C;  1X6G A;  1PSF A;  3TEE A;  4ZN1 A;  2HD0 A; 
#chains in the Genus database with same CATH homology
 2LX7 A;  2OI3 A;  3EGU A;  1GCQ C;  4J9C A;  2BZY A;  2A37 A;  2DVJ A;  4FGD A;  2DM1 A;  1G2B A;  1PRM C;  2H8H A;  5GJW B;  2DIL A;  2RN8 A;  1OV3 A;  4HVU A;  1HSQ A;  1NEB A;  2X3X D;  3NPF A;  1AZG B;  1SEM A;  4JJB A;  2MCN A;  3VS7 A;  3VS1 A;  2M0Y A;  2KGT A;  3VS6 A;  2C0T A;  1NM7 A;  3A98 A;  3NGP A;  3EG1 A;  1CKB A;  3EG0 A;  5L23 A;  1M3A A;  2IOA A;  1AWW A;  4X1V A;  4FDY A;  2LMJ A;  4Z8A A;  2G6F X;  4CC4 B;  1QWE A;  1WDX A;  1XOV A;  1M3B A;  1LCK A;  1RLP C;  2KR3 A;  4DEY A;  1RUW A;  2FG0 A;  2MIO A;  2KRM A;  1UEC A;  1QKW A;  3ULR B;  2RQU A;  4HPE A;  3TSZ A;  2LQN A;  1VA7 A;  2EYY A;  2ENM A;  1UFF A;  1CSK A;  2JM9 A;  3VS2 A;  2EGE A;  1ZUK A;  1T0H A;  2RQR A;  5FW9 A;  1BBZ A;  2OAW A;  1X6B A;  4RTX A;  1IO6 A;  2DLP A;  4R0K A;  2O9V A;  1SHG A;  4E6R A;  1E7O A;  2CSQ A;  2YUP A;  3LH5 A;  1U06 A;  4RTW A;  4IIO A;  2KEA A;  2YT6 A;  3CQT A;  3S0Q A;  2KXC A;  4HZ9 A;  2YUQ A;  1SRL A;  2HSP A;  2K9G A;  1PNJ A;  1VYT A;  2ED0 A;  1NEG A;  3VS3 A;  3VRY A;  2KNB B;  1YCS B;  1CKA A;  1JO8 A;  4OMO A;  4OMN A;  1NYG A;  2FPE A;  4D8D A;  2RQT A;  3JV3 A;  1Z9Z A;  4ZNX A;  2ABL A;  2DNU A;  2KRO A;  3IQL A;  2I0N A;  4J9I A;  3REA B;  2CSI A;  3TVT A;  4J9D A;  2V1Q A;  1ZX6 A;  2EYZ A;  1QWF A;  1I1J A;  4F14 A;  1T0J A;  2RF0 A;  2O2O A;  1H8K A;  1BB9 A;  3UF4 A;  1X27 A;  5IXF A;  4A63 B;  2E5K A;  1WFW A;  2OJ2 A;  4EOB A;  2RQW A;  2C0I A;  2C0O A;  1B3Q A;  3VPJ A;  3EG3 A;  2O88 A;  1JU5 C;  3M0R A;  4JPB W;  2KT1 A;  2F2V A;  4Z89 A;  3NE0 A;  3VS4 A;  1PRL C;  1X43 A;  1MV0 B;  1BU1 A;  1WXB A;  1PWT A;  4K11 A;  2D1X A;  4DEX A;  2YSQ A;  4FSS A;  2DRM A;  2KE9 A;  2ROL A;  2DE0 X;  1JEG A;  3QWX X;  4LUE A;  3EHR A;  1G83 A;  4CSH A;  2NUZ A;  2PTK A;  4JZ3 A;  2O9S A;  2GNC A;  4LN2 A;  4FGI A;  4M4Z A;  3RBB B;  5FWC A;  4CC2 A;  4JXB A;  1YWP A;  1HD3 A;  2CH4 W;  2EW3 A;  2ECZ A;  3VS5 A;  1HJD A;  4ORZ A;  1B07 A;  3VRZ A;  2JM8 A;  2FPF A;  2D8H A;  3A2Z A;  2VVK A;  4JZ4 A;  1Z9Q A;  2RPN A;  1GBR A;  4Q4N A;  2KRS A;  4OMM A;  2J6K A;  1WI7 A;  4AFZ C;  1T3S A;  2W10 A;  5EC7 A;  5IHN A;  2B86 A;  1GFC A;  5I22 A;  1GL5 A;  1X69 A;  3PBC A;  4RTV A;  1NLP C;  1WXU A;  1A0N B;  1WXT A;  2NWM A;  3THK A;  1ZUU A;  2JMA A;  2GGR A;  5IXB A;  3H41 A;  2LZ6 B;  1AZE A;  1K1Z A;  1RI9 A;  1N5Z A;  2GTO A;  4J9B A;  1MV3 A;  1M3C A;  2VPS A;  2J7I A;  2BTT A;  1KIK A;  2HBW A;  2YUN A;  1UUE A;  1H92 A;  2KXD A;  4LJ1 A;  1UE9 A;  2EYW A;  5ECA A;  4GBQ A;  2L3Q A;  3UA7 A;  3FJ5 A;  2CT3 A;  1M27 C;  1NLO C;  1AEY A;  1ABQ A;  2EQI A;  4Y92 A;  1AWJ A;  2JTE A;  2LQW A;  1OPL A;  1PKS A;  2M51 A;  4KRT A;  2AZS A;  2CRE A;  2FO0 A;  3PVL A;  1JXM A;  1UDL A;  2DBK A;  1M30 A;  3UA6 A;  1U5S A;  5HCK A;  2VKN A;  1ZUY A;  2GTJ A;  1YWO A;  4Z88 A;  1S1N A;  1PKT A;  1JXO A;  3I5R A;  4OMP A;  2K2M A;  1QKX A;  1SSH A;  2L2P A;  2QDL A;  4RUG A;  1PHT A;  2K6D A;  2DL4 A;  4AFQ C;  1K9A A;  2D0N A;  1JQQ A;  4HZB A;  1OEB A;  1FYN A;  2A08 A;  3UAT A;  3O98 A;  2RQV A;  3I35 A;  5FWB A;  3I86 A;  3QWY A;  1TUC A;  1UTI A;  2JS2 A;  4AFS C;  3M1U A;  1I0C A;  3R6N A;  2IO7 A;  1VYU A;  5I11 A;  4RTT A;  2BZX A;  3H0F A;  2IF6 A;  3EHQ A;  4FQA A;  2DYB A;  1YN8 A;  2CUD A;  3I5S A;  1UJY A;  3M0T A;  4CGK A;  4RTZ A;  2F2W A;  2EGA A;  2VPM A;  1SPK A;  2IO9 A;  4J9F A;  1SRM A;  1E6H A;  1I07 A;  2KBT A;  5IHK A;  1UHF A;  2DRK A;  2GBQ A;  2EVR A;  2AKK A;  2CUB A;  2JW4 A;  5IH2 A;  3GBQ A;  2L3S A;  2ED1 A;  4EQ8 A;  2DF6 A;  2DL3 A;  4D8K A;  3PBI A;  4JJD A;  2DL7 A;  2PNI A;  1WA7 A;  1AWO A;  4F4M A;  2J6F A;  4J9E A;  4QT7 A;  3M0S A;  4F0V A;  2HEQ A;  2K3B A;  2YUO A;  2HDA A;  4AFU C;  3VPI A;  2SEM A;  4IIM A;  3M0Q A;  2CT4 A;  3O5Z A;  2K3A A;  3KW0 A;  2LRJ A;  4OLK A;  4ESR A;  2EBP A;  2FRY A;  1RLQ C;  5GJV B;  4AG2 C;  2DBM A;  3GT2 A;  1W1F A;  1AVZ C;  4F0W A;  2AK5 A;  2CDT A;  2ESW A;  2JT4 A;  1BK2 A;  2PZ1 A;  2V1R A;  1AWX A;  3U23 A;  1YNZ A;  2X3W D;  2EGC A;  4J9H A;  3RNJ A;  3SHW A;  4HCK A;  1J3T A;  1WX6 A;  1ZBJ A;  1OOT A;  4EQA A;  1NYF A;  2KT8 A;  1EFN A;  2ROT A;  1VYV A;  4LE9 A;  2DX1 A;  2KYM A;  3H0I A;  2MOX A;  2XIV A;  1KSW A;  1T3L A;  2DA9 A;  2K7A A;  3I9Q A;  1WYX A;  1Y0M A;  2IIM A;  4Q4G X;  2AKL A;  1K0S A;  4F17 A;  2HCK A;  2J06 A;  2RMO A;  3EG2 A;  4OML A;  1TG0 A;  1K4U S;  2LP5 A;  3SEM A;  4GLM A;  2P4R A;  1GCP A;  3NMZ C;  1M8M A;  1ARK A;  1K0X A;  4J9G A;  2L3P A;  3REB B;  4LUD A;  1GFD A;  1KJW A;  2LCS A;  3M0P A;  2F2X A;  3PVQ A;  1ZLM A;  4CC3 A;  4CT3 A;  3M0U A;  4HVW A;  2DL5 A;  1GBQ A;  1UG1 A;  4HVV A;  4CC7 A;  2LJ0 A;  1MUZ A;  2GQI A;  3TSW A;  2VOB A;  2KYB A;  4RTU A;  3PE0 A;  4OMQ A;  2AZV A;  4FQB A;  4LNP A;  1TUD A;  2KRN A;  1X2Q A;  4EIK A;  3NHN A;  1ABO A;  2VWF A;  1GRI A;  4WCI A;  2DJQ A;  2IO8 A;  2O31 A;  3KFV A;  1QLY A;  1KFZ A;  1NG2 A;  1UJ0 A;  4HXJ A;  1W70 A;  1E6G A;  4F16 A;  1U3O A;  1W6X A;  2K79 A;  2A28 A;  1ZSG A;  2XMF A;  2EKH A;  2JMC A;  4RTY A;  2K1G A;  1UGV A;  2A36 A;  1UHC A;  4JJC A;  1Y57 A;  2D8J A;  1OPK A;  2W0Z A;  3C0C A;  1QCF A;  5IHI A;  1WIE A;  1FMK A;  1AOJ A;  3A30 A;  3A2Y A;  2DMO A;  4AG1 C;  2BZ8 A;  2IOB A;  2JS0 A;  1WLP B;  1GCQ A;  1H3H A;  4FGE A;  2J6O A;  2LJ3 A;  2EPD A;  2FRW A;  2J05 A;  3H0H A;  2LNH B;  4Q4T A;  1K76 A;  2EYX A;  2FPD A;  1YP5 A;  3VS0 A;  1SHF A;  2SRC A;  2YDL A;  2FEI A;  2JXB A;  2RNA A;  2DL8 A;  2CH4 A;  1X2K A;  2L0A A;  1V1C A;  2LJ1 A;  3ZL7 C;  1X6G A;  1AD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...