4R0KA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
303
structure length
301
Chain Sequence
PMPADSAYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Dipeptidyl-peptidase VI
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from Bacteroides thetaiotaomicron VPI-5482 at 1.75 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
total genus 84
structure length 301
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 4r0kA03
3GBQA 4DEYA 2EKHA 3PBCA 2RQTA 3KFVA 3QWYA 2AKKA 5I22A 3C0CA 2HSPA 1K9AA 1UGVA 2DBKA 1H3HA 5FW9A 1ZX6A 4LUDA 2LX7A 3I5RA 1NG2A 1LCKA 2V1QA 4LJ1A 2YT6A 2OJ2A 3REBB 4HVUA 1ZUYA 4F0VA 3VPJA 2A36A 1S1NA 2DILA 4AG1C 2IO9A 4JJDA 3VS0A 4K11A 2FEIA 1NEGA 2CDTA 1FMKA 1OOTA 3NPFA 4ESRA 1QKWA 2M51A 4RTWA 3H0FA 2IIMA 2RF0A 2XMFA 2CUBA 2VWFA 2DRMA 3THKA 1CKAA 1T0HA 2J06A 2D0NA 2LJ1A 1QCFA 2LQNA 5IHIA 1NM7A 2YUNA 1YCSB 4RTZA 2OI3A 1VYVA 1K1ZA 2P4RA 2OAWA 2ECZA 2DYBA 1K4US 3KW0A 4JZ4A 2L0AA 2LRJA 4EQAA 1Z9ZA 1UG1A 1AZEA 1G2BA 2G6FX 2K2MA 2XIVA 1WFWA 2D1XA 2JT4A 1BBZA 1X2KA 2RQVA 2FPFA 1K76A 1U5SA 2F2VA 3VS4A 5GJWB 2GQIA 3M0QA 1PKTA 3CQTA 2KXCA 4QT7A 4FQBA 3JV3A 4KRTA 5IHKA 2KYBA 3M0PA 3NGPA 4D8KA 3M0TA 2PTKA 2VOBA 5FWBA 1PKSA 3R6NA 2IOAA 1Z9QA 2L3SA 1B07A 3EG3A 4X1VA 4JZ3A 1ABOA 4Q4NA 1H8KA 1BK2A 2SRCA 1ZUKA 3I86A 2RQRA 1SEMA 1U3OA 3M1UA 2AKLA 2BZYA 4LUEA 1HSQA 2AK5A 4LN2A 3PE0A 1RI9A 1UJYA 1M8MA 5IXFA 2GTJA 5GJVB 1WLPB 2LQWA 3VRZA 2CSQA 3EHQA 4EOBA 1VYUA 2KRNA 4OLKA 2KT8A 1QWFA 2KRMA 1W70A 3TSZA 4AG2C 2J6KA 2FO0A 4LNPA 3VS7A 1PWTA 2HCKA 1TUDA 1WYXA 2IOBA 2JS0A 4A63B 1FYNA 2DBMA 2GNCA 2YSQA 2KEAA 1UHFA 5L23A 2KR3A 1KIKA 1KFZA 2YDLA 1I0CA 2JMAA 1K0XA 1I1JA 2QDLA 3A98A 2JS2A 4OMPA 2AZVA 3M0SA 1WI7A 1K0SA 4FGDA 1NEBA 2KROA 1V1CA 3TVTA 1GL5A 4RUGA 2IF6A 4FDYA 2K1GA 1RLPC 2DL7A 2I0NA 3PBIA 1JO8A 5IXBA 2F2XA 4HPEA 3S0QA 2O2OA 2EYXA 2D8HA 3H41A 1AWWA 2LJ3A 2CREA 3UF4A 4HZ9A 3M0UA 2A08A 4HVWA 1OV3A 1M27C 4CC7A 4Q4GX 1HJDA 1Y0MA 4CC4B 1UUEA 3SHWA 1CSKA 1AWOA 2K79A 1RLQC 4M4ZA 2VVKA 4GLMA 1W6XA 2FG0A 2VKNA 3A2YA 1M30A 4JJBA 2SEMA 2KXDA 4CGKA 1BU1A 1E6HA 1J3TA 4OMMA 4Z8AA 2JMCA 4EQ8A 4FSSA 1E7OA 2DNUA 2NWMA 4J9EA 4JJCA 4E6RA 2LNHB 5EC7A 2K6DA 3VPIA 1TG0A 3QWXX 1X6BA 2J7IA 3EGUA 2J6FA 1M3AA 4J9HA 1X6GA 1WX6A 2J05A 2PNIA 4D8DA 4OMLA 4CC3A 1YP5A 1JEGA 1WXTA 2GGRA 1WXBA 2K7AA 3M0RA 2V1RA 2GTOA 2KE9A 2DJQA 4CT3A 1YN8A 2DM1A 1OPLA 2DVJA 1HD3A 2L2PA 1AZGB 4J9DA 1MUZA 2RN8A 2DL5A 5IHNA 2CT4A 2HDAA 4WCIA 5HCKA 1EFNA 1I07A 4J9CA 2DE0X 2EQIA 1X69A 1ZSGA 2K9GA 2ROTA 1Y57A 4JXBA 4OMQA 4OMNA 1TUCA 4AFZC 5IH2A 2YUQA 1PNJA 1GCQA 3REAB 1U06A 2W10A 3VS6A 2CSIA 4FGEA 2RPNA 1NLOC 1GRIA 2EYZA 4GBQA 2MCNA 3LH5A 4RTTA 1SHFA 3VRYA 1RUWA 2CT3A 1WXUA 2DLPA 4IIOA 4AFSC 2HBWA 4J9GA 1NYFA 3TSWA 2BTTA 1GBQA 4HZBA 1JQQA 4EIKA 2YUPA 2EW3A 1SSHA 1JXOA 4Y92A 3O5ZA 4F0WA 1PHTA 1PRLC 3O98A 1UECA 1T0JA 2L3QA 2LMJA 2DL3A 1UJ0A 4HCKA 2RQUA 2JM9A 2LCSA 2X3WD 1ARKA 3UATA 1X27A 2KGTA 3NMZC 1VA7A 4CSHA 1XOVA 2ED1A 2RNAA 2W0ZA 1QKXA 4F17A 1PRMC 2MIOA 1AEYA 1UHCA 1JU5C 2VPSA 1ZBJA 1ZLMA 2EBPA 4HVVA 2EGAA 2VPMA 4FGIA 1WDXA 2J6OA 2ENMA 1T3SA 3VS3A 1OPKA 1ABQA 1YNZA 4RTYA 3NHNA 4CC2A 1GCPA 2A37A 2BZ8A 2KBTA 2RMOA 2CH4W 3EG0A 5I11A 1KJWA 4AFUC 2O9SA 2JW4A 3ZL7C 1CKBA 2BZXA 2C0IA 4Z89A 4IIMA 4J9IA 2IO7A 2DF6A 2H8HA 3I9QA 2CUDA 3VS5A 2O88A 1MV0B 1NYGA 2CH4A 1AVZC 2A28A 2JM8A 2DL8A 1SRLA 1QLYA 1UDLA 3EG2A 2DX1A 2HEQA 2F2WA 2DA9A 1YWPA 1QWEA 2K3AA 1NLPC 2ABLA 3UA6A 2JXBA 4F16A 2O31A 2IO8A 1UFFA 3U23A 3A2ZA 2FRWA 2D8JA 2EYWA 1YWOA 3H0IA 2MOXA 4HXJA 3FJ5A 3SEMA 2DL4A 2KT1A 2KYMA 2RQWA 1GBRA 5FWCA 3IQLA 3RNJA 3I35A 4RTVA 3VS1A 4DEXA 1WA7A 1MV3A 4F4MA 1AOJA 2B86A 1AWJA 2FPEA 1UE9A 1SHGA 2DMOA 3PVQA 3GT2A 1IO6A 3RBBB 1B3QA 3ULRB 1ZUUA 2X3XD 2M0YA 2E5KA 1H92A 2PZ1A 2ESWA 2FPDA 1OEBA 2FRYA 2LP5A 1M3BA 2NUZA 2EYYA 1X43A 4F14A 1GFCA 3I5SA 3NE0A 2C0OA 1T3LA 2GBQA 1M3CA 2JTEA 2K3BA 2ED0A 4OMOA 3H0HA 2EVRA 1E6GA 3UA7A 3VS2A 4Q4TA 1AWXA 1X2QA 4LE9A 4RTUA 2EGCA 1W1FA 1VYTA 1KSWA 2L3PA 2KRSA 4ORZA 1G83A 4R0KA 1N5ZA 4FQAA 1SRMA 1GFDA 1BB9A 2EGEA 4JPBW 1AD5A 2LZ6B 1A0NB 3EHRA 1SPKA 4RTXA 1JXMA 3A30A 3EG1A 4AFQC 4Z88A 1GCQC 5ECAA 2LJ0A 2AZSA 2ROLA 3PVLA 2EPDA 4J9FA 1WIEA 2KNBB 2C0TA 4J9BA 1UTIA 2O9VA 2DRKA 4ZNXA 2YUOA
chains in the Genus database with same CATH superfamily
3GBQA 2RQTA 1VQOT 5A0GA 1SG5A 3QWYA 2AHJB 3CC2A 2XKOC 4ANJA 4ZGJB 3RR6A 5CVIA 2GFAA 2YRVA 1M1GA 2BE9B 1VQ7A 4AG1C 1YJNA 3VS0A 4K11A 2YLCA 1NEGA 1FMKA 1OOTA 4JRPA 1YIJA 2EFIA 2M51A 3BDUA 2VWFA 2F1LA 3JCMQ 2DO3A 2HKQB 1KD1C 3EGXA 3THKA 3QSUA 1ZSZA 2RH2A 2D0NA 3CBMA 1KHCA 2YRDA 5IHIA 2YUNA 1XNIA 2NUPA 5FLXE 4C92E 1JJ2P 4OB1B 2P4TA 4JZ4A 1BI2A 1R0BG 1Z9ZA 3JCMf 1B34B 1UG1A 1VQLT 1G2BA 2K2MA 2JT4A 5HK0A 1BBZA 4HKEA 3QDFA 1K76A 3V8LA 3L2QA 1ZHIA 2QQBA 1IRXA 3A8GB 4C8QC 1PKTA 3CQTA 2KXCA 5GMKm 1VQ8T 3JB9H 3CCVT 2KYBA 1VQOQ 1NBEB 1Q81U 1WNLA 4ZGEB 2PTKA 1FX7A 3MEWA 2MWPA 2BIVA 3G7ZA 1M2VB 4II1A 3DKMA 1ABOA 1M8VA 2SRCA 1ZUKA 3M4GA 5CQYA 2L5QA 4FCYA 4CRIA 4ZTJA 1KD1R 1G3WA 3QZ5B 4M78G 3KBGA 3L2VA 1TOVA 2CSQA 1TH7A 4DBHA 2E65A 2LX9A 2DEUA 2ZPBB 2KRNA 1QWFA 1W70A 2FB7A 3CMET 3CC4T 4LNPA 3EFOA 1VQNQ 2HCKA 1WPYA 4A63B 2DBMA 1OULA 2KEAA 4EMKB 1UHFA 4C92G 2JN0A 1VQLQ 3QXEB 1Q7YU 2JS2A 2AIRB 3M0SA 3MP1A 3OYMA 2EQKA 4M78B 1D3BB 2KSSA 1VQ8Q 4B9WA 2IF6A 2RJCA 4J7FA 3OYBA 3SD4A 1RLPC 4GLKA 4M77E 2F69A 4J8OA 1V29B 3S0QA 1VQMA 2HNIA 2K3XA 1AWWA 2LCCA 3MKDA 4HZ9A 2PVDB 4C92B 4KUIA 3QUIA 2FZGB 2KY9A 5A0LA 2CP2A 4Q4GX 2V8KA 5CK9A 1UGRB 3SHWA 3BE3A 3AHUA 4GY5A 3RMSA 4DBRA 2P0PA 1VQ6T 1RLQC 4M4ZA 3AT1B 1HXDA 1PM3A 2VVKA 1QVFP 2VXEA 1W6XA 2HQXA 1WHHA 3A2YA 1NJIR 2GCXA 2XD0A 3SWNC 3CC4Q 2M16A 4JRQA 1H3ZA 2MF2A 4OMMA 4L5GA 4DOWA 1TUGB 2JMCA 2NWMA 3DLLA 2EJ9A 4BD3A 4E6RA 3JCMe 2L3RA 4Q5WA 1TG0A 2QGFB 4M78D 2J7IA 3NFCA 3OY9A 2J6FA 2RHYA 4J9HA 1X6GA 4JURA 2L89A 5FROA 3GLXA 4PFZA 3HL8A 2GGRA 4EMKC 2P0QA 4RKUE 2JTFA 4KULA 2KE9A 1VQ4Q 2DJQA 2DM1A 2VC8A 3CCET 1M5Q1 2MI6A 3CD6A 2B8AA 4A4EA 2DD5A 3ZFJA 3CMAT 2FYKA 4M77G 2HDAA 4C92D 4M7AE 2O4XA 2CP0A 2EAYA 4JXBA 4ZN1A 1TUCA 1VUBA 1S72A 3REAB 2E3IA 4IUVA 1U06A 5CKBA 3E1SA 2BE7D 3JB9D 1VQ6Q 1LOJA 3N5BB 1QVGA 3H6ZA 3LH5A 3M55A 3EGXB 1X01A 4D6WA 2RHUA 1D1CA 3P8BB 4J9GA 5CKFA 1NYFA 3TSWA 3WVDB 3G6ET 2NUPB 1GBQA 4HZBA 4M77B 3LLRA 1SSHA 1JXOA 4Y28E 4Y92A 3O5ZA 4F0WA 4LDUA 1PHTA 1Q7YC 1PRLC 1Y71A 3UT1A 1YHQQ 2LMJA 2M1HA 4M78F 2X3WD 2QA4A 5GANh 2DAQA 4RG8A 3NMZC 1UEBA 3EAEA 1KK7A 4CSHA 1EIFA 1VOMA 4HA8A 4IUPA 2W0ZA 2COZA 1PRMC 2MIOA 4O5VA 2DZCA 1UHCA 3ASKA 4KT0E 1JU5C 2EBPA 5M9OA 4C92F 3CMAQ 4E2FB 2J6OA 4DA4A 1T3SA 2R57A 4CC2A 2KBTA 2JNGA 2WSFE 4AFUC 4QQGA 1CKBA 2BZXA 3JB9F 1QQJA 2QGGA 2MAMA 1JB0E 4HFLA 4J9IA 2IO7A 5D7UA 3OYCA 4OVAA 2O88A 1MV0B 3NTIA 2K5FA 2CH4A 2JM8A 2WSCE 1Q82R 4C8QA 1SRLA 1UDLA 2QXFA 3JRZA 3EFOB 4M77D 4PNOA 3G6EQ 3A8OB 1JRIA 1YWPA 1QWEA 4PJMA 1VIEA 3UA6A 2JXBA 3OYIA 2O31A 1YCYA 3I55Q 4BE1A 4LDVA 1C1AA 5LJ3j 5C0MA 4L6V5 1UB4A 2FRWA 2D8JA 4J30A 4HXJA 2RQWA 2KYMA 4KH1B 3OYKA 1NPRA 4HCBA 2RI5A 3IQLA 3JCMX 3QG1A 3CC7A 3INZA 2EKOA 1GXIE 3EBQA 4F4MA 1AWJA 1BI0A 5KYUA 2WSEE 3OMCA 4OGCA 2RD1A 3X20B 2QQRA 1WZOA 3ULRB 1D0YA 3QKJA 2PZ1A 1KC8U 3RKXA 2ESWA 2FPDA 2V8IA 3GF5A 2RK2A 1M3BA 4PJJA 3A8LB 4C5GA 3OYDA 3I5SA 3NE0A 3VUZA 1WHKA 3MEAA 4LDXA 3OS0A 2VXFA 2EVRA 1E6GA 3CBPA 2EJGA 4XQ3A 4RTUA 4JDSA 1KSWA 1TSFA 2DIGA 2OTJA 1KQSA 1XJWB 1IXDA 1M90R 3CCQA 4P5NA 1GFDA 1G3YA 2ZPIB 2EGEA 4TVRA 4JRIA 1SPKA 4FL6A 1B34A 4AFQC 1QP3A 1GCQC 5ECAA 2FHDA 2LJ0A 2XHCA 2AZSA 1G3SA 3PVLA 4E7SA 2KNBB 3OW2S 4YTLA 5LJ5f 5KYXA 5CKHA 3L42A 4C8QE 1YI2T 3X26B 2QG9B 2OAUA 2E6ZA 1WHGA 5J3BA 1VQPA 5D6WA 3MEUA 1M2VA 3MHXA 3PGGA 1I4K1 1YITA 4N4HA 4Z02A 3C0CA 4M7AC 3META 2DBKA 3SWNA 1ZX6A 1LCKA 2YT6A 2OJ2A 3REBB 1OZ3A 3D7SB 1ZUYA 3G71A 2VGMA 5GANd 2DILA 8AT1B 2KI7A 2IO9A 4JJDA 2X4XA 3NPFA 1QKWA 4RTWA 2E70A 3H0FA 4AMCA 5L8RE 2CUBA 2LRQA 4JLGA 4BI8B 2E5QA 1KD1U 2LT4A 2RHXA 1BCOA 1QCFA 3BW1A 3CCLA 4O6JA 4RTZA 4EMKA 2HKNA 2X51A 2OI3A 2X4WA 2OTLT 2OAWA 4JS4A 1PG5B 4DBFA 5FU7C 3CCST 3RDVA 3KW0A 4QQDA 3FIFA 4EQAA 4IUTA 3M53A 1UGSB 1EZZB 1AZEA 2XIVA 2XIDA 3OYHA 2EQJA 3RERA 4LD6A 4JLIA 3HHTB 3FJPA 2GQIA 3LYIA 1YI2Q 1K9MR 4FQBA 5IHKA 3M0PA 1HYOA 3PFSA 3M0TA 3OQ5A 2CGHA 4C8QG 4QKUA 3FLGA 2VOBA 3E19A 1OU8A 2LQKA 2L3SA 2RI3A 3EG3A 1VQ9Q 4X1VA 2RJFA 1H8KA 2F5TX 3I86A 5A0DA 1U3OA 2R5AA 2BZYA 4LUEA 3PE0A 1RI9A 2X4JA 3J80E 2GTJA 1WLPB 3G4SQ 5GAMg 3VRZA 4EOBA 1VYUA 1TU0B 5GMKe 1QP2A 2KT8A 4C8QB 4LD9K 4F04B 2J6KA 4ELYC 2HD0A 1LNXA 3VS7A 3L2UA 1PWTA 2PUOB 1KQSP 3J81E 2QEXA 2QK0A 3CCSQ 1UGPB 5L23A 4X34A 1KFZA 2YDLA 3I56T 2M0OA 1I0CA 2JMAA 2K4YA 1I1JA 5LJ5e 4OMPA 2AZVA 3V7CA 1RAIB 2IPOB 4FGDA 1RACB 5KYUB 3TVTA 2E10A 1VQ7T 3HRUA 1JO8A 2D0QB 2F2XA 5FU6C 1FXXA 4HPEA 3OYLA 3NTKA 5KCHA 3OYNA 2BUDA 2E1HA 3UF4A 1QVFA 5GAMh 2EQMA 5LJ3g 2DVEA 1M27C 2LVMA 2DK3A 2VGNA 1UUEA 3SDZA 5KYNA 1CSKA 4OGEA 3LGFA 5KE2A 2RM4A 3R6OA 4C8QD 1VQNT 2HMAA 1ZA2B 4M77A 2KAFA 1MNDA 4FW1A 1PSFA 1E6HA 3C4SA 4Z8AA 5CQXA 1M1FA 1BI3A 4J9EA 1MMNA 4JJCA 3I56Q 2YRCA 5I21A 1K73R 4N0AC 4OMFB 3VPIA 4MMKA 3LW5E 5KYWB 1X6BA 5KYXB 3CPWA 3EGUA 2FL7A 1Q86R 4CC3A 1JEGA 3VUBA 1VQ7Q 2V1RA 2GTOA 2RJEA 1YJNQ 4CT3A 5LJ3h 1YN8A 1I5OB 1OPLA 2DVJA 1YIJQ 4F7UE 5CKEA 5GANe 1K8AR 4J9DA 4KUDK 2CT4A 3SWNB 1LVKA 2ROTA 2PUKB 2DXCA 3PT9A 4QVDA 2CZ7B 2VASA 1GCQA 1VQ8A 3CCVA 1MMDA 2DJZA 4V2SA 3VS6A 4E7KA 4Y91A 4XTXA 2RPNA 3KXTA 4GBQA 2EYZA 2ZZDA 4RTTA 1RABB 4PJNA 1NJIC 2DLPA 4IIOA 5GAN3 2ZPGB 2BTTA 3C95A 4PJOE 2QYZA 3MJXA 1XQHA 3ME9A 5CKDA 3L2ZA 2EW3A 4KGXB 4M7AA 2CP5A 2RQUA 2JM9A 4XU0A 2RO0A 1ARKA 1VQMT 4XU3A 3DB3A 2Y4YA 4A53A 1RAGB 3FB9A 4JJNK 5I2MA 1VQ4T 1VQKA 3CMEA 5LJ5g 1OZ2A 2ED1A 1U1SA 4C0DC 4PK4A 3JCMP 3PIOA 2DZ9A 1BCMA 4LDWA 3BFMA 3EH2A 4FGIA 2ENMA 3HP9A 3BDLA 2XK0A 1YNZA 4UC4A 1G5VA 2KQWA 4F7UG 1GCPA 2A37A 2BZ8A 4PFPA 2CH4W 5GAOp 3EG0A 5I11A 3JCMd 2O9SA 4OF1A 2COWA 2V26A 5DM7R 1N8RC 2C0IA 2VUBA 4Z89A 5IT9E 2JJ9A 3T9NA 3VS5A 1NYGA 2A28A 2DL8A 3H8ZA 5J26A 3QIIA 1VQ5T 1QLYA 3EG2A 5CIUA 1YJWA 4NOYA 4NL3A 4M7DE 2HEQA 3DB4A 3KUFA 1YHQT 3M9QA 4F16A 1M1KR 4F7UB 1MNEA 4PJOG 2NYSA 3A2ZA 2WP7A 3FJ5A 2KT1A 1VQ6A 1VQMQ 3RNJA 2I2LA 2EQUA 4DEXA 3O8VA 1MV3A 1RADB 2B86A 2FPEA 1UE9A 3HFOA 2DMOA 1IO6A 6AT1B 4C0GA 4PJLA 2RJDA 5HKCA 3CPWP 5KCOA 1H92A 2E5KA 4B9XA 2LTOA 2PVOB 4XAXB 1OEBA 4FYYB 2DXBA 3ZBDA 2DETA 4NS5A 1IGUA 4PJOB 1LPLA 1N8RR 2MYSA 2GBQA 2MWOA 2JTEA 2DYIA 8ATCB 1PCXA 3PMTA 2ED0A 3CCRT 4OMOA 4DQ2A 4Q4TA 1AWXA 4XU1A 2E64A 3CCEA 1FMWA 5LJ3d 1N5ZA 3CMAA 1Q82C 1VQ5Q 1N9SA 3I55T 2P84A 1A0NB 4RTXA 3OYEA 4JUVA 2DD4A 4FU6A 4Z88A 5GAMj 3HRSA 1G8XA 2EPDA 3CD6Q 2C0TA 4J9BA 4ZNXA 3M54A 4XTYA 2DIQA 2DPPB 4DEYA 2EKHA 3PBCA 1Q81R 3G6EA 2HBPA 3KFVA 1S72Q 4ELZC 4IUUA 1K9MU 3ER0A 1PC0A 1YJ9A 5I22A 3S3MA 1K9AA 3V8KA 5AT1B 1UGVA 1H3HA 4LUDA 3I5RA 4MMLA 4LJ1A 4M7DB 2V1QA 1TWBA 1KQ1A 2HZYA 4WTOB 4M7AG 4F0VA 3VPJA 4J7IA 3L2WA 2A36A 1S1NA 3CCRQ 2FEIA 2CDTA 4N0AA 1KQ2A 4ESRA 2IIMA 4FYVB 2CP3A 5GMKi 5GAOl 4E7HA 4PJOC 4ZTFA 1CKAA 3MCAB 2LDMA 1T0HA 3CXCS 1M90C 2LJ1A 3WXMB 2QA4Q 4JS5A 1NM7A 1VYVA 2P4RA 1TTHB 5KH6A 4R55A 2YLBA 3OW2A 2DYBA 1K4US 1QVGS 3A8HB 4M7AB 2L0AA 2V8JA 3FDRA 3JCMg 1WFWA 1W2BS 1M9SA 1IB8A 3CCJA 1X2KA 2KK4A 4PLIA 2RQVA 5HK3A 4N4GA 4C0ZA 4J32A 2DTHA 1U5SA 2F2VA 4C5IA 5GJWB 2PU9B 3M0QA 4QT7A 5EG2A 3P8HA 4KRTA 4D8KA 5DLQE 1DJ7B 1PKSA 4EDUA 2IOAA 2MK5A 1WQ7A 4KGZB 2OTJT 1B07A 1JBMA 5GAN7 3OBYA 3OSSC 4Q4NA 1BK2A 5LL6S 2AT1B 5I2SA 5KE3A 2RQRA 4BI4A 5FU7B 2AKLA 4E47A 1I81A 1HSQA 2AK5A 1UJYA 1WQWA 1M8MA 3JCMJ 5GJVB 1M4ZA 4M77F 3EHQA 2E3HA 2EJFA 4M7DC 2KRMA 1D0ZA 4MZMA 3RESA 2DXTA 3CC7Q 2FO0A 3JCMh 2XICA 3JCMc 4WF2A 3C12A 1WYXA 4A4FA 1C6VX 4M7AD 2YSQA 1QCOA 4OP0A 5KYWA 3MO8A 1K0XA 3A98A 1QVPA 1RAHB 1WI7A 2KROA 2KMTA 1GL5A 4M75C 1K9MC 2LT1A 4BY6B 2DFUA 5D6YA 4FDYA 4FW2A 3X25B 3EFRA 2I0NA 3X28B 3PBIA 5IXBA 1VQ9T 3TU4K 2GQVA 3H41A 2OTJQ 2X4YA 4FIBA 5IAYA 3CCQQ 4DOVA 4HVWA 1OV3A 4CC7A 5FRNA 5LJ5j 3G4ST 1WGSA 1EX4A 1Y0MA 5GAN6 1AWOA 4CI0C 2FZKB 4GLMA 5CO7A 2FG0A 1B7TA 2YWWA 4KBMB 4FYXB 4M7AF 2K2VA 2DNUA 5FU6B 2DTIA 1VQPQ 3GPLA 1D1AA 2HSEB 5EC7A 4OB2B 2K6DA 4RCBA 3QWXX 2CZ6B 1YITQ 3OW2P 3A1PA 3M5AA 3OS2A 3UPUA 1WHMA 3CCMT 1ZBXA 3L2RA 2PNIA 4OMLA 3CCUT 1WXTA 4X9CA 3G71Q 1WXBA 5GAOm 4MDXA 2K7AA 3M0RA 1O75A 4XTUA 3EGDA 2OTLA 5GANf 2HAXA 1V76A 1VIFA 2L2PA 1AZGB 4PFOA 2RN8A 3V7SA 3SB2A 1EFNA 1WJQA 4J9CA 2DE0X 2EQIA 1X69A 2H3JA 2K9GA 4BY6C 4BDYA 4OMQA 3RMQA 4OMNA 3CCLQ 2GFUA 2D6FA 4AFZC 4HFFA 1IHWA 1WHJA 3EG9B 3F70A 3CEYA 3QDRB 5GAOn 2W10A 3E9GA 4FGEA 1SSFA 1ZQ1A 3A5ZB 1GRIA 1R0CB 2MCNA 4BI3A 4QQ6A 5CR2A 7AT1B 1SHFA 3VRYA 1RUWA 4ME7A 4KGVB 1NJIU 4AFSC 2XI9A 4VUBA 3RKYA 5GAN2 4L59A 3TCJA 3OS1A 4F7UA 3QJ6A 1JJ2S 3M58A 1QMCA 3CC2T 1UECA 1T0JA 2L3QA 4BB7A 3FRNA 1K73C 4HCKA 4RG2A 2LCSA 2RB6A 3UATA 1X27A 1WJSA 2KGTA 1VA7A 3CCMQ 5IN1A 3ZEHA 1YJNT 1AT1B 1NE8A 2H3EB 1HK9A 3CCUQ 1Q86C 1XOVA 2RNAA 1QKXA 4F17A 1YIJT 1R77A 1KC8R 1ZBJA 2KDSA 2Y4XA 4PJOA 1ZLMA 4HVVA 3I56A 2VPMA 1BYMA 1WDXA 1K8AC 3PNWC 3M57A 1D09B 1OPKA 4KH0B 4RTYA 3NHNA 1O9SA 2A7YA 3LH0A 1SF9A 4JRKA 3C94A 2ZPHB 1VQOA 1D0XA 3ZL7C 2HL5C 2JW4A 3VV0A 2LC4A 1N8RU 1FMVA 2DXUA 4M78E 2QEXQ 1X75C 2DF6A 2PQWA 3I9QA 2JTMA 2CP7A 2HQEA 1AVZC 1IZ6A 2CS7A 1UGQB 3M59A 3P8DA 2DX1A 2XDBA 4C0DB 1RL2A 4FT4A 1SKUB 1BIBA 2ABLA 2IO8A 4C5EA 1Y96B 3CC2Q 3M4YA 3U23A 2EYWA 3H0IA 2MOXA 4LXCA 5FWCA 4BUGA 2XDDA 1VQNA 4A4KA 1BI1A 3X24B 3JAME 1WA7A 5J39A 4HCCA 3PVQA 3GT2A 2E6NA 1B3QA 5D6XA 1ZUUA 3QJYA 4MDWA 1VQLA 4QW2A 4M7DA 2YHTA 4IKFA 2LP5A 4FM4B 2EYYA 1X43A 4F14A 1GFCA 4J6XA 2NUTB 2C0OA 3VYHB 1T3LA 5CCAA 1M3CA 1U1TA 3CBOA 2X9HA 4C8QF 1OYXA 2M9UA 3RIRA 3UA7A 2EGCA 1VYTA 1QVFS 3HSBA 1G83A 1Q82U 4QVCA 1W4SA 2QDYB 3L1AA 1N9RA 4M75A 1SRMA 3UWNA 2QTXA 1RAEB 1AD5A 3EHRA 2EYQA 1VQKT 3A30A 1M2OA 3HPWA 3EG1A 3NTHA 2VB6A 1M1KC 4BE2A 2ROLA 3GP8A 4J9FA 4PLLA 3QPHA 5AYFA 3TREA 2WACA 4BDZA 2FVUA 3CC4A 1ZA1B 3OA6A 2DEQA 4X9DA 4HT8A 4J5YA 2QI2A 3PTAA 4IUQA 3EGDB 3HTRA 3CCVQ 3JB9G 2AKKA 3CPWS 9ATCB 1N27A 2HSPA 5FW9A 2LX7A 1NG2A 4OB0B 1NPPA 4J6YA 4HFKA 4HVUA 2P0KA 1YJWT 1OU9A 4EMHA 5GMKh 1VQ4A 3VJPA 2DKGA 1NZ9A 2RF0A 2GF7A 2XMFA 3SFMA 4NL2A 1QW1A 2DRMA 3LWIA 4R56A 1YFNA 3LWHA 1M90U 2J06A 4ZGDB 5GAMd 2LQNA 5GAN5 1YCSB 2RK1A 1K1ZA 1MMAA 1I5LA 5LJ5h 1VQKQ 2ECZA 3MEVA 3CMEQ 5GAOr 2LNVA 2ATCB 2BKDN 3CD6T 4EPCA 2LRJA 1BIAA 2NLUA 1MHNA 3OYYA 2G6FX 2D1XA 1OI1A 2FPFA 2RHIA 2ZAEA 3VS4A 4MZTA 4EMGA 1S72T 1VQ5A 4M75E 3JV3A 5HY6A 3NGPA 1WHLA 1Q81C 5A2QE 3GOXA 1YHQA 3PIPA 2IG0A 3OMGA 1FWZA 5FWBA 2EIFA 3R6NA 1Z9QA 2RHZA 5C6SA 5GANg 1AHJB 2E4HA 4JZ3A 4A4GA 3LX7A 3MP8A 4XTZA 4M78C 2ZGWA 3JCMb 1YJWQ 1SEMA 3M1UA 1D1BA 2ZPFB 3QBYA 2YXYA 3H9NA 4LN2A 3CXCA 5GAMf 5IXFA 3OYJA 2LQWA 2QA4T 4RCCA 3OS5A 4OLKA 2X35A 3TSZA 4AG2C 3OYGA 4HT9A 3WVEB 3RKWA 1ZSZB 4C92C 1MGQA 4M7DG 1TUDA 1IREB 2IOBA 1W2BA 2JS0A 1FYNA 2GNCA 2KR3A 1KIKA 3OB9A 3CCRA 2QDLA 3PMIA 4XU2A 1YJ9T 3QZ9B 3QHSA 3URGA 1K0SA 3FEOA 1NEBA 1V1CA 5KYYA 5DLOA 4RUGA 3I55A 2L8DA 1G3TA 2K1GA 2HQHA 2DL7A 4PJOD 2F5KA 1WJRA 4M75G 4A54A 2O2OA 2EYXA 2EWNA 2D8HA 3CCEQ 2LJ3A 3MPUB 1OX8A 2CREA 3TQ7P 3VYGA 5FRMA 5LJ3f 1RAAB 3M0UA 2A08A 3EG9A 5CAIA 3HFNA 4LDYA 3OBWA 4BACA 2COYA 1HJDA 4CC4B 1TXQA 2K79A 1YBYA 3CC7T 4RMOA 3QO3A 1N6AA 4PL6A 2VKNA 1M30A 4JJBA 2DERA 4F7UF 2SEMA 3CCJT 1F1BB 2KXDA 5GAN4 2QQSA 4M75B 3J7AF 4CGKA 1BU1A 2D9TA 4XTWA 1J3TA 3Q1JA 1Q95G 2QAZA 1Q7YR 3GIBA 3VU3C 4FSSA 1E7OA 4EQ8A 2VYTA 3OYAA 4C0FA 2LNHB 5GAN8 1OX9A 3S3NA 1YJ9Q 2MMPA 4C5HA 2KVQG 1M3AA 1ZSZC 1WX6A 2J05A 4D8DA 1PD0A 1YP5A 1BKBA 4XK8E 4PJOF 4M77C 4M7DD 4FT2A 5LJ5d 1MMGA 3JB9J 1HD3A 3A8MB 3CCQT 1MUZA 5IHNA 2DL5A 5HCKA 4WCIA 1I07A 2K3YA 1ZSGA 4ZN3A 1Y57A 3FC3A 3OYFA 5IH2A 2YUQA 1PNJA 2O01E 4IURA 1IGQA 4E7JA 1ACMB 2ZCFB 5GAMe 2CSIA 3CPFA 1NLOC 4E7LA 3JSCA 1RAFB 2K57A 4AT1B 2FZCB 2CT3A 1WXUA 4M75D 2RA2A 3CCJQ 3JCMW 3CXCP 4BE0A 4B6MA 1H641 2HBWA 2Y90A 1Y96A 3JCMV 5DY9A 1U8RA 2CP6A 4FYWB 1VQPT 1JQQA 4EIKA 2YUPA 4E7ZA 2R58A 4DBQA 3O98A 1YITT 1QVGP 2DL3A 1UJ0A 1K73U 2QTVA 3HRTA 3E2UA 1W2BP 5GMKj 3G71T 2JUFA 1C0MA 2A0FB 2ZPEB 3EH1A 1Q86U 2XG8D 2QASA 2XU8A 4M7DF 1AEYA 5GAOq 2VPSA 3LGLA 2C06A 4J6WA 2EGAA 2NUTA 4FSXA 1K8AU 1IHVA 3VS3A 3CCLT 1ABQA 5LJ3e 1YI2A 2JZ2A 2JVVA 2RMOA 1KHIA 1KJWA 2O4XB 4PKCC 4XTVA 2CZ1B 4IIMA 1X6OA 5GMKl 3RUXA 2H8HA 2CUDA 1JJ2A 4M75F 1VQ9A 3M56A 2Z0WA 3HKSA 3MP6A 2OX7A 2K5IA 2E12A 3QYGB 3E9FA 2F2WA 2DA9A 2CYZB 2R5MA 1KQSS 3EFSA 2K3AA 3DLMA 1NLPC 3V7RA 4E7IA 3G4SA 1LJOA 1UFFA 2JOYA 2G3RA 1YWOA 2VV5A 1GBRA 3SEMA 2DL4A 3I35A 4RTVA 3VS1A 4M78A 4QVZA 1D3BA 1AOJA 1SHGA 5KYYB 1P92A 3RBBB 3S6WA 3CCSA 2K5LA 1QCNA 2X3XD 4MZPA 2M0YA 1KC8C 2DTOA 2XDPA 2FRYA 2QQ9A 3OSVA 2MPXC 2QQAA 3V8JA 2NUZA 2RI2A 3G1JA 1KG1A 1PD1A 3S3OA 4C92A 3BY7A 2QEXT 3CCMA 2CKKA 2K3BA 2M02A 3CCUA 4A4HA 3QYHB 3H0HA 3JB9I 4J83A 3VS2A 2HL3A 1OQKA 1X2QA 4LE9A 1W1FA 2L3PA 2CZ0B 3VKIA 2KRSA 4ORZA 3TEEA 5GANj 4R0KA 1R8OB 4FQAA 1RI0A 1PSEA 1Y07A 3GNGA 1I8FA 1BB9A 4JPBW 2LZ6B 3UDCA 4HCZA 1JXMA 3GNFB 2A3LA 2LQ8A 1M1KU 2OTLQ 1TS9A 2LCLA 2PVGB 1WIEA 4OB3B 2E41A 1UTIA 2O9VA 2DRKA 1Y7XA 4ATOA 2IVWA 4N4IA 2YUOA 1XTDA
chains in the Genus database with same CATH topology
3GBQA 4DEYA 2EKHA 3PBCA 2RQTA 3KFVA 3QWYA 2AKKA 5I22A 3C0CA 2HSPA 1K9AA 1UGVA 2DBKA 1H3HA 5FW9A 1ZX6A 4LUDA 2LX7A 3I5RA 1NG2A 1LCKA 2V1QA 4LJ1A 2YT6A 2OJ2A 3REBB 4HVUA 1ZUYA 4F0VA 3VPJA 2A36A 1S1NA 2DILA 4AG1C 2IO9A 4JJDA 3VS0A 4K11A 2FEIA 1NEGA 2CDTA 1FMKA 1OOTA 3NPFA 4ESRA 1QKWA 2M51A 4RTWA 3H0FA 2IIMA 2RF0A 2XMFA 2CUBA 2VWFA 2DRMA 3THKA 1CKAA 1T0HA 2J06A 2D0NA 2LJ1A 1QCFA 2LQNA 5IHIA 1NM7A 2YUNA 1YCSB 4RTZA 2OI3A 1VYVA 1K1ZA 2P4RA 2OAWA 2ECZA 2DYBA 1K4US 3KW0A 4JZ4A 2L0AA 2LRJA 4EQAA 1Z9ZA 1UG1A 1AZEA 1G2BA 2G6FX 2K2MA 2XIVA 1WFWA 2D1XA 2JT4A 1BBZA 1X2KA 2RQVA 2FPFA 1K76A 1U5SA 2F2VA 3VS4A 5GJWB 2GQIA 3M0QA 1PKTA 3CQTA 2KXCA 4QT7A 4FQBA 3JV3A 4KRTA 5IHKA 2KYBA 3M0PA 3NGPA 4D8KA 3M0TA 2PTKA 2VOBA 5FWBA 1PKSA 3R6NA 2IOAA 1Z9QA 2L3SA 1B07A 3EG3A 4X1VA 4JZ3A 1ABOA 4Q4NA 1H8KA 1BK2A 2SRCA 1ZUKA 3I86A 2RQRA 1SEMA 1U3OA 3M1UA 2AKLA 2BZYA 4LUEA 1HSQA 2AK5A 4LN2A 3PE0A 1RI9A 1UJYA 1M8MA 5IXFA 2GTJA 5GJVB 1WLPB 2LQWA 3VRZA 2CSQA 3EHQA 4EOBA 1VYUA 2KRNA 4OLKA 2KT8A 1QWFA 2KRMA 1W70A 3TSZA 4AG2C 2J6KA 2FO0A 4LNPA 3VS7A 1PWTA 2HCKA 1TUDA 1WYXA 2IOBA 2JS0A 4A63B 1FYNA 2DBMA 2GNCA 2YSQA 2KEAA 1UHFA 5L23A 2KR3A 1KIKA 1KFZA 2YDLA 1I0CA 2JMAA 1K0XA 1I1JA 2QDLA 3A98A 2JS2A 4OMPA 2AZVA 3M0SA 1WI7A 1K0SA 4FGDA 1NEBA 2KROA 1V1CA 3TVTA 1GL5A 4RUGA 2IF6A 4FDYA 2K1GA 1RLPC 2DL7A 2I0NA 3PBIA 1JO8A 5IXBA 2F2XA 4HPEA 3S0QA 2O2OA 2EYXA 2D8HA 3H41A 1AWWA 2LJ3A 2CREA 3UF4A 4HZ9A 3M0UA 2A08A 4HVWA 1OV3A 1M27C 4CC7A 4Q4GX 1HJDA 1Y0MA 4CC4B 1UUEA 3SHWA 1CSKA 1AWOA 2K79A 1RLQC 4M4ZA 2VVKA 4GLMA 1W6XA 2FG0A 2VKNA 3A2YA 1M30A 4JJBA 2SEMA 2KXDA 4CGKA 1BU1A 1E6HA 1J3TA 4OMMA 4Z8AA 2JMCA 4EQ8A 4FSSA 1E7OA 2DNUA 2NWMA 4J9EA 4JJCA 4E6RA 2LNHB 5EC7A 2K6DA 3VPIA 1TG0A 3QWXX 1X6BA 2J7IA 3EGUA 2J6FA 1M3AA 4J9HA 1X6GA 1WX6A 2J05A 2PNIA 4D8DA 4OMLA 4CC3A 1YP5A 1JEGA 1WXTA 2GGRA 1WXBA 2K7AA 3M0RA 2V1RA 2GTOA 2KE9A 2DJQA 4CT3A 1YN8A 2DM1A 1OPLA 2DVJA 1HD3A 2L2PA 1AZGB 4J9DA 1MUZA 2RN8A 2DL5A 5IHNA 2CT4A 2HDAA 4WCIA 5HCKA 1EFNA 1I07A 4J9CA 2DE0X 2EQIA 1X69A 1ZSGA 2K9GA 2ROTA 1Y57A 4JXBA 4OMQA 4OMNA 1TUCA 4AFZC 5IH2A 2YUQA 1PNJA 1GCQA 3REAB 1U06A 2W10A 3VS6A 2CSIA 4FGEA 2RPNA 1NLOC 1GRIA 2EYZA 4GBQA 2MCNA 3LH5A 4RTTA 1SHFA 3VRYA 1RUWA 2CT3A 1WXUA 2DLPA 4IIOA 4AFSC 2HBWA 4J9GA 1NYFA 3TSWA 2BTTA 1GBQA 4HZBA 1JQQA 4EIKA 2YUPA 2EW3A 1SSHA 1JXOA 4Y92A 3O5ZA 4F0WA 1PHTA 1PRLC 3O98A 1UECA 1T0JA 2L3QA 2LMJA 2DL3A 1UJ0A 4HCKA 2RQUA 2JM9A 2LCSA 2X3WD 1ARKA 3UATA 1X27A 2KGTA 3NMZC 1VA7A 4CSHA 1XOVA 2ED1A 2RNAA 2W0ZA 1QKXA 4F17A 1PRMC 2MIOA 1AEYA 1UHCA 1JU5C 2VPSA 1ZBJA 1ZLMA 2EBPA 4HVVA 2EGAA 2VPMA 4FGIA 1WDXA 2J6OA 2ENMA 1T3SA 3VS3A 1OPKA 1ABQA 1YNZA 4RTYA 3NHNA 4CC2A 1GCPA 2A37A 2BZ8A 2KBTA 2RMOA 2CH4W 3EG0A 5I11A 1KJWA 4AFUC 2O9SA 2JW4A 3ZL7C 1CKBA 2BZXA 2C0IA 4Z89A 4IIMA 4J9IA 2IO7A 2DF6A 2H8HA 3I9QA 2CUDA 3VS5A 2O88A 1MV0B 1NYGA 2CH4A 1AVZC 2A28A 2JM8A 2DL8A 1SRLA 1QLYA 1UDLA 3EG2A 2DX1A 2HEQA 2F2WA 2DA9A 1YWPA 1QWEA 2K3AA 1NLPC 2ABLA 3UA6A 2JXBA 4F16A 2O31A 2IO8A 1UFFA 3U23A 3A2ZA 2FRWA 2D8JA 2EYWA 1YWOA 3H0IA 2MOXA 4HXJA 3FJ5A 3SEMA 2DL4A 2KT1A 2KYMA 2RQWA 1GBRA 5FWCA 3IQLA 3RNJA 3I35A 4RTVA 3VS1A 4DEXA 1WA7A 1MV3A 4F4MA 1AOJA 2B86A 1AWJA 2FPEA 1UE9A 1SHGA 2DMOA 3PVQA 3GT2A 1IO6A 3RBBB 1B3QA 3ULRB 1ZUUA 2X3XD 2M0YA 2E5KA 1H92A 2PZ1A 2ESWA 2FPDA 1OEBA 2FRYA 2LP5A 1M3BA 2NUZA 2EYYA 1X43A 4F14A 1GFCA 3I5SA 3NE0A 2C0OA 1T3LA 2GBQA 1M3CA 2JTEA 2K3BA 2ED0A 4OMOA 3H0HA 2EVRA 1E6GA 3UA7A 3VS2A 4Q4TA 1AWXA 1X2QA 4LE9A 4RTUA 2EGCA 1W1FA 1VYTA 1KSWA 2L3PA 2KRSA 4ORZA 1G83A 4R0KA 1N5ZA 4FQAA 1SRMA 1GFDA 1BB9A 2EGEA 4JPBW 1AD5A 2LZ6B 1A0NB 3EHRA 1SPKA 4RTXA 1JXMA 3A30A 3EG1A 4AFQC 4Z88A 1GCQC 5ECAA 2LJ0A 2AZSA 2ROLA 3PVLA 2EPDA 4J9FA 1WIEA 2KNBB 2C0TA 4J9BA 1UTIA 2O9VA 2DRKA 4ZNXA 2YUOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GBQ A;  4DEY A;  2EKH A;  3PBC A;  2RQT A;  3KFV A;  3QWY A;  2AKK A;  5I22 A;  3C0C A;  2HSP A;  1K9A A;  1UGV A;  2DBK A;  1H3H A;  5FW9 A;  1ZX6 A;  4LUD A;  2LX7 A;  3I5R A;  1NG2 A;  1LCK A;  2V1Q A;  4LJ1 A;  2YT6 A;  2OJ2 A;  3REB B;  4HVU A;  1ZUY A;  4F0V A;  3VPJ A;  2A36 A;  1S1N A;  2DIL A;  4AG1 C;  2IO9 A;  4JJD A;  3VS0 A;  4K11 A;  2FEI A;  1NEG A;  2CDT A;  1FMK A;  1OOT A;  3NPF A;  4ESR A;  1QKW A;  2M51 A;  4RTW A;  3H0F A;  2IIM A;  2RF0 A;  2XMF A;  2CUB A;  2VWF A;  2DRM A;  3THK A;  1CKA A;  1T0H A;  2J06 A;  2D0N A;  2LJ1 A;  1QCF A;  2LQN A;  5IHI A;  1NM7 A;  2YUN A;  1YCS B;  4RTZ A;  2OI3 A;  1VYV A;  1K1Z A;  2P4R A;  2OAW A;  2ECZ A;  2DYB A;  1K4U S;  3KW0 A;  4JZ4 A;  2L0A A;  2LRJ A;  4EQA A;  1Z9Z A;  1UG1 A;  1AZE A;  1G2B A;  2G6F X;  2K2M A;  2XIV A;  1WFW A;  2D1X A;  2JT4 A;  1BBZ A;  1X2K A;  2RQV A;  2FPF A;  1K76 A;  1U5S A;  2F2V A;  3VS4 A;  5GJW B;  2GQI A;  3M0Q A;  1PKT A;  3CQT A;  2KXC A;  4QT7 A;  4FQB A;  3JV3 A;  4KRT A;  5IHK A;  2KYB A;  3M0P A;  3NGP A;  4D8K A;  3M0T A;  2PTK A;  2VOB A;  5FWB A;  1PKS A;  3R6N A;  2IOA A;  1Z9Q A;  2L3S A;  1B07 A;  3EG3 A;  4X1V A;  4JZ3 A;  1ABO A;  4Q4N A;  1H8K A;  1BK2 A;  2SRC A;  1ZUK A;  3I86 A;  2RQR A;  1SEM A;  1U3O A;  3M1U A;  2AKL A;  2BZY A;  4LUE A;  1HSQ A;  2AK5 A;  4LN2 A;  3PE0 A;  1RI9 A;  1UJY A;  1M8M A;  5IXF A;  2GTJ A;  5GJV B;  1WLP B;  2LQW A;  3VRZ A;  2CSQ A;  3EHQ A;  4EOB A;  1VYU A;  2KRN A;  4OLK A;  2KT8 A;  1QWF A;  2KRM A;  1W70 A;  3TSZ A;  4AG2 C;  2J6K A;  2FO0 A;  4LNP A;  3VS7 A;  1PWT A;  2HCK A;  1TUD A;  1WYX A;  2IOB A;  2JS0 A;  4A63 B;  1FYN A;  2DBM A;  2GNC A;  2YSQ A;  2KEA A;  1UHF A;  5L23 A;  2KR3 A;  1KIK A;  1KFZ A;  2YDL A;  1I0C A;  2JMA A;  1K0X A;  1I1J A;  2QDL A;  3A98 A;  2JS2 A;  4OMP A;  2AZV A;  3M0S A;  1WI7 A;  1K0S A;  4FGD A;  1NEB A;  2KRO A;  1V1C A;  3TVT A;  1GL5 A;  4RUG A;  2IF6 A;  4FDY A;  2K1G A;  1RLP C;  2DL7 A;  2I0N A;  3PBI A;  1JO8 A;  5IXB A;  2F2X A;  4HPE A;  3S0Q A;  2O2O A;  2EYX A;  2D8H A;  3H41 A;  1AWW A;  2LJ3 A;  2CRE A;  3UF4 A;  4HZ9 A;  3M0U A;  2A08 A;  4HVW A;  1OV3 A;  1M27 C;  4CC7 A;  4Q4G X;  1HJD A;  1Y0M A;  4CC4 B;  1UUE A;  3SHW A;  1CSK A;  1AWO A;  2K79 A;  1RLQ C;  4M4Z A;  2VVK A;  4GLM A;  1W6X A;  2FG0 A;  2VKN A;  3A2Y A;  1M30 A;  4JJB A;  2SEM A;  2KXD A;  4CGK A;  1BU1 A;  1E6H A;  1J3T A;  4OMM A;  4Z8A A;  2JMC A;  4EQ8 A;  4FSS A;  1E7O A;  2DNU A;  2NWM A;  4J9E A;  4JJC A;  4E6R A;  2LNH B;  5EC7 A;  2K6D A;  3VPI A;  1TG0 A;  3QWX X;  1X6B A;  2J7I A;  3EGU A;  2J6F A;  1M3A A;  4J9H A;  1X6G A;  1WX6 A;  2J05 A;  2PNI A;  4D8D A;  4OML A;  4CC3 A;  1YP5 A;  1JEG A;  1WXT A;  2GGR A;  1WXB A;  2K7A A;  3M0R A;  2V1R A;  2GTO A;  2KE9 A;  2DJQ A;  4CT3 A;  1YN8 A;  2DM1 A;  1OPL A;  2DVJ A;  1HD3 A;  2L2P A;  1AZG B;  4J9D A;  1MUZ A;  2RN8 A;  2DL5 A;  5IHN A;  2CT4 A;  2HDA A;  4WCI A;  5HCK A;  1EFN A;  1I07 A;  4J9C A;  2DE0 X;  2EQI A;  1X69 A;  1ZSG A;  2K9G A;  2ROT A;  1Y57 A;  4JXB A;  4OMQ A;  4OMN A;  1TUC A;  4AFZ C;  5IH2 A;  2YUQ A;  1PNJ A;  1GCQ A;  3REA B;  1U06 A;  2W10 A;  3VS6 A;  2CSI A;  4FGE A;  2RPN A;  1NLO C;  1GRI A;  2EYZ A;  4GBQ A;  2MCN A;  3LH5 A;  4RTT A;  1SHF A;  3VRY A;  1RUW A;  2CT3 A;  1WXU A;  2DLP A;  4IIO A;  4AFS C;  2HBW A;  4J9G A;  1NYF A;  3TSW A;  2BTT A;  1GBQ A;  4HZB A;  1JQQ A;  4EIK A;  2YUP A;  2EW3 A;  1SSH A;  1JXO A;  4Y92 A;  3O5Z A;  4F0W A;  1PHT A;  1PRL C;  3O98 A;  1UEC A;  1T0J A;  2L3Q A;  2LMJ A;  2DL3 A;  1UJ0 A;  4HCK A;  2RQU A;  2JM9 A;  2LCS A;  2X3W D;  1ARK A;  3UAT A;  1X27 A;  2KGT A;  3NMZ C;  1VA7 A;  4CSH A;  1XOV A;  2ED1 A;  2RNA A;  2W0Z A;  1QKX A;  4F17 A;  1PRM C;  2MIO A;  1AEY A;  1UHC A;  1JU5 C;  2VPS A;  1ZBJ A;  1ZLM A;  2EBP A;  4HVV A;  2EGA A;  2VPM A;  4FGI A;  1WDX A;  2J6O A;  2ENM A;  1T3S A;  3VS3 A;  1OPK A;  1ABQ A;  1YNZ A;  4RTY A;  3NHN A;  4CC2 A;  1GCP A;  2A37 A;  2BZ8 A;  2KBT A;  2RMO A;  2CH4 W;  3EG0 A;  5I11 A;  1KJW A;  4AFU C;  2O9S A;  2JW4 A;  3ZL7 C;  1CKB A;  2BZX A;  2C0I A;  4Z89 A;  4IIM A;  4J9I A;  2IO7 A;  2DF6 A;  2H8H A;  3I9Q A;  2CUD A;  3VS5 A;  2O88 A;  1MV0 B;  1NYG A;  2CH4 A;  1AVZ C;  2A28 A;  2JM8 A;  2DL8 A;  1SRL A;  1QLY A;  1UDL A;  3EG2 A;  2DX1 A;  2HEQ A;  2F2W A;  2DA9 A;  1YWP A;  1QWE A;  2K3A A;  1NLP C;  2ABL A;  3UA6 A;  2JXB A;  4F16 A;  2O31 A;  2IO8 A;  1UFF A;  3U23 A;  3A2Z A;  2FRW A;  2D8J A;  2EYW A;  1YWO A;  3H0I A;  2MOX A;  4HXJ A;  3FJ5 A;  3SEM A;  2DL4 A;  2KT1 A;  2KYM A;  2RQW A;  1GBR A;  5FWC A;  3IQL A;  3RNJ A;  3I35 A;  4RTV A;  3VS1 A;  4DEX A;  1WA7 A;  1MV3 A;  4F4M A;  1AOJ A;  2B86 A;  1AWJ A;  2FPE A;  1UE9 A;  1SHG A;  2DMO A;  3PVQ A;  3GT2 A;  1IO6 A;  3RBB B;  1B3Q A;  3ULR B;  1ZUU A;  2X3X D;  2M0Y A;  2E5K A;  1H92 A;  2PZ1 A;  2ESW A;  2FPD A;  1OEB A;  2FRY A;  2LP5 A;  1M3B A;  2NUZ A;  2EYY A;  1X43 A;  4F14 A;  1GFC A;  3I5S A;  3NE0 A;  2C0O A;  1T3L A;  2GBQ A;  1M3C A;  2JTE A;  2K3B A;  2ED0 A;  4OMO A;  3H0H A;  2EVR A;  1E6G A;  3UA7 A;  3VS2 A;  4Q4T A;  1AWX A;  1X2Q A;  4LE9 A;  4RTU A;  2EGC A;  1W1F A;  1VYT A;  1KSW A;  2L3P A;  2KRS A;  4ORZ A;  1G83 A;  4R0K A;  1N5Z A;  4FQA A;  1SRM A;  1GFD A;  1BB9 A;  2EGE A;  4JPB W;  1AD5 A;  2LZ6 B;  1A0N B;  3EHR A;  1SPK A;  4RTX A;  1JXM A;  3A30 A;  3EG1 A;  4AFQ C;  4Z88 A;  1GCQ C;  5ECA A;  2LJ0 A;  2AZS A;  2ROL A;  3PVL A;  2EPD A;  4J9F A;  1WIE A;  2KNB B;  2C0T A;  4J9B A;  1UTI A;  2O9V A;  2DRK A;  4ZNX A;  2YUO A; 
#chains in the Genus database with same CATH topology
 3GBQ A;  2RQT A;  1VQO T;  5A0G A;  1SG5 A;  3QWY A;  2AHJ B;  3CC2 A;  2XKO C;  4ANJ A;  4ZGJ B;  3RR6 A;  5CVI A;  2GFA A;  2YRV A;  1M1G A;  2BE9 B;  1VQ7 A;  4AG1 C;  1YJN A;  3VS0 A;  4K11 A;  2YLC A;  1NEG A;  1FMK A;  1OOT A;  4JRP A;  1YIJ A;  2EFI A;  2M51 A;  3BDU A;  2VWF A;  2F1L A;  3JCM Q;  2DO3 A;  2HKQ B;  1KD1 C;  3EGX A;  3THK A;  3QSU A;  1ZSZ A;  2RH2 A;  2D0N A;  3CBM A;  1KHC A;  2YRD A;  5IHI A;  2YUN A;  1XNI A;  2NUP A;  5FLX E;  4C92 E;  1JJ2 P;  4OB1 B;  2P4T A;  4JZ4 A;  1BI2 A;  1R0B G;  1Z9Z A;  3JCM f;  1B34 B;  1UG1 A;  1VQL T;  1G2B A;  2K2M A;  2JT4 A;  5HK0 A;  1BBZ A;  4HKE A;  3QDF A;  1K76 A;  3V8L A;  3L2Q A;  1ZHI A;  2QQB A;  1IRX A;  3A8G B;  4C8Q C;  1PKT A;  3CQT A;  2KXC A;  5GMK m;  1VQ8 T;  3JB9 H;  3CCV T;  2KYB A;  1VQO Q;  1NBE B;  1Q81 U;  1WNL A;  4ZGE B;  2PTK A;  1FX7 A;  3MEW A;  2MWP A;  2BIV A;  3G7Z A;  1M2V B;  4II1 A;  3DKM A;  1ABO A;  1M8V A;  2SRC A;  1ZUK A;  3M4G A;  5CQY A;  2L5Q A;  4FCY A;  4CRI A;  4ZTJ A;  1KD1 R;  1G3W A;  3QZ5 B;  4M78 G;  3KBG A;  3L2V A;  1TOV A;  2CSQ A;  1TH7 A;  4DBH A;  2E65 A;  2LX9 A;  2DEU A;  2ZPB B;  2KRN A;  1QWF A;  1W70 A;  2FB7 A;  3CME T;  3CC4 T;  4LNP A;  3EFO A;  1VQN Q;  2HCK A;  1WPY A;  4A63 B;  2DBM A;  1OUL A;  2KEA A;  4EMK B;  1UHF A;  4C92 G;  2JN0 A;  1VQL Q;  3QXE B;  1Q7Y U;  2JS2 A;  2AIR B;  3M0S A;  3MP1 A;  3OYM A;  2EQK A;  4M78 B;  1D3B B;  2KSS A;  1VQ8 Q;  4B9W A;  2IF6 A;  2RJC A;  4J7F A;  3OYB A;  3SD4 A;  1RLP C;  4GLK A;  4M77 E;  2F69 A;  4J8O A;  1V29 B;  3S0Q A;  1VQM A;  2HNI A;  2K3X A;  1AWW A;  2LCC A;  3MKD A;  4HZ9 A;  2PVD B;  4C92 B;  4KUI A;  3QUI A;  2FZG B;  2KY9 A;  5A0L A;  2CP2 A;  4Q4G X;  2V8K A;  5CK9 A;  1UGR B;  3SHW A;  3BE3 A;  3AHU A;  4GY5 A;  3RMS A;  4DBR A;  2P0P A;  1VQ6 T;  1RLQ C;  4M4Z A;  3AT1 B;  1HXD A;  1PM3 A;  2VVK A;  1QVF P;  2VXE A;  1W6X A;  2HQX A;  1WHH A;  3A2Y A;  1NJI R;  2GCX A;  2XD0 A;  3SWN C;  3CC4 Q;  2M16 A;  4JRQ A;  1H3Z A;  2MF2 A;  4OMM A;  4L5G A;  4DOW A;  1TUG B;  2JMC A;  2NWM A;  3DLL A;  2EJ9 A;  4BD3 A;  4E6R A;  3JCM e;  2L3R A;  4Q5W A;  1TG0 A;  2QGF B;  4M78 D;  2J7I A;  3NFC A;  3OY9 A;  2J6F A;  2RHY A;  4J9H A;  1X6G A;  4JUR A;  2L89 A;  5FRO A;  3GLX A;  4PFZ A;  3HL8 A;  2GGR A;  4EMK C;  2P0Q A;  4RKU E;  2JTF A;  4KUL A;  2KE9 A;  1VQ4 Q;  2DJQ A;  2DM1 A;  2VC8 A;  3CCE T;  1M5Q 1;  2MI6 A;  3CD6 A;  2B8A A;  4A4E A;  2DD5 A;  3ZFJ A;  3CMA T;  2FYK A;  4M77 G;  2HDA A;  4C92 D;  4M7A E;  2O4X A;  2CP0 A;  2EAY A;  4JXB A;  4ZN1 A;  1TUC A;  1VUB A;  1S72 A;  3REA B;  2E3I A;  4IUV A;  1U06 A;  5CKB A;  3E1S A;  2BE7 D;  3JB9 D;  1VQ6 Q;  1LOJ A;  3N5B B;  1QVG A;  3H6Z A;  3LH5 A;  3M55 A;  3EGX B;  1X01 A;  4D6W A;  2RHU A;  1D1C A;  3P8B B;  4J9G A;  5CKF A;  1NYF A;  3TSW A;  3WVD B;  3G6E T;  2NUP B;  1GBQ A;  4HZB A;  4M77 B;  3LLR A;  1SSH A;  1JXO A;  4Y28 E;  4Y92 A;  3O5Z A;  4F0W A;  4LDU A;  1PHT A;  1Q7Y C;  1PRL C;  1Y71 A;  3UT1 A;  1YHQ Q;  2LMJ A;  2M1H A;  4M78 F;  2X3W D;  2QA4 A;  5GAN h;  2DAQ A;  4RG8 A;  3NMZ C;  1UEB A;  3EAE A;  1KK7 A;  4CSH A;  1EIF A;  1VOM A;  4HA8 A;  4IUP A;  2W0Z A;  2COZ A;  1PRM C;  2MIO A;  4O5V A;  2DZC A;  1UHC A;  3ASK A;  4KT0 E;  1JU5 C;  2EBP A;  5M9O A;  4C92 F;  3CMA Q;  4E2F B;  2J6O A;  4DA4 A;  1T3S A;  2R57 A;  4CC2 A;  2KBT A;  2JNG A;  2WSF E;  4AFU C;  4QQG A;  1CKB A;  2BZX A;  3JB9 F;  1QQJ A;  2QGG A;  2MAM A;  1JB0 E;  4HFL A;  4J9I A;  2IO7 A;  5D7U A;  3OYC A;  4OVA A;  2O88 A;  1MV0 B;  3NTI A;  2K5F A;  2CH4 A;  2JM8 A;  2WSC E;  1Q82 R;  4C8Q A;  1SRL A;  1UDL A;  2QXF A;  3JRZ A;  3EFO B;  4M77 D;  4PNO A;  3G6E Q;  3A8O B;  1JRI A;  1YWP A;  1QWE A;  4PJM A;  1VIE A;  3UA6 A;  2JXB A;  3OYI A;  2O31 A;  1YCY A;  3I55 Q;  4BE1 A;  4LDV A;  1C1A A;  5LJ3 j;  5C0M A;  4L6V 5;  1UB4 A;  2FRW A;  2D8J A;  4J30 A;  4HXJ A;  2RQW A;  2KYM A;  4KH1 B;  3OYK A;  1NPR A;  4HCB A;  2RI5 A;  3IQL A;  3JCM X;  3QG1 A;  3CC7 A;  3INZ A;  2EKO A;  1GXI E;  3EBQ A;  4F4M A;  1AWJ A;  1BI0 A;  5KYU A;  2WSE E;  3OMC A;  4OGC A;  2RD1 A;  3X20 B;  2QQR A;  1WZO A;  3ULR B;  1D0Y A;  3QKJ A;  2PZ1 A;  1KC8 U;  3RKX A;  2ESW A;  2FPD A;  2V8I A;  3GF5 A;  2RK2 A;  1M3B A;  4PJJ A;  3A8L B;  4C5G A;  3OYD A;  3I5S A;  3NE0 A;  3VUZ A;  1WHK A;  3MEA A;  4LDX A;  3OS0 A;  2VXF A;  2EVR A;  1E6G A;  3CBP A;  2EJG A;  4XQ3 A;  4RTU A;  4JDS A;  1KSW A;  1TSF A;  2DIG A;  2OTJ A;  1KQS A;  1XJW B;  1IXD A;  1M90 R;  3CCQ A;  4P5N A;  1GFD A;  1G3Y A;  2ZPI B;  2EGE A;  4TVR A;  4JRI A;  1SPK A;  4FL6 A;  1B34 A;  4AFQ C;  1QP3 A;  1GCQ C;  5ECA A;  2FHD A;  2LJ0 A;  2XHC A;  2AZS A;  1G3S A;  3PVL A;  4E7S A;  2KNB B;  3OW2 S;  4YTL A;  5LJ5 f;  5KYX A;  5CKH A;  3L42 A;  4C8Q E;  1YI2 T;  3X26 B;  2QG9 B;  2OAU A;  2E6Z A;  1WHG A;  5J3B A;  1VQP A;  5D6W A;  3MEU A;  1M2V A;  3MHX A;  3PGG A;  1I4K 1;  1YIT A;  4N4H A;  4Z02 A;  3C0C A;  4M7A C;  3MET A;  2DBK A;  3SWN A;  1ZX6 A;  1LCK A;  2YT6 A;  2OJ2 A;  3REB B;  1OZ3 A;  3D7S B;  1ZUY A;  3G71 A;  2VGM A;  5GAN d;  2DIL A;  8AT1 B;  2KI7 A;  2IO9 A;  4JJD A;  2X4X A;  3NPF A;  1QKW A;  4RTW A;  2E70 A;  3H0F A;  4AMC A;  5L8R E;  2CUB A;  2LRQ A;  4JLG A;  4BI8 B;  2E5Q A;  1KD1 U;  2LT4 A;  2RHX A;  1BCO A;  1QCF A;  3BW1 A;  3CCL A;  4O6J A;  4RTZ A;  4EMK A;  2HKN A;  2X51 A;  2OI3 A;  2X4W A;  2OTL T;  2OAW A;  4JS4 A;  1PG5 B;  4DBF A;  5FU7 C;  3CCS T;  3RDV A;  3KW0 A;  4QQD A;  3FIF A;  4EQA A;  4IUT A;  3M53 A;  1UGS B;  1EZZ B;  1AZE A;  2XIV A;  2XID A;  3OYH A;  2EQJ A;  3RER A;  4LD6 A;  4JLI A;  3HHT B;  3FJP A;  2GQI A;  3LYI A;  1YI2 Q;  1K9M R;  4FQB A;  5IHK A;  3M0P A;  1HYO A;  3PFS A;  3M0T A;  3OQ5 A;  2CGH A;  4C8Q G;  4QKU A;  3FLG A;  2VOB A;  3E19 A;  1OU8 A;  2LQK A;  2L3S A;  2RI3 A;  3EG3 A;  1VQ9 Q;  4X1V A;  2RJF A;  1H8K A;  2F5T X;  3I86 A;  5A0D A;  1U3O A;  2R5A A;  2BZY A;  4LUE A;  3PE0 A;  1RI9 A;  2X4J A;  3J80 E;  2GTJ A;  1WLP B;  3G4S Q;  5GAM g;  3VRZ A;  4EOB A;  1VYU A;  1TU0 B;  5GMK e;  1QP2 A;  2KT8 A;  4C8Q B;  4LD9 K;  4F04 B;  2J6K A;  4ELY C;  2HD0 A;  1LNX A;  3VS7 A;  3L2U A;  1PWT A;  2PUO B;  1KQS P;  3J81 E;  2QEX A;  2QK0 A;  3CCS Q;  1UGP B;  5L23 A;  4X34 A;  1KFZ A;  2YDL A;  3I56 T;  2M0O A;  1I0C A;  2JMA A;  2K4Y A;  1I1J A;  5LJ5 e;  4OMP A;  2AZV A;  3V7C A;  1RAI B;  2IPO B;  4FGD A;  1RAC B;  5KYU B;  3TVT A;  2E10 A;  1VQ7 T;  3HRU A;  1JO8 A;  2D0Q B;  2F2X A;  5FU6 C;  1FXX A;  4HPE A;  3OYL A;  3NTK A;  5KCH A;  3OYN A;  2BUD A;  2E1H A;  3UF4 A;  1QVF A;  5GAM h;  2EQM A;  5LJ3 g;  2DVE A;  1M27 C;  2LVM A;  2DK3 A;  2VGN A;  1UUE A;  3SDZ A;  5KYN A;  1CSK A;  4OGE A;  3LGF A;  5KE2 A;  2RM4 A;  3R6O A;  4C8Q D;  1VQN T;  2HMA A;  1ZA2 B;  4M77 A;  2KAF A;  1MND A;  4FW1 A;  1PSF A;  1E6H A;  3C4S A;  4Z8A A;  5CQX A;  1M1F A;  1BI3 A;  4J9E A;  1MMN A;  4JJC A;  3I56 Q;  2YRC A;  5I21 A;  1K73 R;  4N0A C;  4OMF B;  3VPI A;  4MMK A;  3LW5 E;  5KYW B;  1X6B A;  5KYX B;  3CPW A;  3EGU A;  2FL7 A;  1Q86 R;  4CC3 A;  1JEG A;  3VUB A;  1VQ7 Q;  2V1R A;  2GTO A;  2RJE A;  1YJN Q;  4CT3 A;  5LJ3 h;  1YN8 A;  1I5O B;  1OPL A;  2DVJ A;  1YIJ Q;  4F7U E;  5CKE A;  5GAN e;  1K8A R;  4J9D A;  4KUD K;  2CT4 A;  3SWN B;  1LVK A;  2ROT A;  2PUK B;  2DXC A;  3PT9 A;  4QVD A;  2CZ7 B;  2VAS A;  1GCQ A;  1VQ8 A;  3CCV A;  1MMD A;  2DJZ A;  4V2S A;  3VS6 A;  4E7K A;  4Y91 A;  4XTX A;  2RPN A;  3KXT A;  4GBQ A;  2EYZ A;  2ZZD A;  4RTT A;  1RAB B;  4PJN A;  1NJI C;  2DLP A;  4IIO A;  5GAN 3;  2ZPG B;  2BTT A;  3C95 A;  4PJO E;  2QYZ A;  3MJX A;  1XQH A;  3ME9 A;  5CKD A;  3L2Z A;  2EW3 A;  4KGX B;  4M7A A;  2CP5 A;  2RQU A;  2JM9 A;  4XU0 A;  2RO0 A;  1ARK A;  1VQM T;  4XU3 A;  3DB3 A;  2Y4Y A;  4A53 A;  1RAG B;  3FB9 A;  4JJN K;  5I2M A;  1VQ4 T;  1VQK A;  3CME A;  5LJ5 g;  1OZ2 A;  2ED1 A;  1U1S A;  4C0D C;  4PK4 A;  3JCM P;  3PIO A;  2DZ9 A;  1BCM A;  4LDW A;  3BFM A;  3EH2 A;  4FGI A;  2ENM A;  3HP9 A;  3BDL A;  2XK0 A;  1YNZ A;  4UC4 A;  1G5V A;  2KQW A;  4F7U G;  1GCP A;  2A37 A;  2BZ8 A;  4PFP A;  2CH4 W;  5GAO p;  3EG0 A;  5I11 A;  3JCM d;  2O9S A;  4OF1 A;  2COW A;  2V26 A;  5DM7 R;  1N8R C;  2C0I A;  2VUB A;  4Z89 A;  5IT9 E;  2JJ9 A;  3T9N A;  3VS5 A;  1NYG A;  2A28 A;  2DL8 A;  3H8Z A;  5J26 A;  3QII A;  1VQ5 T;  1QLY A;  3EG2 A;  5CIU A;  1YJW A;  4NOY A;  4NL3 A;  4M7D E;  2HEQ A;  3DB4 A;  3KUF A;  1YHQ T;  3M9Q A;  4F16 A;  1M1K R;  4F7U B;  1MNE A;  4PJO G;  2NYS A;  3A2Z A;  2WP7 A;  3FJ5 A;  2KT1 A;  1VQ6 A;  1VQM Q;  3RNJ A;  2I2L A;  2EQU A;  4DEX A;  3O8V A;  1MV3 A;  1RAD B;  2B86 A;  2FPE A;  1UE9 A;  3HFO A;  2DMO A;  1IO6 A;  6AT1 B;  4C0G A;  4PJL A;  2RJD A;  5HKC A;  3CPW P;  5KCO A;  1H92 A;  2E5K A;  4B9X A;  2LTO A;  2PVO B;  4XAX B;  1OEB A;  4FYY B;  2DXB A;  3ZBD A;  2DET A;  4NS5 A;  1IGU A;  4PJO B;  1LPL A;  1N8R R;  2MYS A;  2GBQ A;  2MWO A;  2JTE A;  2DYI A;  8ATC B;  1PCX A;  3PMT A;  2ED0 A;  3CCR T;  4OMO A;  4DQ2 A;  4Q4T A;  1AWX A;  4XU1 A;  2E64 A;  3CCE A;  1FMW A;  5LJ3 d;  1N5Z A;  3CMA A;  1Q82 C;  1VQ5 Q;  1N9S A;  3I55 T;  2P84 A;  1A0N B;  4RTX A;  3OYE A;  4JUV A;  2DD4 A;  4FU6 A;  4Z88 A;  5GAM j;  3HRS A;  1G8X A;  2EPD A;  3CD6 Q;  2C0T A;  4J9B A;  4ZNX A;  3M54 A;  4XTY A;  2DIQ A;  2DPP B;  4DEY A;  2EKH A;  3PBC A;  1Q81 R;  3G6E A;  2HBP A;  3KFV A;  1S72 Q;  4ELZ C;  4IUU A;  1K9M U;  3ER0 A;  1PC0 A;  1YJ9 A;  5I22 A;  3S3M A;  1K9A A;  3V8K A;  5AT1 B;  1UGV A;  1H3H A;  4LUD A;  3I5R A;  4MML A;  4LJ1 A;  4M7D B;  2V1Q A;  1TWB A;  1KQ1 A;  2HZY A;  4WTO B;  4M7A G;  4F0V A;  3VPJ A;  4J7I A;  3L2W A;  2A36 A;  1S1N A;  3CCR Q;  2FEI A;  2CDT A;  4N0A A;  1KQ2 A;  4ESR A;  2IIM A;  4FYV B;  2CP3 A;  5GMK i;  5GAO l;  4E7H A;  4PJO C;  4ZTF A;  1CKA A;  3MCA B;  2LDM A;  1T0H A;  3CXC S;  1M90 C;  2LJ1 A;  3WXM B;  2QA4 Q;  4JS5 A;  1NM7 A;  1VYV A;  2P4R A;  1TTH B;  5KH6 A;  4R55 A;  2YLB A;  3OW2 A;  2DYB A;  1K4U S;  1QVG S;  3A8H B;  4M7A B;  2L0A A;  2V8J A;  3FDR A;  3JCM g;  1WFW A;  1W2B S;  1M9S A;  1IB8 A;  3CCJ A;  1X2K A;  2KK4 A;  4PLI A;  2RQV A;  5HK3 A;  4N4G A;  4C0Z A;  4J32 A;  2DTH A;  1U5S A;  2F2V A;  4C5I A;  5GJW B;  2PU9 B;  3M0Q A;  4QT7 A;  5EG2 A;  3P8H A;  4KRT A;  4D8K A;  5DLQ E;  1DJ7 B;  1PKS A;  4EDU A;  2IOA A;  2MK5 A;  1WQ7 A;  4KGZ B;  2OTJ T;  1B07 A;  1JBM A;  5GAN 7;  3OBY A;  3OSS C;  4Q4N A;  1BK2 A;  5LL6 S;  2AT1 B;  5I2S A;  5KE3 A;  2RQR A;  4BI4 A;  5FU7 B;  2AKL A;  4E47 A;  1I81 A;  1HSQ A;  2AK5 A;  1UJY A;  1WQW A;  1M8M A;  3JCM J;  5GJV B;  1M4Z A;  4M77 F;  3EHQ A;  2E3H A;  2EJF A;  4M7D C;  2KRM A;  1D0Z A;  4MZM A;  3RES A;  2DXT A;  3CC7 Q;  2FO0 A;  3JCM h;  2XIC A;  3JCM c;  4WF2 A;  3C12 A;  1WYX A;  4A4F A;  1C6V X;  4M7A D;  2YSQ A;  1QCO A;  4OP0 A;  5KYW A;  3MO8 A;  1K0X A;  3A98 A;  1QVP A;  1RAH B;  1WI7 A;  2KRO A;  2KMT A;  1GL5 A;  4M75 C;  1K9M C;  2LT1 A;  4BY6 B;  2DFU A;  5D6Y A;  4FDY A;  4FW2 A;  3X25 B;  3EFR A;  2I0N A;  3X28 B;  3PBI A;  5IXB A;  1VQ9 T;  3TU4 K;  2GQV A;  3H41 A;  2OTJ Q;  2X4Y A;  4FIB A;  5IAY A;  3CCQ Q;  4DOV A;  4HVW A;  1OV3 A;  4CC7 A;  5FRN A;  5LJ5 j;  3G4S T;  1WGS A;  1EX4 A;  1Y0M A;  5GAN 6;  1AWO A;  4CI0 C;  2FZK B;  4GLM A;  5CO7 A;  2FG0 A;  1B7T A;  2YWW A;  4KBM B;  4FYX B;  4M7A F;  2K2V A;  2DNU A;  5FU6 B;  2DTI A;  1VQP Q;  3GPL A;  1D1A A;  2HSE B;  5EC7 A;  4OB2 B;  2K6D A;  4RCB A;  3QWX X;  2CZ6 B;  1YIT Q;  3OW2 P;  3A1P A;  3M5A A;  3OS2 A;  3UPU A;  1WHM A;  3CCM T;  1ZBX A;  3L2R A;  2PNI A;  4OML A;  3CCU T;  1WXT A;  4X9C A;  3G71 Q;  1WXB A;  5GAO m;  4MDX A;  2K7A A;  3M0R A;  1O75 A;  4XTU A;  3EGD A;  2OTL A;  5GAN f;  2HAX A;  1V76 A;  1VIF A;  2L2P A;  1AZG B;  4PFO A;  2RN8 A;  3V7S A;  3SB2 A;  1EFN A;  1WJQ A;  4J9C A;  2DE0 X;  2EQI A;  1X69 A;  2H3J A;  2K9G A;  4BY6 C;  4BDY A;  4OMQ A;  3RMQ A;  4OMN A;  3CCL Q;  2GFU A;  2D6F A;  4AFZ C;  4HFF A;  1IHW A;  1WHJ A;  3EG9 B;  3F70 A;  3CEY A;  3QDR B;  5GAO n;  2W10 A;  3E9G A;  4FGE A;  1SSF A;  1ZQ1 A;  3A5Z B;  1GRI A;  1R0C B;  2MCN A;  4BI3 A;  4QQ6 A;  5CR2 A;  7AT1 B;  1SHF A;  3VRY A;  1RUW A;  4ME7 A;  4KGV B;  1NJI U;  4AFS C;  2XI9 A;  4VUB A;  3RKY A;  5GAN 2;  4L59 A;  3TCJ A;  3OS1 A;  4F7U A;  3QJ6 A;  1JJ2 S;  3M58 A;  1QMC A;  3CC2 T;  1UEC A;  1T0J A;  2L3Q A;  4BB7 A;  3FRN A;  1K73 C;  4HCK A;  4RG2 A;  2LCS A;  2RB6 A;  3UAT A;  1X27 A;  1WJS A;  2KGT A;  1VA7 A;  3CCM Q;  5IN1 A;  3ZEH A;  1YJN T;  1AT1 B;  1NE8 A;  2H3E B;  1HK9 A;  3CCU Q;  1Q86 C;  1XOV A;  2RNA A;  1QKX A;  4F17 A;  1YIJ T;  1R77 A;  1KC8 R;  1ZBJ A;  2KDS A;  2Y4X A;  4PJO A;  1ZLM A;  4HVV A;  3I56 A;  2VPM A;  1BYM A;  1WDX A;  1K8A C;  3PNW C;  3M57 A;  1D09 B;  1OPK A;  4KH0 B;  4RTY A;  3NHN A;  1O9S A;  2A7Y A;  3LH0 A;  1SF9 A;  4JRK A;  3C94 A;  2ZPH B;  1VQO A;  1D0X A;  3ZL7 C;  2HL5 C;  2JW4 A;  3VV0 A;  2LC4 A;  1N8R U;  1FMV A;  2DXU A;  4M78 E;  2QEX Q;  1X75 C;  2DF6 A;  2PQW A;  3I9Q A;  2JTM A;  2CP7 A;  2HQE A;  1AVZ C;  1IZ6 A;  2CS7 A;  1UGQ B;  3M59 A;  3P8D A;  2DX1 A;  2XDB A;  4C0D B;  1RL2 A;  4FT4 A;  1SKU B;  1BIB A;  2ABL A;  2IO8 A;  4C5E A;  1Y96 B;  3CC2 Q;  3M4Y A;  3U23 A;  2EYW A;  3H0I A;  2MOX A;  4LXC A;  5FWC A;  4BUG A;  2XDD A;  1VQN A;  4A4K A;  1BI1 A;  3X24 B;  3JAM E;  1WA7 A;  5J39 A;  4HCC A;  3PVQ A;  3GT2 A;  2E6N A;  1B3Q A;  5D6X A;  1ZUU A;  3QJY A;  4MDW A;  1VQL A;  4QW2 A;  4M7D A;  2YHT A;  4IKF A;  2LP5 A;  4FM4 B;  2EYY A;  1X43 A;  4F14 A;  1GFC A;  4J6X A;  2NUT B;  2C0O A;  3VYH B;  1T3L A;  5CCA A;  1M3C A;  1U1T A;  3CBO A;  2X9H A;  4C8Q F;  1OYX A;  2M9U A;  3RIR A;  3UA7 A;  2EGC A;  1VYT A;  1QVF S;  3HSB A;  1G83 A;  1Q82 U;  4QVC A;  1W4S A;  2QDY B;  3L1A A;  1N9R A;  4M75 A;  1SRM A;  3UWN A;  2QTX A;  1RAE B;  1AD5 A;  3EHR A;  2EYQ A;  1VQK T;  3A30 A;  1M2O A;  3HPW A;  3EG1 A;  3NTH A;  2VB6 A;  1M1K C;  4BE2 A;  2ROL A;  3GP8 A;  4J9F A;  4PLL A;  3QPH A;  5AYF A;  3TRE A;  2WAC A;  4BDZ A;  2FVU A;  3CC4 A;  1ZA1 B;  3OA6 A;  2DEQ A;  4X9D A;  4HT8 A;  4J5Y A;  2QI2 A;  3PTA A;  4IUQ A;  3EGD B;  3HTR A;  3CCV Q;  3JB9 G;  2AKK A;  3CPW S;  9ATC B;  1N27 A;  2HSP A;  5FW9 A;  2LX7 A;  1NG2 A;  4OB0 B;  1NPP A;  4J6Y A;  4HFK A;  4HVU A;  2P0K A;  1YJW T;  1OU9 A;  4EMH A;  5GMK h;  1VQ4 A;  3VJP A;  2DKG A;  1NZ9 A;  2RF0 A;  2GF7 A;  2XMF A;  3SFM A;  4NL2 A;  1QW1 A;  2DRM A;  3LWI A;  4R56 A;  1YFN A;  3LWH A;  1M90 U;  2J06 A;  4ZGD B;  5GAM d;  2LQN A;  5GAN 5;  1YCS B;  2RK1 A;  1K1Z A;  1MMA A;  1I5L A;  5LJ5 h;  1VQK Q;  2ECZ A;  3MEV A;  3CME Q;  5GAO r;  2LNV A;  2ATC B;  2BKD N;  3CD6 T;  4EPC A;  2LRJ A;  1BIA A;  2NLU A;  1MHN A;  3OYY A;  2G6F X;  2D1X A;  1OI1 A;  2FPF A;  2RHI A;  2ZAE A;  3VS4 A;  4MZT A;  4EMG A;  1S72 T;  1VQ5 A;  4M75 E;  3JV3 A;  5HY6 A;  3NGP A;  1WHL A;  1Q81 C;  5A2Q E;  3GOX A;  1YHQ A;  3PIP A;  2IG0 A;  3OMG A;  1FWZ A;  5FWB A;  2EIF A;  3R6N A;  1Z9Q A;  2RHZ A;  5C6S A;  5GAN g;  1AHJ B;  2E4H A;  4JZ3 A;  4A4G A;  3LX7 A;  3MP8 A;  4XTZ A;  4M78 C;  2ZGW A;  3JCM b;  1YJW Q;  1SEM A;  3M1U A;  1D1B A;  2ZPF B;  3QBY A;  2YXY A;  3H9N A;  4LN2 A;  3CXC A;  5GAM f;  5IXF A;  3OYJ A;  2LQW A;  2QA4 T;  4RCC A;  3OS5 A;  4OLK A;  2X35 A;  3TSZ A;  4AG2 C;  3OYG A;  4HT9 A;  3WVE B;  3RKW A;  1ZSZ B;  4C92 C;  1MGQ A;  4M7D G;  1TUD A;  1IRE B;  2IOB A;  1W2B A;  2JS0 A;  1FYN A;  2GNC A;  2KR3 A;  1KIK A;  3OB9 A;  3CCR A;  2QDL A;  3PMI A;  4XU2 A;  1YJ9 T;  3QZ9 B;  3QHS A;  3URG A;  1K0S A;  3FEO A;  1NEB A;  1V1C A;  5KYY A;  5DLO A;  4RUG A;  3I55 A;  2L8D A;  1G3T A;  2K1G A;  2HQH A;  2DL7 A;  4PJO D;  2F5K A;  1WJR A;  4M75 G;  4A54 A;  2O2O A;  2EYX A;  2EWN A;  2D8H A;  3CCE Q;  2LJ3 A;  3MPU B;  1OX8 A;  2CRE A;  3TQ7 P;  3VYG A;  5FRM A;  5LJ3 f;  1RAA B;  3M0U A;  2A08 A;  3EG9 A;  5CAI A;  3HFN A;  4LDY A;  3OBW A;  4BAC A;  2COY A;  1HJD A;  4CC4 B;  1TXQ A;  2K79 A;  1YBY A;  3CC7 T;  4RMO A;  3QO3 A;  1N6A A;  4PL6 A;  2VKN A;  1M30 A;  4JJB A;  2DER A;  4F7U F;  2SEM A;  3CCJ T;  1F1B B;  2KXD A;  5GAN 4;  2QQS A;  4M75 B;  3J7A F;  4CGK A;  1BU1 A;  2D9T A;  4XTW A;  1J3T A;  3Q1J A;  1Q95 G;  2QAZ A;  1Q7Y R;  3GIB A;  3VU3 C;  4FSS A;  1E7O A;  4EQ8 A;  2VYT A;  3OYA A;  4C0F A;  2LNH B;  5GAN 8;  1OX9 A;  3S3N A;  1YJ9 Q;  2MMP A;  4C5H A;  2KVQ G;  1M3A A;  1ZSZ C;  1WX6 A;  2J05 A;  4D8D A;  1PD0 A;  1YP5 A;  1BKB A;  4XK8 E;  4PJO F;  4M77 C;  4M7D D;  4FT2 A;  5LJ5 d;  1MMG A;  3JB9 J;  1HD3 A;  3A8M B;  3CCQ T;  1MUZ A;  5IHN A;  2DL5 A;  5HCK A;  4WCI A;  1I07 A;  2K3Y A;  1ZSG A;  4ZN3 A;  1Y57 A;  3FC3 A;  3OYF A;  5IH2 A;  2YUQ A;  1PNJ A;  2O01 E;  4IUR A;  1IGQ A;  4E7J A;  1ACM B;  2ZCF B;  5GAM e;  2CSI A;  3CPF A;  1NLO C;  4E7L A;  3JSC A;  1RAF B;  2K57 A;  4AT1 B;  2FZC B;  2CT3 A;  1WXU A;  4M75 D;  2RA2 A;  3CCJ Q;  3JCM W;  3CXC P;  4BE0 A;  4B6M A;  1H64 1;  2HBW A;  2Y90 A;  1Y96 A;  3JCM V;  5DY9 A;  1U8R A;  2CP6 A;  4FYW B;  1VQP T;  1JQQ A;  4EIK A;  2YUP A;  4E7Z A;  2R58 A;  4DBQ A;  3O98 A;  1YIT T;  1QVG P;  2DL3 A;  1UJ0 A;  1K73 U;  2QTV A;  3HRT A;  3E2U A;  1W2B P;  5GMK j;  3G71 T;  2JUF A;  1C0M A;  2A0F B;  2ZPE B;  3EH1 A;  1Q86 U;  2XG8 D;  2QAS A;  2XU8 A;  4M7D F;  1AEY A;  5GAO q;  2VPS A;  3LGL A;  2C06 A;  4J6W A;  2EGA A;  2NUT A;  4FSX A;  1K8A U;  1IHV A;  3VS3 A;  3CCL T;  1ABQ A;  5LJ3 e;  1YI2 A;  2JZ2 A;  2JVV A;  2RMO A;  1KHI A;  1KJW A;  2O4X B;  4PKC C;  4XTV A;  2CZ1 B;  4IIM A;  1X6O A;  5GMK l;  3RUX A;  2H8H A;  2CUD A;  1JJ2 A;  4M75 F;  1VQ9 A;  3M56 A;  2Z0W A;  3HKS A;  3MP6 A;  2OX7 A;  2K5I A;  2E12 A;  3QYG B;  3E9F A;  2F2W A;  2DA9 A;  2CYZ B;  2R5M A;  1KQS S;  3EFS A;  2K3A A;  3DLM A;  1NLP C;  3V7R A;  4E7I A;  3G4S A;  1LJO A;  1UFF A;  2JOY A;  2G3R A;  1YWO A;  2VV5 A;  1GBR A;  3SEM A;  2DL4 A;  3I35 A;  4RTV A;  3VS1 A;  4M78 A;  4QVZ A;  1D3B A;  1AOJ A;  1SHG A;  5KYY B;  1P92 A;  3RBB B;  3S6W A;  3CCS A;  2K5L A;  1QCN A;  2X3X D;  4MZP A;  2M0Y A;  1KC8 C;  2DTO A;  2XDP A;  2FRY A;  2QQ9 A;  3OSV A;  2MPX C;  2QQA A;  3V8J A;  2NUZ A;  2RI2 A;  3G1J A;  1KG1 A;  1PD1 A;  3S3O A;  4C92 A;  3BY7 A;  2QEX T;  3CCM A;  2CKK A;  2K3B A;  2M02 A;  3CCU A;  4A4H A;  3QYH B;  3H0H A;  3JB9 I;  4J83 A;  3VS2 A;  2HL3 A;  1OQK A;  1X2Q A;  4LE9 A;  1W1F A;  2L3P A;  2CZ0 B;  3VKI A;  2KRS A;  4ORZ A;  3TEE A;  5GAN j;  4R0K A;  1R8O B;  4FQA A;  1RI0 A;  1PSE A;  1Y07 A;  3GNG A;  1I8F A;  1BB9 A;  4JPB W;  2LZ6 B;  3UDC A;  4HCZ A;  1JXM A;  3GNF B;  2A3L A;  2LQ8 A;  1M1K U;  2OTL Q;  1TS9 A;  2LCL A;  2PVG B;  1WIE A;  4OB3 B;  2E41 A;  1UTI A;  2O9V A;  2DRK A;  1Y7X A;  4ATO A;  2IVW A;  4N4I A;  2YUO A;  1XTD A; 
#chains in the Genus database with same CATH homology
 3GBQ A;  4DEY A;  2EKH A;  3PBC A;  2RQT A;  3KFV A;  3QWY A;  2AKK A;  5I22 A;  3C0C A;  2HSP A;  1K9A A;  1UGV A;  2DBK A;  1H3H A;  5FW9 A;  1ZX6 A;  4LUD A;  2LX7 A;  3I5R A;  1NG2 A;  1LCK A;  2V1Q A;  4LJ1 A;  2YT6 A;  2OJ2 A;  3REB B;  4HVU A;  1ZUY A;  4F0V A;  3VPJ A;  2A36 A;  1S1N A;  2DIL A;  4AG1 C;  2IO9 A;  4JJD A;  3VS0 A;  4K11 A;  2FEI A;  1NEG A;  2CDT A;  1FMK A;  1OOT A;  3NPF A;  4ESR A;  1QKW A;  2M51 A;  4RTW A;  3H0F A;  2IIM A;  2RF0 A;  2XMF A;  2CUB A;  2VWF A;  2DRM A;  3THK A;  1CKA A;  1T0H A;  2J06 A;  2D0N A;  2LJ1 A;  1QCF A;  2LQN A;  5IHI A;  1NM7 A;  2YUN A;  1YCS B;  4RTZ A;  2OI3 A;  1VYV A;  1K1Z A;  2P4R A;  2OAW A;  2ECZ A;  2DYB A;  1K4U S;  3KW0 A;  4JZ4 A;  2L0A A;  2LRJ A;  4EQA A;  1Z9Z A;  1UG1 A;  1AZE A;  1G2B A;  2G6F X;  2K2M A;  2XIV A;  1WFW A;  2D1X A;  2JT4 A;  1BBZ A;  1X2K A;  2RQV A;  2FPF A;  1K76 A;  1U5S A;  2F2V A;  3VS4 A;  5GJW B;  2GQI A;  3M0Q A;  1PKT A;  3CQT A;  2KXC A;  4QT7 A;  4FQB A;  3JV3 A;  4KRT A;  5IHK A;  2KYB A;  3M0P A;  3NGP A;  4D8K A;  3M0T A;  2PTK A;  2VOB A;  5FWB A;  1PKS A;  3R6N A;  2IOA A;  1Z9Q A;  2L3S A;  1B07 A;  3EG3 A;  4X1V A;  4JZ3 A;  1ABO A;  4Q4N A;  1H8K A;  1BK2 A;  2SRC A;  1ZUK A;  3I86 A;  2RQR A;  1SEM A;  1U3O A;  3M1U A;  2AKL A;  2BZY A;  4LUE A;  1HSQ A;  2AK5 A;  4LN2 A;  3PE0 A;  1RI9 A;  1UJY A;  1M8M A;  5IXF A;  2GTJ A;  5GJV B;  1WLP B;  2LQW A;  3VRZ A;  2CSQ A;  3EHQ A;  4EOB A;  1VYU A;  2KRN A;  4OLK A;  2KT8 A;  1QWF A;  2KRM A;  1W70 A;  3TSZ A;  4AG2 C;  2J6K A;  2FO0 A;  4LNP A;  3VS7 A;  1PWT A;  2HCK A;  1TUD A;  1WYX A;  2IOB A;  2JS0 A;  4A63 B;  1FYN A;  2DBM A;  2GNC A;  2YSQ A;  2KEA A;  1UHF A;  5L23 A;  2KR3 A;  1KIK A;  1KFZ A;  2YDL A;  1I0C A;  2JMA A;  1K0X A;  1I1J A;  2QDL A;  3A98 A;  2JS2 A;  4OMP A;  2AZV A;  3M0S A;  1WI7 A;  1K0S A;  4FGD A;  1NEB A;  2KRO A;  1V1C A;  3TVT A;  1GL5 A;  4RUG A;  2IF6 A;  4FDY A;  2K1G A;  1RLP C;  2DL7 A;  2I0N A;  3PBI A;  1JO8 A;  5IXB A;  2F2X A;  4HPE A;  3S0Q A;  2O2O A;  2EYX A;  2D8H A;  3H41 A;  1AWW A;  2LJ3 A;  2CRE A;  3UF4 A;  4HZ9 A;  3M0U A;  2A08 A;  4HVW A;  1OV3 A;  1M27 C;  4CC7 A;  4Q4G X;  1HJD A;  1Y0M A;  4CC4 B;  1UUE A;  3SHW A;  1CSK A;  1AWO A;  2K79 A;  1RLQ C;  4M4Z A;  2VVK A;  4GLM A;  1W6X A;  2FG0 A;  2VKN A;  3A2Y A;  1M30 A;  4JJB A;  2SEM A;  2KXD A;  4CGK A;  1BU1 A;  1E6H A;  1J3T A;  4OMM A;  4Z8A A;  2JMC A;  4EQ8 A;  4FSS A;  1E7O A;  2DNU A;  2NWM A;  4J9E A;  4JJC A;  4E6R A;  2LNH B;  5EC7 A;  2K6D A;  3VPI A;  1TG0 A;  3QWX X;  1X6B A;  2J7I A;  3EGU A;  2J6F A;  1M3A A;  4J9H A;  1X6G A;  1WX6 A;  2J05 A;  2PNI A;  4D8D A;  4OML A;  4CC3 A;  1YP5 A;  1JEG A;  1WXT A;  2GGR A;  1WXB A;  2K7A A;  3M0R A;  2V1R A;  2GTO A;  2KE9 A;  2DJQ A;  4CT3 A;  1YN8 A;  2DM1 A;  1OPL A;  2DVJ A;  1HD3 A;  2L2P A;  1AZG B;  4J9D A;  1MUZ A;  2RN8 A;  2DL5 A;  5IHN A;  2CT4 A;  2HDA A;  4WCI A;  5HCK A;  1EFN A;  1I07 A;  4J9C A;  2DE0 X;  2EQI A;  1X69 A;  1ZSG A;  2K9G A;  2ROT A;  1Y57 A;  4JXB A;  4OMQ A;  4OMN A;  1TUC A;  4AFZ C;  5IH2 A;  2YUQ A;  1PNJ A;  1GCQ A;  3REA B;  1U06 A;  2W10 A;  3VS6 A;  2CSI A;  4FGE A;  2RPN A;  1NLO C;  1GRI A;  2EYZ A;  4GBQ A;  2MCN A;  3LH5 A;  4RTT A;  1SHF A;  3VRY A;  1RUW A;  2CT3 A;  1WXU A;  2DLP A;  4IIO A;  4AFS C;  2HBW A;  4J9G A;  1NYF A;  3TSW A;  2BTT A;  1GBQ A;  4HZB A;  1JQQ A;  4EIK A;  2YUP A;  2EW3 A;  1SSH A;  1JXO A;  4Y92 A;  3O5Z A;  4F0W A;  1PHT A;  1PRL C;  3O98 A;  1UEC A;  1T0J A;  2L3Q A;  2LMJ A;  2DL3 A;  1UJ0 A;  4HCK A;  2RQU A;  2JM9 A;  2LCS A;  2X3W D;  1ARK A;  3UAT A;  1X27 A;  2KGT A;  3NMZ C;  1VA7 A;  4CSH A;  1XOV A;  2ED1 A;  2RNA A;  2W0Z A;  1QKX A;  4F17 A;  1PRM C;  2MIO A;  1AEY A;  1UHC A;  1JU5 C;  2VPS A;  1ZBJ A;  1ZLM A;  2EBP A;  4HVV A;  2EGA A;  2VPM A;  4FGI A;  1WDX A;  2J6O A;  2ENM A;  1T3S A;  3VS3 A;  1OPK A;  1ABQ A;  1YNZ A;  4RTY A;  3NHN A;  4CC2 A;  1GCP A;  2A37 A;  2BZ8 A;  2KBT A;  2RMO A;  2CH4 W;  3EG0 A;  5I11 A;  1KJW A;  4AFU C;  2O9S A;  2JW4 A;  3ZL7 C;  1CKB A;  2BZX A;  2C0I A;  4Z89 A;  4IIM A;  4J9I A;  2IO7 A;  2DF6 A;  2H8H A;  3I9Q A;  2CUD A;  3VS5 A;  2O88 A;  1MV0 B;  1NYG A;  2CH4 A;  1AVZ C;  2A28 A;  2JM8 A;  2DL8 A;  1SRL A;  1QLY A;  1UDL A;  3EG2 A;  2DX1 A;  2HEQ A;  2F2W A;  2DA9 A;  1YWP A;  1QWE A;  2K3A A;  1NLP C;  2ABL A;  3UA6 A;  2JXB A;  4F16 A;  2O31 A;  2IO8 A;  1UFF A;  3U23 A;  3A2Z A;  2FRW A;  2D8J A;  2EYW A;  1YWO A;  3H0I A;  2MOX A;  4HXJ A;  3FJ5 A;  3SEM A;  2DL4 A;  2KT1 A;  2KYM A;  2RQW A;  1GBR A;  5FWC A;  3IQL A;  3RNJ A;  3I35 A;  4RTV A;  3VS1 A;  4DEX A;  1WA7 A;  1MV3 A;  4F4M A;  1AOJ A;  2B86 A;  1AWJ A;  2FPE A;  1UE9 A;  1SHG A;  2DMO A;  3PVQ A;  3GT2 A;  1IO6 A;  3RBB B;  1B3Q A;  3ULR B;  1ZUU A;  2X3X D;  2M0Y A;  2E5K A;  1H92 A;  2PZ1 A;  2ESW A;  2FPD A;  1OEB A;  2FRY A;  2LP5 A;  1M3B A;  2NUZ A;  2EYY A;  1X43 A;  4F14 A;  1GFC A;  3I5S A;  3NE0 A;  2C0O A;  1T3L A;  2GBQ A;  1M3C A;  2JTE A;  2K3B A;  2ED0 A;  4OMO A;  3H0H A;  2EVR A;  1E6G A;  3UA7 A;  3VS2 A;  4Q4T A;  1AWX A;  1X2Q A;  4LE9 A;  4RTU A;  2EGC A;  1W1F A;  1VYT A;  1KSW A;  2L3P A;  2KRS A;  4ORZ A;  1G83 A;  4R0K A;  1N5Z A;  4FQA A;  1SRM A;  1GFD A;  1BB9 A;  2EGE A;  4JPB W;  1AD5 A;  2LZ6 B;  1A0N B;  3EHR A;  1SPK A;  4RTX A;  1JXM A;  3A30 A;  3EG1 A;  4AFQ C;  4Z88 A;  1GCQ C;  5ECA A;  2LJ0 A;  2AZS A;  2ROL A;  3PVL A;  2EPD A;  4J9F A;  1WIE A;  2KNB B;  2C0T A;  4J9B A;  1UTI A;  2O9V A;  2DRK A;  4ZNX A;  2YUO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...