4R0KA

Crystal structure of a putative dipeptidyl-peptidase vi (bt_1314) from bacteroides thetaiotaomicron vpi-5482 at 1.75 a resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
303
structure length
301
Chain Sequence
PMPADSAYGVVHISVCNMRDEGKFTSGMSTQALLGMPVKVLQYTGWYEIQTPDDYTGWVHRMVITPMSKEKYDEWNRAEKIVVTSHYGFTYEKPDDDSQTVSDVVAGNRLKWEGSKGHFYKVSYPDGRQAYISRHISQPESKWRASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDSGLVRTVLFMHDIIIPRDASQQAYVGERIEIAPDFSNVQRGDLVFFGRKATADRKEGISHVGIYLGNKRFIHALGDVHISSFDPEDEYDEFNTGRLLFATRFLPYINKEKGMNTTDHNLYYLHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a putative dipeptidyl-peptidase VI (BT_1314) from Bacteroides thetaiotaomicron VPI-5482 at 1.75 A resolution
rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Hydrolase
molecule keywords Dipeptidyl-peptidase VI
total genus 84
structure length 301
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA01
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 4r0kA02
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 4r0kA03
2K2MA 4JZ4A 1XOVA 1GRIA 2J7IA 2EVRA 3M1UA 2JS0A 4Q4TA 4FSSA 1NLPC 1WI7A 2DBKA 4J9DA 5IH2A 3UA6A 3M0QA 5GJWB 1AZEA 1GCQC 3IQLA 1B3QA 1J3TA 4RTUA 1RI9A 3I86A 5IHIA 2ROTA 1WLPB 2RQRA 4EOBA 1UGVA 3H0IA 2LQNA 2YDLA 1QWEA 2AKLA 1ZLMA 1UECA 4AFZC 1H92A 2YUOA 1WXTA 2AKKA 1TUDA 2A28A 2F2VA 4RTVA 1ZSGA 1HSQA 2DL3A 4JJCA 2CREA 4JJBA 2BZ8A 1OV3A 1BK2A 3I5SA 1SHGA 1OPKA 4F4MA 1RUWA 3ZL7C 2DX1A 2IO7A 1UHCA 3SEMA 1PRMC 3M0UA 1SRMA 3CQTA 4J9FA 4FDYA 2LX7A 1G2BA 2PTKA 1GFCA 2YUPA 1WYXA 3TVTA 1KIKA 2J6FA 3C0CA 2O31A 3REAB 5I22A 1QKWA 1YN8A 2JW4A 4JPBW 1SHFA 2HDAA 1BB9A 1V1CA 2OAWA 2KT1A 2GQIA 2DRMA 4J9IA 1K4US 3I35A 5IXFA 1I07A 1PWTA 3VRZA 2KEAA 2OI3A 2ABLA 2JMCA 2CT3A 3RNJA 4ZNXA 2JMAA 3A30A 4J9HA 1KJWA 1YWPA 3EG0A 2DBMA 4IIMA 2FPDA 2BZXA 2SRCA 2KE9A 2X3WD 1UTIA 2IOAA 2IF6A 1SEMA 4FQBA 1BBZA 2RF0A 1NEGA 1PHTA 2RQVA 2DL8A 2RNAA 3JV3A 2FRWA 1H8KA 2BTTA 2KXCA 2RQUA 4E6RA 1LCKA 4KRTA 1M27C 1ZUUA 4J9CA 4EIKA 1VYTA 1WX6A 1GCQA 1HD3A 2MIOA 4HVWA 2CSIA 4GBQA 2KNBB 3EHRA 4CC4B 1X6GA 3PBIA 2XMFA 4FGIA 1YWOA 2LNHB 3THKA 1BU1A 1E6GA 3LH5A 1W1FA 1M30A 1WXBA 2LZ6B 2DL7A 2O2OA 1GFDA 4CGKA 2ESWA 4J9EA 1NM7A 2NWMA 1PKSA 2DM1A 3NGPA 4J9GA 2KRSA 1QKXA 2LMJA 1T0HA 2BZYA 1E6HA 1T0JA 1SSHA 4JXBA 2K6DA 2KROA 2D8JA 3GBQA 3M0RA 2RMOA 4Z8AA 3H0HA 4HZ9A 2KYMA 3PVLA 1WXUA 2OJ2A 2VWFA 2LRJA 5IXBA 1ARKA 4Z88A 1CSKA 2EYZA 3PBCA 5FWBA 3VS5A 1AVZC 2W10A 3O5ZA 4Q4GX 1UDLA 2K7AA 2JS2A 2DILA 2FEIA 3UF4A 2EYYA 3UATA 5GJVB 2VPSA 2V1RA 4F0WA 4QT7A 4JJDA 3SHWA 3U23A 2EYWA 3UA7A 2DL4A 2LQWA 4F16A 1YP5A 2ROLA 2PNIA 4LUDA 5EC7A 2HCKA 1AZGB 2FRYA 2K3BA 2L3SA 2RQTA 2M51A 1MUZA 3M0PA 2C0IA 2VVKA 2XIVA 1Z9ZA 2D8HA 1AEYA 2YUNA 2YSQA 2EPDA 2JM8A 2H8HA 2K9GA 2VPMA 2KT8A 2IO8A 4M4ZA 4AFQC 2J06A 2F2WA 1YCSB 2CUDA 3S0QA 1GCPA 4LN2A 2EQIA 5I11A 2FO0A 1AD5A 3REBB 1GBRA 1M3CA 3GT2A 2C0OA 2AK5A 2MCNA 2O9SA 2LJ1A 3KW0A 1I1JA 2YUQA 1QLYA 3NPFA 3H41A 3NHNA 2KYBA 1PNJA 4RUGA 1Y57A 4FGEA 2RPNA 4OMNA 1T3SA 1ZX6A 2JT4A 2HBWA 2ED1A 4OLKA 2K79A 1U3OA 3NE0A 1NG2A 2YT6A 2CH4W 2DLPA 2EW3A 3KFVA 1SPKA 4IIOA 4F0VA 4CSHA 1FYNA 3M0TA 2ECZA 3EGUA 3VS1A 1OEBA 1W70A 3VS6A 2A37A 1NYGA 2CT4A 2LJ3A 2FPEA 1G83A 3PE0A 5IHKA 3VPIA 1H3HA 2L3PA 3VS4A 2CUBA 2CH4A 2SEMA 4AFSC 1IO6A 5FW9A 5IHNA 3VS3A 3I5RA 4Q4NA 1ZUYA 1AWJA 5ECAA 3O98A 2EYXA 2EGCA 2DRKA 2VOBA 1VYUA 4D8KA 1Y0MA 1OOTA 2K3AA 2PZ1A 1T3LA 4LE9A 1VYVA 1TUCA 4AG1C 1M3AA 2X3XD 3H0FA 4RTWA 1WFWA 1ABQA 2E5KA 1JU5C 2A08A 2EBPA 4WCIA 2DL5A 1MV0B 1X27A 4RTXA 1PRLC 1KFZA 2GTOA 2A36A 2DF6A 1NLOC 4R0KA 2EKHA 3VRYA 2I0NA 2NUZA 2KXDA 2DJQA 4FGDA 4JZ3A 1PKTA 1MV3A 4HVUA 2QDLA 2MOXA 1RLPC 4CC3A 2KRMA 1EFNA 3VS0A 2EGAA 3PVQA 2JM9A 2JTEA 4RTYA 3RBBB 3EG1A 1A0NB 1ABOA 2V1QA 2O9VA 1N5ZA 2KGTA 2DNUA 4AFUC 3VS7A 1KSWA 1X69A 1JQQA 3EG2A 1JO8A 2CDTA 1UHFA 1K9AA 1ZBJA 2FPFA 2GGRA 4J9BA 4F14A 1AWOA 1NEBA 1QCFA 2DE0X 2LP5A 1WIEA 1Z9QA 3VS2A 3A2YA 2DYBA 2AZVA 3ULRB 1AWWA 1GBQA 4OMOA 2J6KA 2B86A 3R6NA 2P4RA 1E7OA 2HSPA 2DMOA 1I0CA 1M3BA 2RQWA 1HJDA 3EG3A 4RTTA 2HEQA 2GNCA 4AG2C 4X1VA 1CKBA 3NMZC 1RLQC 1AWXA 1UG1A 4Y92A 2GBQA 3A98A 3QWXX 1JEGA 2K1GA 2J05A 1CKAA 1K76A 4ESRA 2D0NA 4LUEA 2EGEA 4CC2A 1K0XA 2CSQA 1SRLA 2D1XA 4ORZA 4LNPA 3FJ5A 1S1NA 4CT3A 1WA7A 1ZUKA 1VA7A 1M8MA 3QWYA 3TSZA 1UJ0A 3TSWA 1JXOA 4HPEA 4D8DA 4DEXA 2L0AA 1X2QA 4EQ8A 2VKNA 1GL5A 2ENMA 2FG0A 2J6OA 1NYFA 3A2ZA 1X2KA 2C0TA 2JXBA 4Z89A 2IOBA 4HZBA 2GTJA 2IIMA 2AZSA 4GLMA 2LCSA 4FQAA 1X43A 1UE9A 2KRNA 2O88A 4OMLA 1K1ZA 4RTZA 4DEYA 4HCKA 5HCKA 4A63B 2L3QA 5FWCA 1WDXA 2DA9A 1K0SA 1TG0A 1W6XA 1U5SA 2KR3A 2RN8A 4CC7A 5L23A 1UUEA 2L2PA 2DVJA 2G6FX 3M0SA 4OMPA 2IO9A 2LJ0A 4OMMA 1FMKA 1UFFA 1YNZA 4F17A 3I9QA 2ED0A 4K11A 4HVVA 2M0YA 1OPLA 2KBTA 3VPJA 1U06A 4OMQA 4LJ1A 1UJYA 1JXMA 4EQAA 1X6BA 1B07A 2F2XA 1AOJA 3EHQA 4HXJA 1QWFA 2W0ZA
chains in the Genus database with same CATH superfamily
4JZ4A 4M77D 2J7IA 5C6SA 1YJWT 4OVAA 3META 4RG8A 4Q4TA 4FSSA 3VJPA 4M78G 3FJPA 4LDUA 1I5OB 5GAMj 2VB6A 1J3TA 1FX7A 1VQOA 5IHIA 2ROTA 1LPLA 1K8AU 4EOBA 2XI9A 1UGVA 3H0IA 2Z0WA 4FL6A 2LQNA 3HRTA 4DOWA 2YUOA 1PSFA 2AKKA 1Q81U 2WSEE 1YITQ 1YITA 1TUDA 3QKJA 4RG2A 2F2VA 1HSQA 3P8BB 1BI0A 4M78B 4JJBA 4PJOF 3HTRA 2QQSA 2DXTA 1IZ6A 2YXYA 4F4MA 4PK4A 1BKBA 3ZL7C 4R55A 1M2VB 4M75F 2KSSA 1UHCA 3SEMA 4XQ3A 5CR2A 2LX7A 1Q82U 2YUPA 1VQ7Q 4FYVB 3TU4K 2CP6A 1KIKA 1BCOA 3C0CA 2PVDB 5I22A 2CP2A 4M75G 2DTHA 3V7RA 3X28B 3LGLA 1JB0E 2FZKB 1VIFA 4PJOG 1KHCA 1BB9A 3S3OA 4E7LA 2RI2A 3QPHA 3RR6A 2OAWA 2GQIA 4HT9A 5IXFA 5AYFA 1PWTA 2KEAA 2JMCA 3RNJA 5D7UA 2LDMA 3A30A 4J9HA 4LXCA 1YWPA 4M77C 3OS2A 1BI2A 1WZOA 1OZ3A 4FQBA 3CCVQ 2DL8A 1HK9A 2RNAA 3CPWS 3UT1A 1KQSP 2BTTA 2L5QA 3CC4A 2BE7D 1ZUUA 3CPWA 1RL2A 1X6OA 4VUBA 5A0DA 4N4GA 5CAIA 1O9SA 2CZ1B 2KNBB 3EHRA 3M53A 4KGZB 4CC4B 2RH2A 2HAXA 4FGIA 5LJ3g 2MMPA 5GMKj 2M0OA 2V8KA 1IXDA 5D6YA 3VUZA 3G1JA 2MAMA 2O2OA 3JCMW 1GFDA 2ESWA 1NM7A 3JCMc 4J9GA 4II1A 5GAMh 4IUQA 3OBWA 1KQSS 1E6HA 4B9WA 1SSHA 1MMGA 3M55A 3H8ZA 4JLGA 3VUBA 3OSVA 3M0RA 2RMOA 4C5IA 2ZPBB 4C8QB 8ATCB 4HZ9A 5IT9E 1W4SA 2OJ2A 2LRJA 1ARKA 3JCMX 4QQDA 1CSKA 2ATCB 2EYZA 2MK5A 4PNOA 3QJYA 3CC2T 3QBYA 2G3RA 5FWBA 3VS5A 1AVZC 3MP8A 1UDLA 2RK1A 2ZAEA 1YJNQ 3V7CA 3CCQQ 2DILA 3UF4A 3CCST 2EYYA 4FYYB 5GANj 4HA8A 4QT7A 1N27A 4JJDA 5LJ5j 3UA7A 2DL4A 2QQBA 4QVZA 5HKCA 3TCJA 4FSXA 5EC7A 2HCKA 1N9RA 3CPFA 4HCCA 3CCRA 1WQWA 3EG9B 3MJXA 1QP3A 1MUZA 1Z9ZA 2D8HA 4HKEA 1AEYA 2YUNA 2YSQA 2O4XB 1KK7A 3CPWP 2IO8A 4PJJA 2KAFA 1YCSB 2CUDA 1MMAA 1MHNA 3BFMA 5I11A 2FO0A 3REBB 3CMAT 1YIJA 3L2WA 2FZCB 2RB6A 5FU6C 1OU9A 1WHKA 2O9SA 4PJMA 2HL3A 1XNIA 1B34A 3G4SA 1WJQA 3H41A 4BD3A 1TS9A 2K2VA 4RUGA 3LWIA 2JJ9A 4M77F 5GMKe 4FGEA 1G3YA 3EH2A 1LNXA 2R5MA 5CKDA 2DLPA 2EW3A 3CC2A 5GAOq 4A4FA 1K73C 4GY5A 4OMFB 1W2BA 1F1BB 4CSHA 1HYOA 2QEXQ 3M0TA 2QEXA 3PIOA 2JOYA 3JB9I 1MGQA 2ECZA 5GMKh 3V8KA 3VS1A 1K8AR 4M7AG 2QK0A 2LJ3A 4E47A 3PE0A 1Q7YR 3L2UA 1WPYA 4CI0C 3OYCA 1VQLA 3V8JA 5GAMf 1LVKA 2EYXA 2EGCA 4D6WA 2CP7A 1FMVA 2E65A 1YIJQ 2DRKA 2EQJA 2VOBA 4E7ZA 5GANf 5D6WA 2WSFE 1UGRB 1MMNA 4E7SA 3HL8A 1OOTA 4M7AA 4L59A 2YRDA 2V26A 4WF2A 4DBRA 4AG1C 2LRQA 1M1GA 3H0FA 3LW5E 1RACB 4RTWA 5L8RE 4WCIA 2RHYA 5D6XA 2RJEA 2OTJT 2YHTA 4MZPA 2GTOA 4PJLA 2VV5A 1WNLA 4R0KA 3JCMV 3AHUA 2I0NA 2NUZA 3A8GB 5M9OA 4JZ3A 1PKTA 2ZCFB 2QDLA 4GLKA 4KH0B 2MOXA 3P8DA 1RLPC 4CC3A 1TSFA 1FXXA 2EGAA 1ZSZB 2E4HA 2HZYA 2JTEA 4RTYA 1VQ4A 3QUIA 3GPLA 5KH6A 2O9VA 4MZMA 2DNUA 2LQ8A 3JCMf 1JQQA 1BIAA 5LJ3j 1VQMT 1UHFA 5I2MA 2O01E 1ZBJA 1VQ9A 1M1FA 1M2OA 2EFIA 2D9TA 1ACMB 3GIBA 1IGQA 1GBQA 2RHZA 2J6KA 4E7IA 4M75A 3R6NA 4J7FA 2PQWA 1E7OA 4KGVB 4F04B 1I0CA 1M3BA 4ZTFA 3UPUA 1M90R 2QGFB 4X1VA 1CKBA 4FYXB 1YI2Q 1BCMA 2XHCA 4Y92A 2K1GA 2M1HA 1K76A 1KQ2A 2RM4A 2QQRA 4MDWA 1PSEA 2EKOA 2CP5A 2LX9A 4QVDA 4XTVA 1TOVA 4FW2A 3OYMA 1S1NA 1WA7A 1VA7A 3TSZA 4NL3A 1R77A 1YI2T 1JXOA 1NJIC 1QVFA 5LJ5f 4EQ8A 1QW1A 3RERA 4DBFA 2JXBA 3QZ9B 4OF1A 2LQKA 2AZSA 4FQAA 1UE9A 3ASKA 3L2QA 2RI5A 1ZHIA 4DEYA 4PJNA 1PCXA 3C95A 5HCKA 2L3QA 5FWCA 1N8RR 2DA9A 1K0SA 1TG0A 1W6XA 2KR3A 3X24B 1N9SA 1Y96A 2IO9A 4XAXB 2DFUA 1QCNA 2EAYA 3OS5A 2F69A 3SWNB 3OMCA 3EG9A 5CQYA 4K11A 1OU8A 1OPLA 1U06A 1WHJA 4LJ1A 1JXMA 2JTMA 3G4SQ 3MO8A 2PVGB 2W0ZA 2X4WA 1XOVA 2MYSA 3PMIA 2ZPIB 1Q86R 4M77B 3CD6T 3M54A 3MEUA 1WI7A 2DBKA 4J9DA 4IUPA 3M0QA 3EGXA 4M77E 2AT1B 4RTUA 5GAMg 3I86A 2FYKA 3LYIA 2XG8D 2ZPHB 4KUIA 4BDZA 3CC7T 4EMHA 1PD0A 5FLXE 2M9UA 4FYWB 3PT9A 5CKEA 1UECA 3CC4Q 4EMKB 2EJFA 3E9GA 4EMKC 4DA4A 4A54A 4RTVA 1ZSGA 2DL3A 3WVDB 1VQPT 2CREA 1JJ2S 2XD0A 2NUTA 1C0MA 1SHGA 4M77A 1K9MR 1M5Q1 2DX1A 3AT1B 2IO7A 2GFAA 4M7DG 1FMWA 1PM3A 4F7UF 1G2BA 4JRIA 1GFCA 3I56T 3TVTA 2E5QA 3CCRT 1D3BB 1G3TA 3FLGA 1N8RC 2J6FA 1KC8R 3A8MB 1QKWA 1YN8A 3OYGA 3S3MA 1SSFA 1SG5A 2DRMA 2JNGA 4N4IA 3GNFB 1I07A 2K3YA 2VC8A 2ABLA 2OI3A 3MEVA 4ZTJA 2JMAA 2IPOB 2E41A 1RADB 3HP9A 4IKFA 3ZFJA 3OYIA 2JVVA 2FPDA 4XTYA 3C12A 4E2FB 2X3WD 3O8VA 2D6FA 3S3NA 2OX7A 2RK2A 2F5TX 1Q7YC 2DYIA 1NEGA 2FRWA 5DLQE 5KYYB 4XU2A 4ZGEB 2OTLQ 2RQUA 4E6RA 1YJWA 2QA4T 1M27C 3OQ5A 2CGHA 1VQPA 1K73R 4HCBA 1WX6A 2X35A 1M90U 1Q82C 2CSIA 4GBQA 1M2VA 2Y90A 1X6GA 3PBIA 4WTOB 1S72Q 2YLBA 3FB9A 5CCAA 4HFLA 2QEXT 1E6GA 3DB4A 5KCHA 2LZ6B 3GF5A 4C92D 1VQ5T 5J26A 2L8DA 3M4GA 2KRSA 1QKXA 3QDFA 1NZ9A 4JXBA 5KYWA 5LL6S 3PFSA 1TU0B 1YFNA 3A8LB 3GBQA 3JCMe 5GAOr 1VQ7A 1K9MC 3BDLA 3QXEB 2KYMA 3PVLA 4XK8E 5IXBA 3DLMA 1ZA1B 3LGFA 4Z88A 1UGSB 4X9CA 4LDWA 4C92G 4Q4GX 4J5YA 1VQNT 6AT1B 2JS2A 5FU7B 4BE1A 5KE3A 4JRQA 1G5VA 2FEIA 1QVGA 1OQKA 3OYHA 3VV0A 5GJVB 2V1RA 4CRIA 1K73U 1QQJA 3MPUB 2LQWA 4L6V5 4RKUE 2PNIA 4JS5A 1EZZB 3OBYA 1AZGB 3JCMJ 3PNWC 2L3SA 2EIFA 4E7KA 1XQHA 4C8QG 1YI2A 2RQTA 3QYGB 3RKYA 4MDXA 5GMKm 2EPDA 2JM8A 1C1AA 2VPMA 4ELZC 4M4ZA 4AFQC 2RJFA 5GAN5 4M7DE 1GCPA 4B9XA 2K5IA 2EQIA 4DBQA 1GBRA 2P84A 3DB3A 2PUKB 2B8AA 2C0OA 3GT2A 3QZ5B 2AK5A 2MCNA 2LJ1A 2P4TA 1PC0A 2DD5A 5KCOA 3VKIA 5HY6A 3HRSA 4C0ZA 3KUFA 5CIUA 4M7AB 3EGDA 3EFRA 2RPNA 1T3SA 2DD4A 2P0KA 4Y91A 1UGQB 3NE0A 2QGGA 3OW2P 4FCYA 5IN1A 1SPKA 1TXQA 1M1KU 4PJOE 4F0VA 1VQLT 3CCLA 1FYNA 4UC4A 3JCMQ 3PTAA 1VQPQ 3CC7Q 2E3HA 3VS6A 2A37A 4ELYC 2O4XA 2FPEA 5IHKA 3VPIA 1Q86U 1VOMA 4AFSC 3VS3A 1IREB 2DEUA 1ZUYA 1Y96B 5ECAA 1M1KR 1G3WA 1YHQQ 5KYYA 4M7AC 3RKWA 1FWZA 4D8KA 2MI6A 1AT1B 3DKMA 1VYVA 1M3AA 2X3XD 1B7TA 4A4EA 1ABQA 1H641 5GAN2 3BDUA 3A8HB 3CMAA 2EQMA 1KFZA 2E10A 2V8JA 3QHSA 1NLOC 3OYJA 2EKHA 4N0AA 1O75A 2QG9B 4X9DA 3G71A 4C5HA 1MV3A 4A53A 1R0BG 1R0CB 2YLCA 3MEAA 3VS0A 1IB8A 2KVQG 1OYXA 4E7HA 1WHMA 4C0FA 3EAEA 1SF9A 1N5ZA 4X34A 4M7DB 5GAOp 5KYXB 1X69A 1U8RA 2F5KA 5FROA 2DPPB 1K9AA 2FPFA 2GGRA 1KD1R 1QVFS 3DLLA 1QCFA 2FVUA 1WIEA 1Z9QA 2DXCA 3A2YA 1AWWA 3CD6A 2ZGWA 1YJ9T 3PMTA 4XTXA 2COYA 2P4RA 3HHTB 4M78E 3ER0A 2EJGA 2HSPA 2LTOA 3LX7A 3EG3A 4RTTA 3CMEQ 3GLXA 5I2SA 3L42A 1VUBA 3NMZC 1AWXA 1UG1A 3MP1A 4BI4A 1N6AA 2DXUA 4M7AD 2FB7A 2ZPEB 3EFOA 5DY9A 3HFOA 2EGEA 1K0XA 3BY7A 1AHJB 4ORZA 1BI3A 4CT3A 2KMTA 1TTHB 4F7UB 4HT8A 2XDPA 2E6ZA 3TSWA 3CCEQ 2WACA 1RAFB 2NLUA 1VQKQ 1OULA 3VYHB 1VQOQ 5A2QE 2C0TA 4Z89A 4HZBA 2ZZDA 2O88A 4DOVA 1YJ9A 2Y4YA 4A63B 2YRCA 3M58A 1Y7XA 4Z02A 4J30A 2LNVA 1UUEA 2L2PA 2X9HA 1G8XA 2LJ0A 4OMMA 4PLIA 1FMKA 4C92F 1KHIA 4BE0A 4C5GA 2P0QA 2MF2A 4F17A 4E7JA 2CZ7B 4JLIA 4QQGA 1D3BA 4AMCA 4HVVA 5LJ3e 2KBTA 4OMQA 2JN0A 2F1LA 2F2XA 3EHQA 4KGXB 3EH1A 4KUDK 1Y71A 1BYMA 5I21A 2EVRA 4J6XA 5GAN7 1QCOA 5GANg 4LDYA 5FU6B 2JS0A 5CKFA 4M78A 3PGGA 4IURA 3FC3A 5IH2A 3UA6A 2XK0A 1AZEA 1GCQC 1B3QA 1RI9A 3JCMg 3D7SB 2LCCA 1WLPB 2LCLA 1KC8U 1ZA2B 1QWEA 2YDLA 1ZLMA 2DTOA 3A1PA 4BY6B 3FRNA 4PL6A 5KYUA 1VQKA 2BZ8A 1M4ZA 1OV3A 2HL5C 1BK2A 3I5SA 5GAN8 1I81A 4HFKA 1M9SA 1RUWA 1RABB 1YBYA 4C92B 3TEEA 1SRMA 3CCSQ 1EX4A 1W2BP 4FT4A 4J9FA 3OYNA 4FW1A 1D0XA 2PTKA 1WYXA 4OB2B 3M59A 3CCUA 1DJ7B 2QTVA 2O31A 3A8OB 2KQWA 3CBOA 3INZA 5DLOA 3CCLT 3MKDA 5LJ3f 3REAB 2RO0A 3VU3C 1LOJA 2QA4Q 4M77G 2HQHA 3CCJT 3EBQA 4C8QC 4FIBA 1VQMA 4TVRA 4YTLA 1I8FA 2KT1A 4J9IA 3JCMP 2E70A 3I35A 4EMGA 3VRZA 2EJ9A 2DVEA 2CT3A 3OY9A 1K9MU 2X4YA 1KJWA 3V8LA 2M16A 3EG0A 2DBMA 4RCBA 4A4HA 4IIMA 2BZXA 4C5EA 2DETA 2KE9A 4O6JA 2HQEA 3VYGA 1VQ5Q 1UTIA 2CYZB 4F7UG 2IF6A 3CC7A 4M7DF 5A0LA 5GANe 1BBZA 3CCQT 2HQXA 2RF0A 1PHTA 2RQVA 4XU3A 2RHIA 3CCSA 4BE2A 2DTIA 3CC2Q 3HPWA 4IUVA 1WHLA 2KXCA 3MEWA 2OAUA 4KRTA 4J9CA 1QVGS 3CXCS 4BACA 2MIOA 3L2ZA 4HFFA 1YWOA 2PUOB 3BE3A 3JRZA 3THKA 3LH5A 5GANh 1WXBA 2DL7A 2FZGB 1QVGP 1PKSA 2DM1A 2OTLT 4J6YA 3GNGA 1T0HA 2BZYA 2RI3A 1T0JA 2E6NA 5J39A 3C94A 4QW2A 3T9NA 2JZ2A 3ZBDA 4Z8AA 3H0HA 3MP6A 3CEYA 1WXUA 1NPRA 2VWFA 2VXEA 3OYEA 3E2UA 2JTFA 2XIDA 4DBHA 2KK4A 2I2LA 4C0DB 3BW1A 1IGUA 3ZEHA 2QXFA 2PVOB 3FDRA 5HK0A 2C06A 2DZ9A 5CKHA 2DK3A 3QG1A 5CO7A 3SHWA 3CCQA 2EYWA 2QYZA 2BIVA 4F16A 2E1HA 1YP5A 3I55A 2ROLA 4LUDA 4MMKA 3G4ST 3CCMA 4XU0A 1HXDA 5J3BA 3OYDA 2FRYA 2K3BA 1D0YA 2M51A 1Q81C 1M8VA 3JB9J 2A0FB 2H8HA 2K9GA 2RHUA 1RAHB 2KT8A 3CXCA 2E3IA 2YWWA 2FHDA 2J06A 1WJSA 1KD1U 3CCJA 1WQ7A 2A7YA 4ZGDB 1VQ9T 1S72A 3NTHA 3H9NA 3CMET 1M3CA 3OYAA 3KW0A 5GAN6 1I1JA 2DXBA 2HSEB 1ZSZA 1QLYA 3NPFA 3JB9H 3EFOB 5LJ5h 3NHNA 1IRXA 1PNJA 3L1AA 4EMKA 1RI0A 4OMNA 4OB3B 1ZSZC 3FIFA 2HBWA 4M75D 4Y28E 2ED1A 3OSSC 4BI8B 1U3OA 3CD6Q 1IHVA 2YT6A 2CH4W 5DM7R 1Q82R 1VQ5A 2XICA 3CCVA 3QO3A 1NPPA 1R8OB 3CCET 1NYGA 4PFPA 2CT4A 2KY9A 1G83A 2V8IA 4IUTA 1UGPB 2L3PA 4F7UE 1VQ6Q 3JB9G 2KDSA 1MNDA 1IO6A 5FW9A 5IHNA 5KYXA 4Q4NA 1AWJA 2XDBA 3KBGA 3WXMB 1K8AC 1X01A 2ZPGB 3J81E 3M9QA 2E12A 1VYUA 4R56A 2VGNA 1QP2A 2K3AA 4C92A 4QVCA 3E1SA 5LJ3h 1G3SA 1TUCA 3TREA 1WFWA 1VQNQ 1TH7A 3RMQA 3X26B 1VIEA 1RAEB 4PJOD 1MV0B 1X27A 1PRLC 2XKOC 4OP0A 4FU6A 1UEBA 4XTWA 3VRYA 4J8OA 1NE8A 4RCCA 1TWBA 2DJQA 4HVUA 1VQ8Q 4KULA 4OB0B 1V29B 2HKNA 2R57A 2RA2A 2D0QB 4C92C 2KRMA 5HK3A 3CCMQ 5KYNA 1B34B 2JM9A 4LD6A 2E64A 3RBBB 4OB1B 5GMKi 1VQLQ 1A0NB 2H3JA 2V1QA 1Q81R 1VQMQ 3JAME 4N4HA 3EG2A 1JO8A 1S72T 4J9BA 3LWHA 1AWOA 2LVMA 3M4YA 2BUDA 1NEBA 3JCMb 2NUPB 2DE0X 2LP5A 4FT2A 3VS2A 4PJOA 2DYBA 2AZVA 3ULRB 3GP8A 4BDYA 1OZ2A 4OMOA 3JB9D 2B86A 3CCJQ 1D1AA 4C8QD 2DMOA 4RMOA 2HEQA 2GNCA 4PJOC 1OX8A 3HRUA 1RLQC 4C8QE 3I55T 3JCMd 2GBQA 4OGCA 5LJ3d 4ESRA 4LUEA 3OMGA 2CSQA 2HKQB 4JJNK 1MMDA 4LNPA 3EFSA 4HCZA 3QWYA 1M8MA 3OYKA 1GXIE 3I55Q 4Q5WA 4D8DA 1H3ZA 1X2QA 1V76A 5AT1B 1ZBXA 4ANJA 2VKNA 4JRKA 1GL5A 3UDCA 2ENMA 4C8QA 2FG0A 4MMLA 2J6OA 2QASA 4M7AF 3SFMA 2GTJA 4GLMA 4JUVA 2KRNA 4OMLA 4MZTA 4HCKA 5GAOm 4M7DA 1WDXA 2XU8A 4CC7A 2X51A 4BUGA 2G6FX 3I56Q 1YNZA 3SWNC 1KQSA 2ED0A 3H6ZA 3SD4A 2M0YA 3CCUT 4NOYA 1UJYA 2EWNA 1KQ1A 1N8RU 1AOJA 1BIBA 2HBPA 4LD9K 2K2MA 2LT1A 1GRIA 3CBPA 3NTIA 3M1UA 3CC4T 1D09B 4ZN3A 3OW2S 3PIPA 1YJ9Q 1NLPC 4V2SA 3TQ7P 5GJWB 2K4YA 3IQLA 2FL7A 5LJ5d 2RHXA 1VQ4Q 2RQRA 1JJ2A 2ZPFB 2X4XA 1RAIB 1H92A 2AKLA 4AFZC 3G6ET 2R5AA 1WXTA 3CXCP 4M7DC 2DO3A 1VQOT 2A28A 2R58A 3OYBA 3G71Q 3Q1JA 4JJCA 5FU7C 1KC8C 1I4K1 4M75E 1OPKA 5FRNA 2OTLA 1PRMC 2EQKA 3M0UA 4BI3A 2GQVA 3CQTA 1VQ6T 5FRMA 4FDYA 3HFNA 3M56A 4XU1A 4JS4A 5CK9A 5GAMd 2L3RA 3OB9A 3RUXA 1OI1A 2DEQA 2CS7A 2K3XA 3EGDB 2MWOA 2QQ9A 1C6VX 2JW4A 1VQ8T 4JPBW 4NS5A 1SHFA 2HDAA 4EDUA 3A5ZB 1V1CA 1NBEB 1NJIR 2DIGA 2PU9B 1YJNT 1K4US 2RJDA 3CCRQ 2VASA 4ZNXA 5LJ5g 5GAN3 1Q7YU 3NTKA 2QDYB 2SRCA 1W2BS 3RDVA 2IOAA 1SEMA 4KT0E 1P92A 1QVPA 1M90C 3JV3A 3RESA 3M57A 3OS0A 1OX9A 1U1TA 1H8KA 4KH1B 1X75C 1LCKA 2QI2A 2QAZA 4EIKA 1VQNA 1VYTA 4HVWA 1GCQA 1HD3A 2DKGA 2HD0A 2COZA 2XMFA 1WHGA 2DAQA 3CBMA 4DQ2A 2NUTB 2LNHB 1BI1A 1BU1A 3CCVT 1W1FA 3P8HA 1M30A 5CVIA 3J7AF 2QQAA 1YHQA 4CGKA 4J9EA 2NWMA 3RMSA 4P5NA 3NGPA 5GMKl 4M78F 3M5AA 2LMJA 1VQKT 3QYHB 2K6DA 2RJCA 3JB9F 2OTJA 1YHQT 2KROA 2D8JA 5GAN4 4PFOA 3OYYA 3RIRA 4PFZA 2COWA 1JBMA 3I56A 3L2RA 3OYLA 3QJ6A 3PBCA 4OGEA 2W10A 1VQ9Q 1RAAB 3O5ZA 2K7AA 4C0GA 3HKSA 2CKKA 4A4KA 3UATA 2VPSA 4J32A 3RKXA 2XDDA 1YCYA 4F0WA 4M7AE 1EIFA 3U23A 4B6MA 2HMAA 3E9FA 4J83A 2A3LA 1VQ7T 3SDZA 1Q86C 1KD1C 3R6OA 5GAOn 3G6EQ 2WSCE 1RAGB 3M0PA 2C0IA 2CP0A 2VVKA 2XIVA 1Y07A 4JRPA 4L5GA 2VGMA 2EYQA 2VYTA 3F70A 3QSUA 2F2WA 1SKUB 2IVWA 4BB7A 3S0QA 5KE2A 4LN2A 1AD5A 3UWNA 1YITT 3QIIA 1LJOA 2YUQA 1YJWQ 3KXTA 2K5FA 2KYBA 1UB4A 2VXFA 3MHXA 9ATCB 1Y57A 1ZX6A 2JT4A 4A4GA 1TUGB 2GFUA 1QVFP 3G71T 5GAOl 4BY6C 3JCMh 2K79A 4FM4B 4OLKA 1NG2A 3KFVA 4IIOA 3C4SA 3EGXB 4QQ6A 4NL2A 1VQ4T 3EGUA 4M78C 1OEBA 1W70A 3CCEA 3X25B 4C8QF 4ATOA 4XTZA 1M1KC 3N5BB 2CP3A 1H3HA 3VS4A 2CUBA 2CH4A 3OA6A 2SEMA 3G7ZA 4AT1B 3I5RA 1YJNA 1KG1A 3O98A 2DERA 1MNEA 2RD1A 3V7SA 3L2VA 2NUPA 1JJ2P 2AIRB 5IAYA 2OTJQ 2MWPA 1Y0MA 2IG0A 2LC4A 3ME9A 3OW2A 7AT1B 2PZ1A 2BE9B 4ZGJB 3OS1A 1T3LA 4LE9A 1NJIU 5KYUB 2X4JA 2E5KA 1JU5C 2A08A 2EBPA 2QTXA 1XTDA 3X20B 2H3EB 2JUFA 4ME7A 3CMEA 5EG2A 2DL5A 4JURA 4RTXA 2CZ6B 2EQUA 5CKBA 2A36A 2DF6A 2VUBA 2AHJB 3OYFA 2QA4A 5C0MA 2LT4A 2KXDA 1PG5B 4FGDA 2WP7A 4KBMB 4LDVA 4C92E 5GANd 4PLLA 2DIQA 8AT1B 3SB2A 1EFNA 1IHWA 5KYWB 1QMCA 3PVQA 1D1CA 3CCLQ 2GCXA 3NFCA 4J7IA 1PD1A 1ZQ1A 3EG1A 1ABOA 2KGTA 2Y4XA 4AFUC 3VS7A 1KSWA 4ZN1A 1U1SA 2CDTA 4M7DD 5CQXA 4F14A 2KI7A 1WHHA 3S6WA 1JRIA 4LDXA 3J80E 1WGSA 2K5LA 3WVEB 3SWNA 3GOXA 4QKUA 3CCUQ 5GAMe 4EPCA 2RQWA 4F7UA 1HJDA 2DJZA 3CMAQ 5A0GA 2M02A 4AG2C 4M78D 1VQ6A 4IUUA 4O5VA 2DZCA 3A98A 3QWXX 1YIJT 1JEGA 3QDRB 2J05A 1CKAA 4XTUA 2D0NA 2CZ0B 3JSCA 3URGA 4CC2A 4PKCC 1SRLA 2D1XA 4JDSA 3FJ5A 2L89A 1ZUKA 1UJ0A 4HPEA 4DEXA 2L0AA 2NYSA 3HSBA 3CCMT 2HNIA 2YRVA 1NYFA 3FEOA 3G6EA 2K57A 3A2ZA 1X2KA 2IOBA 2IIMA 2LCSA 1X43A 1D1BA 1K1ZA 4RTZA 1I5LA 3LLRA 5L23A 1U5SA 2RN8A 4PJOB 2DVJA 1VQ8A 2MPXC 3M0SA 3LH0A 4J6WA 4OMPA 4M75B 1UFFA 3MCAB 4M75C 3I9QA 1XJWB 2GF7A 2P0PA 3E19A 2BKDN 3VPJA 1WJRA 5LJ5e 4N0AC 4EQAA 1X6BA 1Q95G 1B07A 4HXJA 1QWFA 1D0ZA 4C0DC
chains in the Genus database with same CATH topology
2K2MA 4JZ4A 1XOVA 1GRIA 2J7IA 2EVRA 3M1UA 2JS0A 4Q4TA 4FSSA 1NLPC 1WI7A 2DBKA 4J9DA 5IH2A 3UA6A 3M0QA 5GJWB 1AZEA 1GCQC 3IQLA 1B3QA 1J3TA 4RTUA 1RI9A 3I86A 5IHIA 2ROTA 1WLPB 2RQRA 4EOBA 1UGVA 3H0IA 2LQNA 2YDLA 1QWEA 2AKLA 1ZLMA 1UECA 4AFZC 1H92A 2YUOA 1WXTA 2AKKA 1TUDA 2A28A 2F2VA 4RTVA 1ZSGA 1HSQA 2DL3A 4JJCA 2CREA 4JJBA 2BZ8A 1OV3A 1BK2A 3I5SA 1SHGA 1OPKA 4F4MA 1RUWA 3ZL7C 2DX1A 2IO7A 1UHCA 3SEMA 1PRMC 3M0UA 1SRMA 3CQTA 4J9FA 4FDYA 2LX7A 1G2BA 2PTKA 1GFCA 2YUPA 1WYXA 3TVTA 1KIKA 2J6FA 3C0CA 2O31A 3REAB 5I22A 1QKWA 1YN8A 2JW4A 4JPBW 1SHFA 2HDAA 1BB9A 1V1CA 2OAWA 2KT1A 2GQIA 2DRMA 4J9IA 1K4US 3I35A 5IXFA 1I07A 1PWTA 3VRZA 2KEAA 2OI3A 2ABLA 2JMCA 2CT3A 3RNJA 4ZNXA 2JMAA 3A30A 4J9HA 1KJWA 1YWPA 3EG0A 2DBMA 4IIMA 2FPDA 2BZXA 2SRCA 2KE9A 2X3WD 1UTIA 2IOAA 2IF6A 1SEMA 4FQBA 1BBZA 2RF0A 1NEGA 1PHTA 2RQVA 2DL8A 2RNAA 3JV3A 2FRWA 1H8KA 2BTTA 2KXCA 2RQUA 4E6RA 1LCKA 4KRTA 1M27C 1ZUUA 4J9CA 4EIKA 1VYTA 1WX6A 1GCQA 1HD3A 2MIOA 4HVWA 2CSIA 4GBQA 2KNBB 3EHRA 4CC4B 1X6GA 3PBIA 2XMFA 4FGIA 1YWOA 2LNHB 3THKA 1BU1A 1E6GA 3LH5A 1W1FA 1M30A 1WXBA 2LZ6B 2DL7A 2O2OA 1GFDA 4CGKA 2ESWA 4J9EA 1NM7A 2NWMA 1PKSA 2DM1A 3NGPA 4J9GA 2KRSA 1QKXA 2LMJA 1T0HA 2BZYA 1E6HA 1T0JA 1SSHA 4JXBA 2K6DA 2KROA 2D8JA 3GBQA 3M0RA 2RMOA 4Z8AA 3H0HA 4HZ9A 2KYMA 3PVLA 1WXUA 2OJ2A 2VWFA 2LRJA 5IXBA 1ARKA 4Z88A 1CSKA 2EYZA 3PBCA 5FWBA 3VS5A 1AVZC 2W10A 3O5ZA 4Q4GX 1UDLA 2K7AA 2JS2A 2DILA 2FEIA 3UF4A 2EYYA 3UATA 5GJVB 2VPSA 2V1RA 4F0WA 4QT7A 4JJDA 3SHWA 3U23A 2EYWA 3UA7A 2DL4A 2LQWA 4F16A 1YP5A 2ROLA 2PNIA 4LUDA 5EC7A 2HCKA 1AZGB 2FRYA 2K3BA 2L3SA 2RQTA 2M51A 1MUZA 3M0PA 2C0IA 2VVKA 2XIVA 1Z9ZA 2D8HA 1AEYA 2YUNA 2YSQA 2EPDA 2JM8A 2H8HA 2K9GA 2VPMA 2KT8A 2IO8A 4M4ZA 4AFQC 2J06A 2F2WA 1YCSB 2CUDA 3S0QA 1GCPA 4LN2A 2EQIA 5I11A 2FO0A 1AD5A 3REBB 1GBRA 1M3CA 3GT2A 2C0OA 2AK5A 2MCNA 2O9SA 2LJ1A 3KW0A 1I1JA 2YUQA 1QLYA 3NPFA 3H41A 3NHNA 2KYBA 1PNJA 4RUGA 1Y57A 4FGEA 2RPNA 4OMNA 1T3SA 1ZX6A 2JT4A 2HBWA 2ED1A 4OLKA 2K79A 1U3OA 3NE0A 1NG2A 2YT6A 2CH4W 2DLPA 2EW3A 3KFVA 1SPKA 4IIOA 4F0VA 4CSHA 1FYNA 3M0TA 2ECZA 3EGUA 3VS1A 1OEBA 1W70A 3VS6A 2A37A 1NYGA 2CT4A 2LJ3A 2FPEA 1G83A 3PE0A 5IHKA 3VPIA 1H3HA 2L3PA 3VS4A 2CUBA 2CH4A 2SEMA 4AFSC 1IO6A 5FW9A 5IHNA 3VS3A 3I5RA 4Q4NA 1ZUYA 1AWJA 5ECAA 3O98A 2EYXA 2EGCA 2DRKA 2VOBA 1VYUA 4D8KA 1Y0MA 1OOTA 2K3AA 2PZ1A 1T3LA 4LE9A 1VYVA 1TUCA 4AG1C 1M3AA 2X3XD 3H0FA 4RTWA 1WFWA 1ABQA 2E5KA 1JU5C 2A08A 2EBPA 4WCIA 2DL5A 1MV0B 1X27A 4RTXA 1PRLC 1KFZA 2GTOA 2A36A 2DF6A 1NLOC 4R0KA 2EKHA 3VRYA 2I0NA 2NUZA 2KXDA 2DJQA 4FGDA 4JZ3A 1PKTA 1MV3A 4HVUA 2QDLA 2MOXA 1RLPC 4CC3A 2KRMA 1EFNA 3VS0A 2EGAA 3PVQA 2JM9A 2JTEA 4RTYA 3RBBB 3EG1A 1A0NB 1ABOA 2V1QA 2O9VA 1N5ZA 2KGTA 2DNUA 4AFUC 3VS7A 1KSWA 1X69A 1JQQA 3EG2A 1JO8A 2CDTA 1UHFA 1K9AA 1ZBJA 2FPFA 2GGRA 4J9BA 4F14A 1AWOA 1NEBA 1QCFA 2DE0X 2LP5A 1WIEA 1Z9QA 3VS2A 3A2YA 2DYBA 2AZVA 3ULRB 1AWWA 1GBQA 4OMOA 2J6KA 2B86A 3R6NA 2P4RA 1E7OA 2HSPA 2DMOA 1I0CA 1M3BA 2RQWA 1HJDA 3EG3A 4RTTA 2HEQA 2GNCA 4AG2C 4X1VA 1CKBA 3NMZC 1RLQC 1AWXA 1UG1A 4Y92A 2GBQA 3A98A 3QWXX 1JEGA 2K1GA 2J05A 1CKAA 1K76A 4ESRA 2D0NA 4LUEA 2EGEA 4CC2A 1K0XA 2CSQA 1SRLA 2D1XA 4ORZA 4LNPA 3FJ5A 1S1NA 4CT3A 1WA7A 1ZUKA 1VA7A 1M8MA 3QWYA 3TSZA 1UJ0A 3TSWA 1JXOA 4HPEA 4D8DA 4DEXA 2L0AA 1X2QA 4EQ8A 2VKNA 1GL5A 2ENMA 2FG0A 2J6OA 1NYFA 3A2ZA 1X2KA 2C0TA 2JXBA 4Z89A 2IOBA 4HZBA 2GTJA 2IIMA 2AZSA 4GLMA 2LCSA 4FQAA 1X43A 1UE9A 2KRNA 2O88A 4OMLA 1K1ZA 4RTZA 4DEYA 4HCKA 5HCKA 4A63B 2L3QA 5FWCA 1WDXA 2DA9A 1K0SA 1TG0A 1W6XA 1U5SA 2KR3A 2RN8A 4CC7A 5L23A 1UUEA 2L2PA 2DVJA 2G6FX 3M0SA 4OMPA 2IO9A 2LJ0A 4OMMA 1FMKA 1UFFA 1YNZA 4F17A 3I9QA 2ED0A 4K11A 4HVVA 2M0YA 1OPLA 2KBTA 3VPJA 1U06A 4OMQA 4LJ1A 1UJYA 1JXMA 4EQAA 1X6BA 1B07A 2F2XA 1AOJA 3EHQA 4HXJA 1QWFA 2W0ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K2M A;  4JZ4 A;  1XOV A;  1GRI A;  2J7I A;  2EVR A;  3M1U A;  2JS0 A;  4Q4T A;  4FSS A;  1NLP C;  1WI7 A;  2DBK A;  4J9D A;  5IH2 A;  3UA6 A;  3M0Q A;  5GJW B;  1AZE A;  1GCQ C;  3IQL A;  1B3Q A;  1J3T A;  4RTU A;  1RI9 A;  3I86 A;  5IHI A;  2ROT A;  1WLP B;  2RQR A;  4EOB A;  1UGV A;  3H0I A;  2LQN A;  2YDL A;  1QWE A;  2AKL A;  1ZLM A;  1UEC A;  4AFZ C;  1H92 A;  2YUO A;  1WXT A;  2AKK A;  1TUD A;  2A28 A;  2F2V A;  4RTV A;  1ZSG A;  1HSQ A;  2DL3 A;  4JJC A;  2CRE A;  4JJB A;  2BZ8 A;  1OV3 A;  1BK2 A;  3I5S A;  1SHG A;  1OPK A;  4F4M A;  1RUW A;  3ZL7 C;  2DX1 A;  2IO7 A;  1UHC A;  3SEM A;  1PRM C;  3M0U A;  1SRM A;  3CQT A;  4J9F A;  4FDY A;  2LX7 A;  1G2B A;  2PTK A;  1GFC A;  2YUP A;  1WYX A;  3TVT A;  1KIK A;  2J6F A;  3C0C A;  2O31 A;  3REA B;  5I22 A;  1QKW A;  1YN8 A;  2JW4 A;  4JPB W;  1SHF A;  2HDA A;  1BB9 A;  1V1C A;  2OAW A;  2KT1 A;  2GQI A;  2DRM A;  4J9I A;  1K4U S;  3I35 A;  5IXF A;  1I07 A;  1PWT A;  3VRZ A;  2KEA A;  2OI3 A;  2ABL A;  2JMC A;  2CT3 A;  3RNJ A;  4ZNX A;  2JMA A;  3A30 A;  4J9H A;  1KJW A;  1YWP A;  3EG0 A;  2DBM A;  4IIM A;  2FPD A;  2BZX A;  2SRC A;  2KE9 A;  2X3W D;  1UTI A;  2IOA A;  2IF6 A;  1SEM A;  4FQB A;  1BBZ A;  2RF0 A;  1NEG A;  1PHT A;  2RQV A;  2DL8 A;  2RNA A;  3JV3 A;  2FRW A;  1H8K A;  2BTT A;  2KXC A;  2RQU A;  4E6R A;  1LCK A;  4KRT A;  1M27 C;  1ZUU A;  4J9C A;  4EIK A;  1VYT A;  1WX6 A;  1GCQ A;  1HD3 A;  2MIO A;  4HVW A;  2CSI A;  4GBQ A;  2KNB B;  3EHR A;  4CC4 B;  1X6G A;  3PBI A;  2XMF A;  4FGI A;  1YWO A;  2LNH B;  3THK A;  1BU1 A;  1E6G A;  3LH5 A;  1W1F A;  1M30 A;  1WXB A;  2LZ6 B;  2DL7 A;  2O2O A;  1GFD A;  4CGK A;  2ESW A;  4J9E A;  1NM7 A;  2NWM A;  1PKS A;  2DM1 A;  3NGP A;  4J9G A;  2KRS A;  1QKX A;  2LMJ A;  1T0H A;  2BZY A;  1E6H A;  1T0J A;  1SSH A;  4JXB A;  2K6D A;  2KRO A;  2D8J A;  3GBQ A;  3M0R A;  2RMO A;  4Z8A A;  3H0H A;  4HZ9 A;  2KYM A;  3PVL A;  1WXU A;  2OJ2 A;  2VWF A;  2LRJ A;  5IXB A;  1ARK A;  4Z88 A;  1CSK A;  2EYZ A;  3PBC A;  5FWB A;  3VS5 A;  1AVZ C;  2W10 A;  3O5Z A;  4Q4G X;  1UDL A;  2K7A A;  2JS2 A;  2DIL A;  2FEI A;  3UF4 A;  2EYY A;  3UAT A;  5GJV B;  2VPS A;  2V1R A;  4F0W A;  4QT7 A;  4JJD A;  3SHW A;  3U23 A;  2EYW A;  3UA7 A;  2DL4 A;  2LQW A;  4F16 A;  1YP5 A;  2ROL A;  2PNI A;  4LUD A;  5EC7 A;  2HCK A;  1AZG B;  2FRY A;  2K3B A;  2L3S A;  2RQT A;  2M51 A;  1MUZ A;  3M0P A;  2C0I A;  2VVK A;  2XIV A;  1Z9Z A;  2D8H A;  1AEY A;  2YUN A;  2YSQ A;  2EPD A;  2JM8 A;  2H8H A;  2K9G A;  2VPM A;  2KT8 A;  2IO8 A;  4M4Z A;  4AFQ C;  2J06 A;  2F2W A;  1YCS B;  2CUD A;  3S0Q A;  1GCP A;  4LN2 A;  2EQI A;  5I11 A;  2FO0 A;  1AD5 A;  3REB B;  1GBR A;  1M3C A;  3GT2 A;  2C0O A;  2AK5 A;  2MCN A;  2O9S A;  2LJ1 A;  3KW0 A;  1I1J A;  2YUQ A;  1QLY A;  3NPF A;  3H41 A;  3NHN A;  2KYB A;  1PNJ A;  4RUG A;  1Y57 A;  4FGE A;  2RPN A;  4OMN A;  1T3S A;  1ZX6 A;  2JT4 A;  2HBW A;  2ED1 A;  4OLK A;  2K79 A;  1U3O A;  3NE0 A;  1NG2 A;  2YT6 A;  2CH4 W;  2DLP A;  2EW3 A;  3KFV A;  1SPK A;  4IIO A;  4F0V A;  4CSH A;  1FYN A;  3M0T A;  2ECZ A;  3EGU A;  3VS1 A;  1OEB A;  1W70 A;  3VS6 A;  2A37 A;  1NYG A;  2CT4 A;  2LJ3 A;  2FPE A;  1G83 A;  3PE0 A;  5IHK A;  3VPI A;  1H3H A;  2L3P A;  3VS4 A;  2CUB A;  2CH4 A;  2SEM A;  4AFS C;  1IO6 A;  5FW9 A;  5IHN A;  3VS3 A;  3I5R A;  4Q4N A;  1ZUY A;  1AWJ A;  5ECA A;  3O98 A;  2EYX A;  2EGC A;  2DRK A;  2VOB A;  1VYU A;  4D8K A;  1Y0M A;  1OOT A;  2K3A A;  2PZ1 A;  1T3L A;  4LE9 A;  1VYV A;  1TUC A;  4AG1 C;  1M3A A;  2X3X D;  3H0F A;  4RTW A;  1WFW A;  1ABQ A;  2E5K A;  1JU5 C;  2A08 A;  2EBP A;  4WCI A;  2DL5 A;  1MV0 B;  1X27 A;  4RTX A;  1PRL C;  1KFZ A;  2GTO A;  2A36 A;  2DF6 A;  1NLO C;  4R0K A;  2EKH A;  3VRY A;  2I0N A;  2NUZ A;  2KXD A;  2DJQ A;  4FGD A;  4JZ3 A;  1PKT A;  1MV3 A;  4HVU A;  2QDL A;  2MOX A;  1RLP C;  4CC3 A;  2KRM A;  1EFN A;  3VS0 A;  2EGA A;  3PVQ A;  2JM9 A;  2JTE A;  4RTY A;  3RBB B;  3EG1 A;  1A0N B;  1ABO A;  2V1Q A;  2O9V A;  1N5Z A;  2KGT A;  2DNU A;  4AFU C;  3VS7 A;  1KSW A;  1X69 A;  1JQQ A;  3EG2 A;  1JO8 A;  2CDT A;  1UHF A;  1K9A A;  1ZBJ A;  2FPF A;  2GGR A;  4J9B A;  4F14 A;  1AWO A;  1NEB A;  1QCF A;  2DE0 X;  2LP5 A;  1WIE A;  1Z9Q A;  3VS2 A;  3A2Y A;  2DYB A;  2AZV A;  3ULR B;  1AWW A;  1GBQ A;  4OMO A;  2J6K A;  2B86 A;  3R6N A;  2P4R A;  1E7O A;  2HSP A;  2DMO A;  1I0C A;  1M3B A;  2RQW A;  1HJD A;  3EG3 A;  4RTT A;  2HEQ A;  2GNC A;  4AG2 C;  4X1V A;  1CKB A;  3NMZ C;  1RLQ C;  1AWX A;  1UG1 A;  4Y92 A;  2GBQ A;  3A98 A;  3QWX X;  1JEG A;  2K1G A;  2J05 A;  1CKA A;  1K76 A;  4ESR A;  2D0N A;  4LUE A;  2EGE A;  4CC2 A;  1K0X A;  2CSQ A;  1SRL A;  2D1X A;  4ORZ A;  4LNP A;  3FJ5 A;  1S1N A;  4CT3 A;  1WA7 A;  1ZUK A;  1VA7 A;  1M8M A;  3QWY A;  3TSZ A;  1UJ0 A;  3TSW A;  1JXO A;  4HPE A;  4D8D A;  4DEX A;  2L0A A;  1X2Q A;  4EQ8 A;  2VKN A;  1GL5 A;  2ENM A;  2FG0 A;  2J6O A;  1NYF A;  3A2Z A;  1X2K A;  2C0T A;  2JXB A;  4Z89 A;  2IOB A;  4HZB A;  2GTJ A;  2IIM A;  2AZS A;  4GLM A;  2LCS A;  4FQA A;  1X43 A;  1UE9 A;  2KRN A;  2O88 A;  4OML A;  1K1Z A;  4RTZ A;  4DEY A;  4HCK A;  5HCK A;  4A63 B;  2L3Q A;  5FWC A;  1WDX A;  2DA9 A;  1K0S A;  1TG0 A;  1W6X A;  1U5S A;  2KR3 A;  2RN8 A;  4CC7 A;  5L23 A;  1UUE A;  2L2P A;  2DVJ A;  2G6F X;  3M0S A;  4OMP A;  2IO9 A;  2LJ0 A;  4OMM A;  1FMK A;  1UFF A;  1YNZ A;  4F17 A;  3I9Q A;  2ED0 A;  4K11 A;  4HVV A;  2M0Y A;  1OPL A;  2KBT A;  3VPJ A;  1U06 A;  4OMQ A;  4LJ1 A;  1UJY A;  1JXM A;  4EQA A;  1X6B A;  1B07 A;  2F2X A;  1AOJ A;  3EHQ A;  4HXJ A;  1QWF A;  2W0Z A; 
#chains in the Genus database with same CATH topology
 4JZ4 A;  4M77 D;  2J7I A;  5C6S A;  1YJW T;  4OVA A;  3MET A;  4RG8 A;  4Q4T A;  4FSS A;  3VJP A;  4M78 G;  3FJP A;  4LDU A;  1I5O B;  5GAM j;  2VB6 A;  1J3T A;  1FX7 A;  1VQO A;  5IHI A;  2ROT A;  1LPL A;  1K8A U;  4EOB A;  2XI9 A;  1UGV A;  3H0I A;  2Z0W A;  4FL6 A;  2LQN A;  3HRT A;  4DOW A;  2YUO A;  1PSF A;  2AKK A;  1Q81 U;  2WSE E;  1YIT Q;  1YIT A;  1TUD A;  3QKJ A;  4RG2 A;  2F2V A;  1HSQ A;  3P8B B;  1BI0 A;  4M78 B;  4JJB A;  4PJO F;  3HTR A;  2QQS A;  2DXT A;  1IZ6 A;  2YXY A;  4F4M A;  4PK4 A;  1BKB A;  3ZL7 C;  4R55 A;  1M2V B;  4M75 F;  2KSS A;  1UHC A;  3SEM A;  4XQ3 A;  5CR2 A;  2LX7 A;  1Q82 U;  2YUP A;  1VQ7 Q;  4FYV B;  3TU4 K;  2CP6 A;  1KIK A;  1BCO A;  3C0C A;  2PVD B;  5I22 A;  2CP2 A;  4M75 G;  2DTH A;  3V7R A;  3X28 B;  3LGL A;  1JB0 E;  2FZK B;  1VIF A;  4PJO G;  1KHC A;  1BB9 A;  3S3O A;  4E7L A;  2RI2 A;  3QPH A;  3RR6 A;  2OAW A;  2GQI A;  4HT9 A;  5IXF A;  5AYF A;  1PWT A;  2KEA A;  2JMC A;  3RNJ A;  5D7U A;  2LDM A;  3A30 A;  4J9H A;  4LXC A;  1YWP A;  4M77 C;  3OS2 A;  1BI2 A;  1WZO A;  1OZ3 A;  4FQB A;  3CCV Q;  2DL8 A;  1HK9 A;  2RNA A;  3CPW S;  3UT1 A;  1KQS P;  2BTT A;  2L5Q A;  3CC4 A;  2BE7 D;  1ZUU A;  3CPW A;  1RL2 A;  1X6O A;  4VUB A;  5A0D A;  4N4G A;  5CAI A;  1O9S A;  2CZ1 B;  2KNB B;  3EHR A;  3M53 A;  4KGZ B;  4CC4 B;  2RH2 A;  2HAX A;  4FGI A;  5LJ3 g;  2MMP A;  5GMK j;  2M0O A;  2V8K A;  1IXD A;  5D6Y A;  3VUZ A;  3G1J A;  2MAM A;  2O2O A;  3JCM W;  1GFD A;  2ESW A;  1NM7 A;  3JCM c;  4J9G A;  4II1 A;  5GAM h;  4IUQ A;  3OBW A;  1KQS S;  1E6H A;  4B9W A;  1SSH A;  1MMG A;  3M55 A;  3H8Z A;  4JLG A;  3VUB A;  3OSV A;  3M0R A;  2RMO A;  4C5I A;  2ZPB B;  4C8Q B;  8ATC B;  4HZ9 A;  5IT9 E;  1W4S A;  2OJ2 A;  2LRJ A;  1ARK A;  3JCM X;  4QQD A;  1CSK A;  2ATC B;  2EYZ A;  2MK5 A;  4PNO A;  3QJY A;  3CC2 T;  3QBY A;  2G3R A;  5FWB A;  3VS5 A;  1AVZ C;  3MP8 A;  1UDL A;  2RK1 A;  2ZAE A;  1YJN Q;  3V7C A;  3CCQ Q;  2DIL A;  3UF4 A;  3CCS T;  2EYY A;  4FYY B;  5GAN j;  4HA8 A;  4QT7 A;  1N27 A;  4JJD A;  5LJ5 j;  3UA7 A;  2DL4 A;  2QQB A;  4QVZ A;  5HKC A;  3TCJ A;  4FSX A;  5EC7 A;  2HCK A;  1N9R A;  3CPF A;  4HCC A;  3CCR A;  1WQW A;  3EG9 B;  3MJX A;  1QP3 A;  1MUZ A;  1Z9Z A;  2D8H A;  4HKE A;  1AEY A;  2YUN A;  2YSQ A;  2O4X B;  1KK7 A;  3CPW P;  2IO8 A;  4PJJ A;  2KAF A;  1YCS B;  2CUD A;  1MMA A;  1MHN A;  3BFM A;  5I11 A;  2FO0 A;  3REB B;  3CMA T;  1YIJ A;  3L2W A;  2FZC B;  2RB6 A;  5FU6 C;  1OU9 A;  1WHK A;  2O9S A;  4PJM A;  2HL3 A;  1XNI A;  1B34 A;  3G4S A;  1WJQ A;  3H41 A;  4BD3 A;  1TS9 A;  2K2V A;  4RUG A;  3LWI A;  2JJ9 A;  4M77 F;  5GMK e;  4FGE A;  1G3Y A;  3EH2 A;  1LNX A;  2R5M A;  5CKD A;  2DLP A;  2EW3 A;  3CC2 A;  5GAO q;  4A4F A;  1K73 C;  4GY5 A;  4OMF B;  1W2B A;  1F1B B;  4CSH A;  1HYO A;  2QEX Q;  3M0T A;  2QEX A;  3PIO A;  2JOY A;  3JB9 I;  1MGQ A;  2ECZ A;  5GMK h;  3V8K A;  3VS1 A;  1K8A R;  4M7A G;  2QK0 A;  2LJ3 A;  4E47 A;  3PE0 A;  1Q7Y R;  3L2U A;  1WPY A;  4CI0 C;  3OYC A;  1VQL A;  3V8J A;  5GAM f;  1LVK A;  2EYX A;  2EGC A;  4D6W A;  2CP7 A;  1FMV A;  2E65 A;  1YIJ Q;  2DRK A;  2EQJ A;  2VOB A;  4E7Z A;  5GAN f;  5D6W A;  2WSF E;  1UGR B;  1MMN A;  4E7S A;  3HL8 A;  1OOT A;  4M7A A;  4L59 A;  2YRD A;  2V26 A;  4WF2 A;  4DBR A;  4AG1 C;  2LRQ A;  1M1G A;  3H0F A;  3LW5 E;  1RAC B;  4RTW A;  5L8R E;  4WCI A;  2RHY A;  5D6X A;  2RJE A;  2OTJ T;  2YHT A;  4MZP A;  2GTO A;  4PJL A;  2VV5 A;  1WNL A;  4R0K A;  3JCM V;  3AHU A;  2I0N A;  2NUZ A;  3A8G B;  5M9O A;  4JZ3 A;  1PKT A;  2ZCF B;  2QDL A;  4GLK A;  4KH0 B;  2MOX A;  3P8D A;  1RLP C;  4CC3 A;  1TSF A;  1FXX A;  2EGA A;  1ZSZ B;  2E4H A;  2HZY A;  2JTE A;  4RTY A;  1VQ4 A;  3QUI A;  3GPL A;  5KH6 A;  2O9V A;  4MZM A;  2DNU A;  2LQ8 A;  3JCM f;  1JQQ A;  1BIA A;  5LJ3 j;  1VQM T;  1UHF A;  5I2M A;  2O01 E;  1ZBJ A;  1VQ9 A;  1M1F A;  1M2O A;  2EFI A;  2D9T A;  1ACM B;  3GIB A;  1IGQ A;  1GBQ A;  2RHZ A;  2J6K A;  4E7I A;  4M75 A;  3R6N A;  4J7F A;  2PQW A;  1E7O A;  4KGV B;  4F04 B;  1I0C A;  1M3B A;  4ZTF A;  3UPU A;  1M90 R;  2QGF B;  4X1V A;  1CKB A;  4FYX B;  1YI2 Q;  1BCM A;  2XHC A;  4Y92 A;  2K1G A;  2M1H A;  1K76 A;  1KQ2 A;  2RM4 A;  2QQR A;  4MDW A;  1PSE A;  2EKO A;  2CP5 A;  2LX9 A;  4QVD A;  4XTV A;  1TOV A;  4FW2 A;  3OYM A;  1S1N A;  1WA7 A;  1VA7 A;  3TSZ A;  4NL3 A;  1R77 A;  1YI2 T;  1JXO A;  1NJI C;  1QVF A;  5LJ5 f;  4EQ8 A;  1QW1 A;  3RER A;  4DBF A;  2JXB A;  3QZ9 B;  4OF1 A;  2LQK A;  2AZS A;  4FQA A;  1UE9 A;  3ASK A;  3L2Q A;  2RI5 A;  1ZHI A;  4DEY A;  4PJN A;  1PCX A;  3C95 A;  5HCK A;  2L3Q A;  5FWC A;  1N8R R;  2DA9 A;  1K0S A;  1TG0 A;  1W6X A;  2KR3 A;  3X24 B;  1N9S A;  1Y96 A;  2IO9 A;  4XAX B;  2DFU A;  1QCN A;  2EAY A;  3OS5 A;  2F69 A;  3SWN B;  3OMC A;  3EG9 A;  5CQY A;  4K11 A;  1OU8 A;  1OPL A;  1U06 A;  1WHJ A;  4LJ1 A;  1JXM A;  2JTM A;  3G4S Q;  3MO8 A;  2PVG B;  2W0Z A;  2X4W A;  1XOV A;  2MYS A;  3PMI A;  2ZPI B;  1Q86 R;  4M77 B;  3CD6 T;  3M54 A;  3MEU A;  1WI7 A;  2DBK A;  4J9D A;  4IUP A;  3M0Q A;  3EGX A;  4M77 E;  2AT1 B;  4RTU A;  5GAM g;  3I86 A;  2FYK A;  3LYI A;  2XG8 D;  2ZPH B;  4KUI A;  4BDZ A;  3CC7 T;  4EMH A;  1PD0 A;  5FLX E;  2M9U A;  4FYW B;  3PT9 A;  5CKE A;  1UEC A;  3CC4 Q;  4EMK B;  2EJF A;  3E9G A;  4EMK C;  4DA4 A;  4A54 A;  4RTV A;  1ZSG A;  2DL3 A;  3WVD B;  1VQP T;  2CRE A;  1JJ2 S;  2XD0 A;  2NUT A;  1C0M A;  1SHG A;  4M77 A;  1K9M R;  1M5Q 1;  2DX1 A;  3AT1 B;  2IO7 A;  2GFA A;  4M7D G;  1FMW A;  1PM3 A;  4F7U F;  1G2B A;  4JRI A;  1GFC A;  3I56 T;  3TVT A;  2E5Q A;  3CCR T;  1D3B B;  1G3T A;  3FLG A;  1N8R C;  2J6F A;  1KC8 R;  3A8M B;  1QKW A;  1YN8 A;  3OYG A;  3S3M A;  1SSF A;  1SG5 A;  2DRM A;  2JNG A;  4N4I A;  3GNF B;  1I07 A;  2K3Y A;  2VC8 A;  2ABL A;  2OI3 A;  3MEV A;  4ZTJ A;  2JMA A;  2IPO B;  2E41 A;  1RAD B;  3HP9 A;  4IKF A;  3ZFJ A;  3OYI A;  2JVV A;  2FPD A;  4XTY A;  3C12 A;  4E2F B;  2X3W D;  3O8V A;  2D6F A;  3S3N A;  2OX7 A;  2RK2 A;  2F5T X;  1Q7Y C;  2DYI A;  1NEG A;  2FRW A;  5DLQ E;  5KYY B;  4XU2 A;  4ZGE B;  2OTL Q;  2RQU A;  4E6R A;  1YJW A;  2QA4 T;  1M27 C;  3OQ5 A;  2CGH A;  1VQP A;  1K73 R;  4HCB A;  1WX6 A;  2X35 A;  1M90 U;  1Q82 C;  2CSI A;  4GBQ A;  1M2V A;  2Y90 A;  1X6G A;  3PBI A;  4WTO B;  1S72 Q;  2YLB A;  3FB9 A;  5CCA A;  4HFL A;  2QEX T;  1E6G A;  3DB4 A;  5KCH A;  2LZ6 B;  3GF5 A;  4C92 D;  1VQ5 T;  5J26 A;  2L8D A;  3M4G A;  2KRS A;  1QKX A;  3QDF A;  1NZ9 A;  4JXB A;  5KYW A;  5LL6 S;  3PFS A;  1TU0 B;  1YFN A;  3A8L B;  3GBQ A;  3JCM e;  5GAO r;  1VQ7 A;  1K9M C;  3BDL A;  3QXE B;  2KYM A;  3PVL A;  4XK8 E;  5IXB A;  3DLM A;  1ZA1 B;  3LGF A;  4Z88 A;  1UGS B;  4X9C A;  4LDW A;  4C92 G;  4Q4G X;  4J5Y A;  1VQN T;  6AT1 B;  2JS2 A;  5FU7 B;  4BE1 A;  5KE3 A;  4JRQ A;  1G5V A;  2FEI A;  1QVG A;  1OQK A;  3OYH A;  3VV0 A;  5GJV B;  2V1R A;  4CRI A;  1K73 U;  1QQJ A;  3MPU B;  2LQW A;  4L6V 5;  4RKU E;  2PNI A;  4JS5 A;  1EZZ B;  3OBY A;  1AZG B;  3JCM J;  3PNW C;  2L3S A;  2EIF A;  4E7K A;  1XQH A;  4C8Q G;  1YI2 A;  2RQT A;  3QYG B;  3RKY A;  4MDX A;  5GMK m;  2EPD A;  2JM8 A;  1C1A A;  2VPM A;  4ELZ C;  4M4Z A;  4AFQ C;  2RJF A;  5GAN 5;  4M7D E;  1GCP A;  4B9X A;  2K5I A;  2EQI A;  4DBQ A;  1GBR A;  2P84 A;  3DB3 A;  2PUK B;  2B8A A;  2C0O A;  3GT2 A;  3QZ5 B;  2AK5 A;  2MCN A;  2LJ1 A;  2P4T A;  1PC0 A;  2DD5 A;  5KCO A;  3VKI A;  5HY6 A;  3HRS A;  4C0Z A;  3KUF A;  5CIU A;  4M7A B;  3EGD A;  3EFR A;  2RPN A;  1T3S A;  2DD4 A;  2P0K A;  4Y91 A;  1UGQ B;  3NE0 A;  2QGG A;  3OW2 P;  4FCY A;  5IN1 A;  1SPK A;  1TXQ A;  1M1K U;  4PJO E;  4F0V A;  1VQL T;  3CCL A;  1FYN A;  4UC4 A;  3JCM Q;  3PTA A;  1VQP Q;  3CC7 Q;  2E3H A;  3VS6 A;  2A37 A;  4ELY C;  2O4X A;  2FPE A;  5IHK A;  3VPI A;  1Q86 U;  1VOM A;  4AFS C;  3VS3 A;  1IRE B;  2DEU A;  1ZUY A;  1Y96 B;  5ECA A;  1M1K R;  1G3W A;  1YHQ Q;  5KYY A;  4M7A C;  3RKW A;  1FWZ A;  4D8K A;  2MI6 A;  1AT1 B;  3DKM A;  1VYV A;  1M3A A;  2X3X D;  1B7T A;  4A4E A;  1ABQ A;  1H64 1;  5GAN 2;  3BDU A;  3A8H B;  3CMA A;  2EQM A;  1KFZ A;  2E10 A;  2V8J A;  3QHS A;  1NLO C;  3OYJ A;  2EKH A;  4N0A A;  1O75 A;  2QG9 B;  4X9D A;  3G71 A;  4C5H A;  1MV3 A;  4A53 A;  1R0B G;  1R0C B;  2YLC A;  3MEA A;  3VS0 A;  1IB8 A;  2KVQ G;  1OYX A;  4E7H A;  1WHM A;  4C0F A;  3EAE A;  1SF9 A;  1N5Z A;  4X34 A;  4M7D B;  5GAO p;  5KYX B;  1X69 A;  1U8R A;  2F5K A;  5FRO A;  2DPP B;  1K9A A;  2FPF A;  2GGR A;  1KD1 R;  1QVF S;  3DLL A;  1QCF A;  2FVU A;  1WIE A;  1Z9Q A;  2DXC A;  3A2Y A;  1AWW A;  3CD6 A;  2ZGW A;  1YJ9 T;  3PMT A;  4XTX A;  2COY A;  2P4R A;  3HHT B;  4M78 E;  3ER0 A;  2EJG A;  2HSP A;  2LTO A;  3LX7 A;  3EG3 A;  4RTT A;  3CME Q;  3GLX A;  5I2S A;  3L42 A;  1VUB A;  3NMZ C;  1AWX A;  1UG1 A;  3MP1 A;  4BI4 A;  1N6A A;  2DXU A;  4M7A D;  2FB7 A;  2ZPE B;  3EFO A;  5DY9 A;  3HFO A;  2EGE A;  1K0X A;  3BY7 A;  1AHJ B;  4ORZ A;  1BI3 A;  4CT3 A;  2KMT A;  1TTH B;  4F7U B;  4HT8 A;  2XDP A;  2E6Z A;  3TSW A;  3CCE Q;  2WAC A;  1RAF B;  2NLU A;  1VQK Q;  1OUL A;  3VYH B;  1VQO Q;  5A2Q E;  2C0T A;  4Z89 A;  4HZB A;  2ZZD A;  2O88 A;  4DOV A;  1YJ9 A;  2Y4Y A;  4A63 B;  2YRC A;  3M58 A;  1Y7X A;  4Z02 A;  4J30 A;  2LNV A;  1UUE A;  2L2P A;  2X9H A;  1G8X A;  2LJ0 A;  4OMM A;  4PLI A;  1FMK A;  4C92 F;  1KHI A;  4BE0 A;  4C5G A;  2P0Q A;  2MF2 A;  4F17 A;  4E7J A;  2CZ7 B;  4JLI A;  4QQG A;  1D3B A;  4AMC A;  4HVV A;  5LJ3 e;  2KBT A;  4OMQ A;  2JN0 A;  2F1L A;  2F2X A;  3EHQ A;  4KGX B;  3EH1 A;  4KUD K;  1Y71 A;  1BYM A;  5I21 A;  2EVR A;  4J6X A;  5GAN 7;  1QCO A;  5GAN g;  4LDY A;  5FU6 B;  2JS0 A;  5CKF A;  4M78 A;  3PGG A;  4IUR A;  3FC3 A;  5IH2 A;  3UA6 A;  2XK0 A;  1AZE A;  1GCQ C;  1B3Q A;  1RI9 A;  3JCM g;  3D7S B;  2LCC A;  1WLP B;  2LCL A;  1KC8 U;  1ZA2 B;  1QWE A;  2YDL A;  1ZLM A;  2DTO A;  3A1P A;  4BY6 B;  3FRN A;  4PL6 A;  5KYU A;  1VQK A;  2BZ8 A;  1M4Z A;  1OV3 A;  2HL5 C;  1BK2 A;  3I5S A;  5GAN 8;  1I81 A;  4HFK A;  1M9S A;  1RUW A;  1RAB B;  1YBY A;  4C92 B;  3TEE A;  1SRM A;  3CCS Q;  1EX4 A;  1W2B P;  4FT4 A;  4J9F A;  3OYN A;  4FW1 A;  1D0X A;  2PTK A;  1WYX A;  4OB2 B;  3M59 A;  3CCU A;  1DJ7 B;  2QTV A;  2O31 A;  3A8O B;  2KQW A;  3CBO A;  3INZ A;  5DLO A;  3CCL T;  3MKD A;  5LJ3 f;  3REA B;  2RO0 A;  3VU3 C;  1LOJ A;  2QA4 Q;  4M77 G;  2HQH A;  3CCJ T;  3EBQ A;  4C8Q C;  4FIB A;  1VQM A;  4TVR A;  4YTL A;  1I8F A;  2KT1 A;  4J9I A;  3JCM P;  2E70 A;  3I35 A;  4EMG A;  3VRZ A;  2EJ9 A;  2DVE A;  2CT3 A;  3OY9 A;  1K9M U;  2X4Y A;  1KJW A;  3V8L A;  2M16 A;  3EG0 A;  2DBM A;  4RCB A;  4A4H A;  4IIM A;  2BZX A;  4C5E A;  2DET A;  2KE9 A;  4O6J A;  2HQE A;  3VYG A;  1VQ5 Q;  1UTI A;  2CYZ B;  4F7U G;  2IF6 A;  3CC7 A;  4M7D F;  5A0L A;  5GAN e;  1BBZ A;  3CCQ T;  2HQX A;  2RF0 A;  1PHT A;  2RQV A;  4XU3 A;  2RHI A;  3CCS A;  4BE2 A;  2DTI A;  3CC2 Q;  3HPW A;  4IUV A;  1WHL A;  2KXC A;  3MEW A;  2OAU A;  4KRT A;  4J9C A;  1QVG S;  3CXC S;  4BAC A;  2MIO A;  3L2Z A;  4HFF A;  1YWO A;  2PUO B;  3BE3 A;  3JRZ A;  3THK A;  3LH5 A;  5GAN h;  1WXB A;  2DL7 A;  2FZG B;  1QVG P;  1PKS A;  2DM1 A;  2OTL T;  4J6Y A;  3GNG A;  1T0H A;  2BZY A;  2RI3 A;  1T0J A;  2E6N A;  5J39 A;  3C94 A;  4QW2 A;  3T9N A;  2JZ2 A;  3ZBD A;  4Z8A A;  3H0H A;  3MP6 A;  3CEY A;  1WXU A;  1NPR A;  2VWF A;  2VXE A;  3OYE A;  3E2U A;  2JTF A;  2XID A;  4DBH A;  2KK4 A;  2I2L A;  4C0D B;  3BW1 A;  1IGU A;  3ZEH A;  2QXF A;  2PVO B;  3FDR A;  5HK0 A;  2C06 A;  2DZ9 A;  5CKH A;  2DK3 A;  3QG1 A;  5CO7 A;  3SHW A;  3CCQ A;  2EYW A;  2QYZ A;  2BIV A;  4F16 A;  2E1H A;  1YP5 A;  3I55 A;  2ROL A;  4LUD A;  4MMK A;  3G4S T;  3CCM A;  4XU0 A;  1HXD A;  5J3B A;  3OYD A;  2FRY A;  2K3B A;  1D0Y A;  2M51 A;  1Q81 C;  1M8V A;  3JB9 J;  2A0F B;  2H8H A;  2K9G A;  2RHU A;  1RAH B;  2KT8 A;  3CXC A;  2E3I A;  2YWW A;  2FHD A;  2J06 A;  1WJS A;  1KD1 U;  3CCJ A;  1WQ7 A;  2A7Y A;  4ZGD B;  1VQ9 T;  1S72 A;  3NTH A;  3H9N A;  3CME T;  1M3C A;  3OYA A;  3KW0 A;  5GAN 6;  1I1J A;  2DXB A;  2HSE B;  1ZSZ A;  1QLY A;  3NPF A;  3JB9 H;  3EFO B;  5LJ5 h;  3NHN A;  1IRX A;  1PNJ A;  3L1A A;  4EMK A;  1RI0 A;  4OMN A;  4OB3 B;  1ZSZ C;  3FIF A;  2HBW A;  4M75 D;  4Y28 E;  2ED1 A;  3OSS C;  4BI8 B;  1U3O A;  3CD6 Q;  1IHV A;  2YT6 A;  2CH4 W;  5DM7 R;  1Q82 R;  1VQ5 A;  2XIC A;  3CCV A;  3QO3 A;  1NPP A;  1R8O B;  3CCE T;  1NYG A;  4PFP A;  2CT4 A;  2KY9 A;  1G83 A;  2V8I A;  4IUT A;  1UGP B;  2L3P A;  4F7U E;  1VQ6 Q;  3JB9 G;  2KDS A;  1MND A;  1IO6 A;  5FW9 A;  5IHN A;  5KYX A;  4Q4N A;  1AWJ A;  2XDB A;  3KBG A;  3WXM B;  1K8A C;  1X01 A;  2ZPG B;  3J81 E;  3M9Q A;  2E12 A;  1VYU A;  4R56 A;  2VGN A;  1QP2 A;  2K3A A;  4C92 A;  4QVC A;  3E1S A;  5LJ3 h;  1G3S A;  1TUC A;  3TRE A;  1WFW A;  1VQN Q;  1TH7 A;  3RMQ A;  3X26 B;  1VIE A;  1RAE B;  4PJO D;  1MV0 B;  1X27 A;  1PRL C;  2XKO C;  4OP0 A;  4FU6 A;  1UEB A;  4XTW A;  3VRY A;  4J8O A;  1NE8 A;  4RCC A;  1TWB A;  2DJQ A;  4HVU A;  1VQ8 Q;  4KUL A;  4OB0 B;  1V29 B;  2HKN A;  2R57 A;  2RA2 A;  2D0Q B;  4C92 C;  2KRM A;  5HK3 A;  3CCM Q;  5KYN A;  1B34 B;  2JM9 A;  4LD6 A;  2E64 A;  3RBB B;  4OB1 B;  5GMK i;  1VQL Q;  1A0N B;  2H3J A;  2V1Q A;  1Q81 R;  1VQM Q;  3JAM E;  4N4H A;  3EG2 A;  1JO8 A;  1S72 T;  4J9B A;  3LWH A;  1AWO A;  2LVM A;  3M4Y A;  2BUD A;  1NEB A;  3JCM b;  2NUP B;  2DE0 X;  2LP5 A;  4FT2 A;  3VS2 A;  4PJO A;  2DYB A;  2AZV A;  3ULR B;  3GP8 A;  4BDY A;  1OZ2 A;  4OMO A;  3JB9 D;  2B86 A;  3CCJ Q;  1D1A A;  4C8Q D;  2DMO A;  4RMO A;  2HEQ A;  2GNC A;  4PJO C;  1OX8 A;  3HRU A;  1RLQ C;  4C8Q E;  3I55 T;  3JCM d;  2GBQ A;  4OGC A;  5LJ3 d;  4ESR A;  4LUE A;  3OMG A;  2CSQ A;  2HKQ B;  4JJN K;  1MMD A;  4LNP A;  3EFS A;  4HCZ A;  3QWY A;  1M8M A;  3OYK A;  1GXI E;  3I55 Q;  4Q5W A;  4D8D A;  1H3Z A;  1X2Q A;  1V76 A;  5AT1 B;  1ZBX A;  4ANJ A;  2VKN A;  4JRK A;  1GL5 A;  3UDC A;  2ENM A;  4C8Q A;  2FG0 A;  4MML A;  2J6O A;  2QAS A;  4M7A F;  3SFM A;  2GTJ A;  4GLM A;  4JUV A;  2KRN A;  4OML A;  4MZT A;  4HCK A;  5GAO m;  4M7D A;  1WDX A;  2XU8 A;  4CC7 A;  2X51 A;  4BUG A;  2G6F X;  3I56 Q;  1YNZ A;  3SWN C;  1KQS A;  2ED0 A;  3H6Z A;  3SD4 A;  2M0Y A;  3CCU T;  4NOY A;  1UJY A;  2EWN A;  1KQ1 A;  1N8R U;  1AOJ A;  1BIB A;  2HBP A;  4LD9 K;  2K2M A;  2LT1 A;  1GRI A;  3CBP A;  3NTI A;  3M1U A;  3CC4 T;  1D09 B;  4ZN3 A;  3OW2 S;  3PIP A;  1YJ9 Q;  1NLP C;  4V2S A;  3TQ7 P;  5GJW B;  2K4Y A;  3IQL A;  2FL7 A;  5LJ5 d;  2RHX A;  1VQ4 Q;  2RQR A;  1JJ2 A;  2ZPF B;  2X4X A;  1RAI B;  1H92 A;  2AKL A;  4AFZ C;  3G6E T;  2R5A A;  1WXT A;  3CXC P;  4M7D C;  2DO3 A;  1VQO T;  2A28 A;  2R58 A;  3OYB A;  3G71 Q;  3Q1J A;  4JJC A;  5FU7 C;  1KC8 C;  1I4K 1;  4M75 E;  1OPK A;  5FRN A;  2OTL A;  1PRM C;  2EQK A;  3M0U A;  4BI3 A;  2GQV A;  3CQT A;  1VQ6 T;  5FRM A;  4FDY A;  3HFN A;  3M56 A;  4XU1 A;  4JS4 A;  5CK9 A;  5GAM d;  2L3R A;  3OB9 A;  3RUX A;  1OI1 A;  2DEQ A;  2CS7 A;  2K3X A;  3EGD B;  2MWO A;  2QQ9 A;  1C6V X;  2JW4 A;  1VQ8 T;  4JPB W;  4NS5 A;  1SHF A;  2HDA A;  4EDU A;  3A5Z B;  1V1C A;  1NBE B;  1NJI R;  2DIG A;  2PU9 B;  1YJN T;  1K4U S;  2RJD A;  3CCR Q;  2VAS A;  4ZNX A;  5LJ5 g;  5GAN 3;  1Q7Y U;  3NTK A;  2QDY B;  2SRC A;  1W2B S;  3RDV A;  2IOA A;  1SEM A;  4KT0 E;  1P92 A;  1QVP A;  1M90 C;  3JV3 A;  3RES A;  3M57 A;  3OS0 A;  1OX9 A;  1U1T A;  1H8K A;  4KH1 B;  1X75 C;  1LCK A;  2QI2 A;  2QAZ A;  4EIK A;  1VQN A;  1VYT A;  4HVW A;  1GCQ A;  1HD3 A;  2DKG A;  2HD0 A;  2COZ A;  2XMF A;  1WHG A;  2DAQ A;  3CBM A;  4DQ2 A;  2NUT B;  2LNH B;  1BI1 A;  1BU1 A;  3CCV T;  1W1F A;  3P8H A;  1M30 A;  5CVI A;  3J7A F;  2QQA A;  1YHQ A;  4CGK A;  4J9E A;  2NWM A;  3RMS A;  4P5N A;  3NGP A;  5GMK l;  4M78 F;  3M5A A;  2LMJ A;  1VQK T;  3QYH B;  2K6D A;  2RJC A;  3JB9 F;  2OTJ A;  1YHQ T;  2KRO A;  2D8J A;  5GAN 4;  4PFO A;  3OYY A;  3RIR A;  4PFZ A;  2COW A;  1JBM A;  3I56 A;  3L2R A;  3OYL A;  3QJ6 A;  3PBC A;  4OGE A;  2W10 A;  1VQ9 Q;  1RAA B;  3O5Z A;  2K7A A;  4C0G A;  3HKS A;  2CKK A;  4A4K A;  3UAT A;  2VPS A;  4J32 A;  3RKX A;  2XDD A;  1YCY A;  4F0W A;  4M7A E;  1EIF A;  3U23 A;  4B6M A;  2HMA A;  3E9F A;  4J83 A;  2A3L A;  1VQ7 T;  3SDZ A;  1Q86 C;  1KD1 C;  3R6O A;  5GAO n;  3G6E Q;  2WSC E;  1RAG B;  3M0P A;  2C0I A;  2CP0 A;  2VVK A;  2XIV A;  1Y07 A;  4JRP A;  4L5G A;  2VGM A;  2EYQ A;  2VYT A;  3F70 A;  3QSU A;  2F2W A;  1SKU B;  2IVW A;  4BB7 A;  3S0Q A;  5KE2 A;  4LN2 A;  1AD5 A;  3UWN A;  1YIT T;  3QII A;  1LJO A;  2YUQ A;  1YJW Q;  3KXT A;  2K5F A;  2KYB A;  1UB4 A;  2VXF A;  3MHX A;  9ATC B;  1Y57 A;  1ZX6 A;  2JT4 A;  4A4G A;  1TUG B;  2GFU A;  1QVF P;  3G71 T;  5GAO l;  4BY6 C;  3JCM h;  2K79 A;  4FM4 B;  4OLK A;  1NG2 A;  3KFV A;  4IIO A;  3C4S A;  3EGX B;  4QQ6 A;  4NL2 A;  1VQ4 T;  3EGU A;  4M78 C;  1OEB A;  1W70 A;  3CCE A;  3X25 B;  4C8Q F;  4ATO A;  4XTZ A;  1M1K C;  3N5B B;  2CP3 A;  1H3H A;  3VS4 A;  2CUB A;  2CH4 A;  3OA6 A;  2SEM A;  3G7Z A;  4AT1 B;  3I5R A;  1YJN A;  1KG1 A;  3O98 A;  2DER A;  1MNE A;  2RD1 A;  3V7S A;  3L2V A;  2NUP A;  1JJ2 P;  2AIR B;  5IAY A;  2OTJ Q;  2MWP A;  1Y0M A;  2IG0 A;  2LC4 A;  3ME9 A;  3OW2 A;  7AT1 B;  2PZ1 A;  2BE9 B;  4ZGJ B;  3OS1 A;  1T3L A;  4LE9 A;  1NJI U;  5KYU B;  2X4J A;  2E5K A;  1JU5 C;  2A08 A;  2EBP A;  2QTX A;  1XTD A;  3X20 B;  2H3E B;  2JUF A;  4ME7 A;  3CME A;  5EG2 A;  2DL5 A;  4JUR A;  4RTX A;  2CZ6 B;  2EQU A;  5CKB A;  2A36 A;  2DF6 A;  2VUB A;  2AHJ B;  3OYF A;  2QA4 A;  5C0M A;  2LT4 A;  2KXD A;  1PG5 B;  4FGD A;  2WP7 A;  4KBM B;  4LDV A;  4C92 E;  5GAN d;  4PLL A;  2DIQ A;  8AT1 B;  3SB2 A;  1EFN A;  1IHW A;  5KYW B;  1QMC A;  3PVQ A;  1D1C A;  3CCL Q;  2GCX A;  3NFC A;  4J7I A;  1PD1 A;  1ZQ1 A;  3EG1 A;  1ABO A;  2KGT A;  2Y4X A;  4AFU C;  3VS7 A;  1KSW A;  4ZN1 A;  1U1S A;  2CDT A;  4M7D D;  5CQX A;  4F14 A;  2KI7 A;  1WHH A;  3S6W A;  1JRI A;  4LDX A;  3J80 E;  1WGS A;  2K5L A;  3WVE B;  3SWN A;  3GOX A;  4QKU A;  3CCU Q;  5GAM e;  4EPC A;  2RQW A;  4F7U A;  1HJD A;  2DJZ A;  3CMA Q;  5A0G A;  2M02 A;  4AG2 C;  4M78 D;  1VQ6 A;  4IUU A;  4O5V A;  2DZC A;  3A98 A;  3QWX X;  1YIJ T;  1JEG A;  3QDR B;  2J05 A;  1CKA A;  4XTU A;  2D0N A;  2CZ0 B;  3JSC A;  3URG A;  4CC2 A;  4PKC C;  1SRL A;  2D1X A;  4JDS A;  3FJ5 A;  2L89 A;  1ZUK A;  1UJ0 A;  4HPE A;  4DEX A;  2L0A A;  2NYS A;  3HSB A;  3CCM T;  2HNI A;  2YRV A;  1NYF A;  3FEO A;  3G6E A;  2K57 A;  3A2Z A;  1X2K A;  2IOB A;  2IIM A;  2LCS A;  1X43 A;  1D1B A;  1K1Z A;  4RTZ A;  1I5L A;  3LLR A;  5L23 A;  1U5S A;  2RN8 A;  4PJO B;  2DVJ A;  1VQ8 A;  2MPX C;  3M0S A;  3LH0 A;  4J6W A;  4OMP A;  4M75 B;  1UFF A;  3MCA B;  4M75 C;  3I9Q A;  1XJW B;  2GF7 A;  2P0P A;  3E19 A;  2BKD N;  3VPJ A;  1WJR A;  5LJ5 e;  4N0A C;  4EQA A;  1X6B A;  1Q95 G;  1B07 A;  4HXJ A;  1QWF A;  1D0Z A;  4C0D C; 
#chains in the Genus database with same CATH homology
 2K2M A;  4JZ4 A;  1XOV A;  1GRI A;  2J7I A;  2EVR A;  3M1U A;  2JS0 A;  4Q4T A;  4FSS A;  1NLP C;  1WI7 A;  2DBK A;  4J9D A;  5IH2 A;  3UA6 A;  3M0Q A;  5GJW B;  1AZE A;  1GCQ C;  3IQL A;  1B3Q A;  1J3T A;  4RTU A;  1RI9 A;  3I86 A;  5IHI A;  2ROT A;  1WLP B;  2RQR A;  4EOB A;  1UGV A;  3H0I A;  2LQN A;  2YDL A;  1QWE A;  2AKL A;  1ZLM A;  1UEC A;  4AFZ C;  1H92 A;  2YUO A;  1WXT A;  2AKK A;  1TUD A;  2A28 A;  2F2V A;  4RTV A;  1ZSG A;  1HSQ A;  2DL3 A;  4JJC A;  2CRE A;  4JJB A;  2BZ8 A;  1OV3 A;  1BK2 A;  3I5S A;  1SHG A;  1OPK A;  4F4M A;  1RUW A;  3ZL7 C;  2DX1 A;  2IO7 A;  1UHC A;  3SEM A;  1PRM C;  3M0U A;  1SRM A;  3CQT A;  4J9F A;  4FDY A;  2LX7 A;  1G2B A;  2PTK A;  1GFC A;  2YUP A;  1WYX A;  3TVT A;  1KIK A;  2J6F A;  3C0C A;  2O31 A;  3REA B;  5I22 A;  1QKW A;  1YN8 A;  2JW4 A;  4JPB W;  1SHF A;  2HDA A;  1BB9 A;  1V1C A;  2OAW A;  2KT1 A;  2GQI A;  2DRM A;  4J9I A;  1K4U S;  3I35 A;  5IXF A;  1I07 A;  1PWT A;  3VRZ A;  2KEA A;  2OI3 A;  2ABL A;  2JMC A;  2CT3 A;  3RNJ A;  4ZNX A;  2JMA A;  3A30 A;  4J9H A;  1KJW A;  1YWP A;  3EG0 A;  2DBM A;  4IIM A;  2FPD A;  2BZX A;  2SRC A;  2KE9 A;  2X3W D;  1UTI A;  2IOA A;  2IF6 A;  1SEM A;  4FQB A;  1BBZ A;  2RF0 A;  1NEG A;  1PHT A;  2RQV A;  2DL8 A;  2RNA A;  3JV3 A;  2FRW A;  1H8K A;  2BTT A;  2KXC A;  2RQU A;  4E6R A;  1LCK A;  4KRT A;  1M27 C;  1ZUU A;  4J9C A;  4EIK A;  1VYT A;  1WX6 A;  1GCQ A;  1HD3 A;  2MIO A;  4HVW A;  2CSI A;  4GBQ A;  2KNB B;  3EHR A;  4CC4 B;  1X6G A;  3PBI A;  2XMF A;  4FGI A;  1YWO A;  2LNH B;  3THK A;  1BU1 A;  1E6G A;  3LH5 A;  1W1F A;  1M30 A;  1WXB A;  2LZ6 B;  2DL7 A;  2O2O A;  1GFD A;  4CGK A;  2ESW A;  4J9E A;  1NM7 A;  2NWM A;  1PKS A;  2DM1 A;  3NGP A;  4J9G A;  2KRS A;  1QKX A;  2LMJ A;  1T0H A;  2BZY A;  1E6H A;  1T0J A;  1SSH A;  4JXB A;  2K6D A;  2KRO A;  2D8J A;  3GBQ A;  3M0R A;  2RMO A;  4Z8A A;  3H0H A;  4HZ9 A;  2KYM A;  3PVL A;  1WXU A;  2OJ2 A;  2VWF A;  2LRJ A;  5IXB A;  1ARK A;  4Z88 A;  1CSK A;  2EYZ A;  3PBC A;  5FWB A;  3VS5 A;  1AVZ C;  2W10 A;  3O5Z A;  4Q4G X;  1UDL A;  2K7A A;  2JS2 A;  2DIL A;  2FEI A;  3UF4 A;  2EYY A;  3UAT A;  5GJV B;  2VPS A;  2V1R A;  4F0W A;  4QT7 A;  4JJD A;  3SHW A;  3U23 A;  2EYW A;  3UA7 A;  2DL4 A;  2LQW A;  4F16 A;  1YP5 A;  2ROL A;  2PNI A;  4LUD A;  5EC7 A;  2HCK A;  1AZG B;  2FRY A;  2K3B A;  2L3S A;  2RQT A;  2M51 A;  1MUZ A;  3M0P A;  2C0I A;  2VVK A;  2XIV A;  1Z9Z A;  2D8H A;  1AEY A;  2YUN A;  2YSQ A;  2EPD A;  2JM8 A;  2H8H A;  2K9G A;  2VPM A;  2KT8 A;  2IO8 A;  4M4Z A;  4AFQ C;  2J06 A;  2F2W A;  1YCS B;  2CUD A;  3S0Q A;  1GCP A;  4LN2 A;  2EQI A;  5I11 A;  2FO0 A;  1AD5 A;  3REB B;  1GBR A;  1M3C A;  3GT2 A;  2C0O A;  2AK5 A;  2MCN A;  2O9S A;  2LJ1 A;  3KW0 A;  1I1J A;  2YUQ A;  1QLY A;  3NPF A;  3H41 A;  3NHN A;  2KYB A;  1PNJ A;  4RUG A;  1Y57 A;  4FGE A;  2RPN A;  4OMN A;  1T3S A;  1ZX6 A;  2JT4 A;  2HBW A;  2ED1 A;  4OLK A;  2K79 A;  1U3O A;  3NE0 A;  1NG2 A;  2YT6 A;  2CH4 W;  2DLP A;  2EW3 A;  3KFV A;  1SPK A;  4IIO A;  4F0V A;  4CSH A;  1FYN A;  3M0T A;  2ECZ A;  3EGU A;  3VS1 A;  1OEB A;  1W70 A;  3VS6 A;  2A37 A;  1NYG A;  2CT4 A;  2LJ3 A;  2FPE A;  1G83 A;  3PE0 A;  5IHK A;  3VPI A;  1H3H A;  2L3P A;  3VS4 A;  2CUB A;  2CH4 A;  2SEM A;  4AFS C;  1IO6 A;  5FW9 A;  5IHN A;  3VS3 A;  3I5R A;  4Q4N A;  1ZUY A;  1AWJ A;  5ECA A;  3O98 A;  2EYX A;  2EGC A;  2DRK A;  2VOB A;  1VYU A;  4D8K A;  1Y0M A;  1OOT A;  2K3A A;  2PZ1 A;  1T3L A;  4LE9 A;  1VYV A;  1TUC A;  4AG1 C;  1M3A A;  2X3X D;  3H0F A;  4RTW A;  1WFW A;  1ABQ A;  2E5K A;  1JU5 C;  2A08 A;  2EBP A;  4WCI A;  2DL5 A;  1MV0 B;  1X27 A;  4RTX A;  1PRL C;  1KFZ A;  2GTO A;  2A36 A;  2DF6 A;  1NLO C;  4R0K A;  2EKH A;  3VRY A;  2I0N A;  2NUZ A;  2KXD A;  2DJQ A;  4FGD A;  4JZ3 A;  1PKT A;  1MV3 A;  4HVU A;  2QDL A;  2MOX A;  1RLP C;  4CC3 A;  2KRM A;  1EFN A;  3VS0 A;  2EGA A;  3PVQ A;  2JM9 A;  2JTE A;  4RTY A;  3RBB B;  3EG1 A;  1A0N B;  1ABO A;  2V1Q A;  2O9V A;  1N5Z A;  2KGT A;  2DNU A;  4AFU C;  3VS7 A;  1KSW A;  1X69 A;  1JQQ A;  3EG2 A;  1JO8 A;  2CDT A;  1UHF A;  1K9A A;  1ZBJ A;  2FPF A;  2GGR A;  4J9B A;  4F14 A;  1AWO A;  1NEB A;  1QCF A;  2DE0 X;  2LP5 A;  1WIE A;  1Z9Q A;  3VS2 A;  3A2Y A;  2DYB A;  2AZV A;  3ULR B;  1AWW A;  1GBQ A;  4OMO A;  2J6K A;  2B86 A;  3R6N A;  2P4R A;  1E7O A;  2HSP A;  2DMO A;  1I0C A;  1M3B A;  2RQW A;  1HJD A;  3EG3 A;  4RTT A;  2HEQ A;  2GNC A;  4AG2 C;  4X1V A;  1CKB A;  3NMZ C;  1RLQ C;  1AWX A;  1UG1 A;  4Y92 A;  2GBQ A;  3A98 A;  3QWX X;  1JEG A;  2K1G A;  2J05 A;  1CKA A;  1K76 A;  4ESR A;  2D0N A;  4LUE A;  2EGE A;  4CC2 A;  1K0X A;  2CSQ A;  1SRL A;  2D1X A;  4ORZ A;  4LNP A;  3FJ5 A;  1S1N A;  4CT3 A;  1WA7 A;  1ZUK A;  1VA7 A;  1M8M A;  3QWY A;  3TSZ A;  1UJ0 A;  3TSW A;  1JXO A;  4HPE A;  4D8D A;  4DEX A;  2L0A A;  1X2Q A;  4EQ8 A;  2VKN A;  1GL5 A;  2ENM A;  2FG0 A;  2J6O A;  1NYF A;  3A2Z A;  1X2K A;  2C0T A;  2JXB A;  4Z89 A;  2IOB A;  4HZB A;  2GTJ A;  2IIM A;  2AZS A;  4GLM A;  2LCS A;  4FQA A;  1X43 A;  1UE9 A;  2KRN A;  2O88 A;  4OML A;  1K1Z A;  4RTZ A;  4DEY A;  4HCK A;  5HCK A;  4A63 B;  2L3Q A;  5FWC A;  1WDX A;  2DA9 A;  1K0S A;  1TG0 A;  1W6X A;  1U5S A;  2KR3 A;  2RN8 A;  4CC7 A;  5L23 A;  1UUE A;  2L2P A;  2DVJ A;  2G6F X;  3M0S A;  4OMP A;  2IO9 A;  2LJ0 A;  4OMM A;  1FMK A;  1UFF A;  1YNZ A;  4F17 A;  3I9Q A;  2ED0 A;  4K11 A;  4HVV A;  2M0Y A;  1OPL A;  2KBT A;  3VPJ A;  1U06 A;  4OMQ A;  4LJ1 A;  1UJY A;  1JXM A;  4EQA A;  1X6B A;  1B07 A;  2F2X A;  1AOJ A;  3EHQ A;  4HXJ A;  1QWF A;  2W0Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...