2FG0A

Crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
222
structure length
222
Chain Sequence
KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTSQKATHVGLYLADGYYIHSSGKDQGRDGIGIDILSEQGDAVSLSYYQQLRGAGRVFKSYEPQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords COG0791: Cell wall-associated hydrolases (invasion-associate
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Nostoc punctiforme
total genus 65
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fg0A01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2fg0A02
2DX1A 1AVZC 1QWEA 3NPFA 3VS7A 2HCKA 4F16A 4JZ4A 4EOBA 2RQUA 2X3WD 4IIMA 3ULRB 3PBCA 4F0WA 4RUGA 2GGRA 4D8KA 4E6RA 3THKA 2RF0A 3NHNA 3O5ZA 3H41A 4RTXA 1VYTA 2DF6A 3QWYA 1W70A 1E6HA 4HPEA 2SEMA 4RTTA 1I07A 4AFZC 1X6GA 2ROLA 3PVLA 4WCIA 4F0VA 2C0IA 2LRJA 4LN2A 4JJBA 1QCFA 2GQIA 3M0SA 2JS0A 2KXDA 1WX6A 2ECZA 3GBQA 2W10A 1OOTA 2EVRA 1UUEA 1NEBA 4FGDA 2EQIA 1UTIA 2GTJA 3IQLA 1X43A 4F4MA 4IIOA 2F2VA 3VRYA 2DBKA 5FWBA 2FG0A 4CC7A 1X69A 2MIOA 1JXOA 1UE9A 3CQTA 4K11A 3PE0A 3I5RA 5L23A 1SHGA 1GCQC 2RQVA 2DL5A 2C0OA 3H0FA 3TSWA 1WLPB 1TUDA 1XOVA 2A36A 4J9HA 2A37A 2G6FX 2LMJA 2DA9A 1J3TA 2IIMA 1FYNA 1VYUA 1V1CA 2JS2A 1SSHA 4OMOA 2RN8A 4KRTA 1AWOA 2KXCA 1TUCA 1A0NB 5HCKA 2LZ6B 2PZ1A 1K0XA 2CSQA 1PKSA 2DL8A 3M0QA 3LH5A 3VS6A 4EQAA 4AG1C 2QDLA 1QKXA 5IHIA 1KJWA 4GBQA 1FMKA 2XMFA 2DRMA 4JZ3A 4OMMA 4A63B 4OMQA 1QKWA 1UG1A 2DYBA 1WA7A 2V1RA 2FEIA 2YUPA 4OLKA 1M3AA 5FW9A 3QWXX 1WXBA 1HJDA 3VPIA 2EYXA 2LX7A 2FPFA 4HVWA 2DVJA 2YUNA 2EW3A 3EG2A 4R0KA 2FRWA 1KIKA 1K0SA 3ZL7C 2L3QA 4HVVA 2D8HA 2YDLA 3I9QA 2HEQA 4OMNA 1UGVA 1ZUUA 2KYMA 1MV0B 2CUBA 2DILA 4F14A 2IF6A 1K9AA 3I35A 2DM1A 2PNIA 2YSQA 2ABLA 1GL5A 1MUZA 2O31A 2AKLA 2ESWA 2OJ2A 1NEGA 2P4RA 2JTEA 2K79A 5I22A 5IH2A 1BU1A 2ED1A 4J9BA 1I1JA 2DL7A 2ED0A 1UHFA 2CH4A 4HVUA 4FQAA 3S0QA 1YNZA 1ZLMA 4AG2C 4J9DA 1K4US 1PHTA 3EHRA 2CH4W 2J6KA 4LNPA 1UECA 1X27A 1JO8A 2IO8A 2GBQA 1K76A 2FPEA 1YP5A 2O9SA 3NGPA 5FWCA 3NMZC 1CKBA 1WXUA 2SRCA 4CSHA 1BK2A 2VPMA 2ROTA 1ARKA 2X3XD 1M8MA 4ESRA 1HD3A 4CGKA 2K7AA 2OAWA 1RI9A 4LJ1A 1G83A 2L0AA 2DBMA 4X1VA 2KBTA 1X2KA 1UHCA 1RLQC 2CUDA 1M27C 2NUZA 2JMCA 2A08A 2BZXA 2J7IA 4OMPA 1K1ZA 5GJVB 1UDLA 1OV3A 1U3OA 2LJ1A 1UJYA 2J05A 2KR3A 4JJDA 4QT7A 4RTVA 3UA7A 1PRLC 2YUQA 3VS1A 1U06A 1SHFA 2LJ3A 1E6GA 2LQWA 1H92A 2J6FA 3RNJA 2VOBA 1YWPA 2RPNA 4JXBA 4HCKA 3FJ5A 2H8HA 4D8DA 2O9VA 1PWTA 1YWOA 2IOBA 2AZVA 2IO7A 2KT1A 1W6XA 2DE0X 4ORZA 2JM9A 2KROA 1Z9ZA 2M51A 1UFFA 1T3SA 3EHQA 3A2ZA 1Y0MA 1E7OA 1CKAA 3I86A 3EGUA 2K6DA 3O98A 2DJQA 1G2BA 4Q4TA 3A98A 1NYFA 4DEXA 1GCPA 4J9IA 2GTOA 1T3LA 4AFQC 1ZSGA 4M4ZA 4JJCA 3EG1A 3EG0A 2LCSA 4LE9A 1M30A 3M0PA 2BZYA 1OEBA 1Y57A 1JEGA 2JW4A 1SRMA 2VWFA 1BB9A 2KRNA 1QWFA 3C0CA 2AZSA 4HZ9A 1JXMA 2D8JA 2E5KA 2BTTA 2K3AA 3M1UA 1RUWA 3SEMA 2MCNA 1PKTA 3PVQA 3H0HA 1VYVA 2DMOA 2RQTA 1W1FA 3TSZA 3UA6A 1WI7A 1U5SA 3GT2A 2L3PA 5IHKA 3VS0A 3VS5A 1OPLA 1N5ZA 2JXBA 2AKKA 1AWWA 2AK5A 2VKNA 2CT3A 4AFSC 1MV3A 1T0HA 1YCSB 1I0CA 4Z88A 3H0IA 1GFCA 2CSIA 1H3HA 3A30A 2HDAA 3VS2A 1JU5C 4Y92A 2DLPA 2A28A 4OMLA 2KNBB 5IXFA 2DNUA 1NG2A 1M3BA 3I5SA 1AOJA 2K1GA 2IO9A 1NLOC 2HBWA 4F17A 2HSPA 1VA7A 2MOXA 3EG3A 3KW0A 2K2MA 2RMOA 4GLMA 1GRIA 2PTKA 5GJWB 3A2YA 2K3BA 4CC2A 1KFZA 2F2XA 1ZUYA 2KT8A 2L2PA 4RTYA 2O88A 3SHWA 3VRZA 2YUOA 2NWMA 2KEAA 4RTWA 1RLPC 4RTZA 1UJ0A 4EIKA 1Z9QA 3RBBB 2V1QA 1AWXA 1KSWA 1GBRA 2VPSA 3VS4A 1TG0A 5I11A 1WFWA 2KE9A 2LP5A 2VVKA 1PRMC 2EYWA 4J9CA 1H8KA 2YT6A 4RTUA 5EC7A 2CDTA 2RNAA 2D1XA 1ABOA 2KYBA 1YN8A 1T0JA 4ZNXA 2L3SA 3UATA 1WDXA 2LJ0A 2EYYA 3TVTA 4J9EA 1PNJA 4Q4GX 1CSKA 1ABQA 2EBPA 2LQNA 2GNCA 2EGAA 5ECAA 2CREA 2EGEA 2FRYA 1B3QA 1AWJA 4JPBW 1B07A 2DL3A 5IXBA 2FPDA 3PBIA 2RQWA 3VS3A 1AZGB 2LNHB 2D0NA 4CC4B 2EPDA 2J06A 4FSSA 4J9FA 2BZ8A 1SRLA 1S1NA 1NM7A 3REAB 2RQRA 1X2QA 2CT4A 5IHNA 1SEMA 4Z89A 3U23A 2JM8A 1IO6A 4CT3A 3VPJA 1GCQA 4AFUC 1AEYA 2F2WA 4LUDA 1GFDA 4FQBA 2DRKA 2FO0A 2W0ZA 4Q4NA 1NLPC 4FGEA 2KGTA 2EYZA 4HZBA 4FGIA 2B86A 1NYGA 1ZUKA 3M0TA 2IOAA 2XIVA 2OI3A 1EFNA 1WXTA 2DL4A 3R6NA 1AD5A 4EQ8A 3JV3A 1AZEA 1OPKA 3KFVA 1WIEA 2I0NA 1HSQA 2O2OA 1ZX6A 2J6OA 2KRMA 2EGCA 3NE0A 4DEYA 4CC3A 2C0TA 1BBZA 4LUEA 3M0RA 3UF4A 2M0YA 2EKHA 3M0UA 4HXJA 1ZBJA 4FDYA 4Z8AA 1QLYA 1SPKA 1M3CA 4J9GA 1JQQA 1GBQA 2JMAA 2ENMA 1X6BA 1WYXA 2JT4A 2K9GA 2KRSA 1LCKA 3REBB
chains in the Genus database with same CATH superfamily
2X4JA 5D7UA 4OMFB 4QQDA 1UB4A 4EMGA 2X3WD 2IG0A 3ULRB 5LJ5h 4F0WA 2DAQA 4RUGA 2F1LA 2GGRA 4D8KA 2MYSA 2RF0A 1IREB 2QI2A 1OU9A 4DBFA 4RTTA 1YJNA 4AFZC 1X6GA 4WCIA 4F0VA 3L2ZA 1VQ9T 5FRMA 4E7SA 1QCFA 4N0AA 2KXDA 2DERA 4O5VA 4C0GA 4ZTJA 1F1BB 2HKQB 3GBQA 4IURA 1OOTA 2EVRA 4JDSA 1UUEA 5GAN2 3X20B 4YTLA 1UTIA 2GTJA 3IQLA 4F4MA 4IIOA 1M1FA 2F2VA 5GAN4 5FWBA 1K73U 3PNWC 3CQTA 5KYWB 3PIPA 1U1SA 4M7AF 3MJXA 1OZ3A 2DL5A 3HTRA 2C0OA 3TSWA 3G71Q 2VXFA 5LJ3f 1D0YA 1MMGA 1YFNA 2X35A 2DA9A 2IIMA 4E7LA 1VYUA 5KCOA 2RN8A 3HRTA 5CKHA 2HMAA 1QCNA 2RI2A 5HY6A 1LVKA 1TUCA 1PSFA 1N8RC 1YJ9Q 3LH5A 3VS6A 2KY9A 4PJOC 4F7UA 2RA2A 2DRMA 2EAYA 2V8IA 1QKWA 2P4TA 1YJWQ 1JJ2S 3G71T 3JB9F 2OTLA 4ZGDB 2V1RA 2E3HA 1M3AA 1WXBA 3LLRA 4C92G 1BIAA 4L6V5 4KH0B 2EYXA 2EW3A 4C8QD 1KIKA 2BKDN 2RM4A 2RI3A 2YDLA 4HVVA 4JS5A 5LJ3j 2HEQA 4M75F 3JCMV 3G4SA 3DLMA 1VQMT 1ZUUA 1MV0B 3QKJA 5DLOA 4PJLA 8ATCB 2XDBA 3MKDA 2IF6A 1YI2T 1X6OA 2CZ7B 3PT9A 3CCQA 3LW5E 1MUZA 1YJWT 2AKLA 2ZPBB 1KK7A 3OYEA 3RKWA 1NEGA 2PVGB 3OSSC 2K79A 2ED1A 1QVFA 1LNXA 4HCBA 4N0AC 2QYZA 3E19A 1K4US 1D09B 2J6KA 1UECA 1VQPA 1JO8A 1KHCA 4EMKA 1LJOA 2FPEA 5GMKi 4PL6A 4E7JA 2VGNA 3CXCS 5FWCA 5FLXE 3NMZC 4FT2A 2JTMA 2ROTA 3WVEB 1D0ZA 4NOYA 4LDYA 2EQUA 1QW1A 1HD3A 4CGKA 3UPUA 4HCCA 5LJ5f 1FMVA 1HXDA 2L0AA 2COZA 2PQWA 1UHCA 2F69A 1B7TA 1LPLA 1OX9A 3HRUA 1RLQC 3A5ZB 2A08A 2BZXA 4OMPA 4XTVA 4E7KA 3CMAQ 1UDLA 2RJFA 3FJPA 2L8DA 1VQKT 4M77E 4MZMA 2P0KA 2J05A 2KR3A 4QT7A 3UA7A 1PCXA 3VKIA 1PRLC 4CI0C 2LJ3A 2LQWA 2VOBA 5HK0A 3Q1JA 1Y71A 3G71A 1IHWA 4D8DA 1BI3A 3FC3A 2XICA 2X4YA 2EKOA 4M7DA 1HYOA 2KT1A 2DE0X 2ZPIB 3CMET 1Q86R 2QTVA 3L2UA 3UT1A 5GAMe 2H3JA 1M1KU 3CMAT 3AHUA 1QQJA 3I86A 3CC2T 5LJ5j 1YJ9A 3O98A 4C8QG 3OYNA 2DJQA 3A98A 1D1BA 1GCPA 2NUTA 3HSBA 1WHGA 5I21A 1YJWA 4P5NA 3EFSA 4OB0B 2LCSA 1MMDA 1M30A 4ZN3A 2RJCA 4F7UE 5FU7C 5C6SA 3A8HB 2JW4A 2RJDA 2EJFA 2KRNA 3CCMQ 1BKBA 2AZSA 2E5KA 5IN1A 3M1UA 3F70A 2MCNA 3PVQA 1EZZB 2RQTA 1YHQQ 1WI7A 4A4GA 4HFKA 2RHZA 1MHNA 2D0QB 2RHXA 2LDMA 3L2VA 4AFSC 1T0HA 3CCMT 4OB2B 4C92A 3VS2A 2IPOB 1JU5C 4Y92A 1Q81C 3G6EA 4OMLA 2KNBB 1VQ8Q 4Q5WA 4X9DA 1YHQT 2K1GA 1VA7A 3EG3A 4M77D 1IGQA 2A7YA 2FZKB 2YLBA 2JZ2A 1VQOA 1K9MU 4CC2A 1X01A 3OW2P 3H6ZA 1ZUYA 3CCST 3QIIA 3JAME 5GMKh 4RTWA 1RLPC 4RTZA 1UJ0A 2QA4A 1I5OB 2QTXA 3MHXA 1VQ8T 3SWNC 2EYWA 4J9CA 1H8KA 5EC7A 2CDTA 1IZ6A 1T0JA 4ZNXA 2L3SA 1BIBA 1WDXA 3OMCA 4FU6A 4M78C 4XTZA 5ECAA 2VASA 2CREA 4FYXB 4E47A 1AWJA 3CBPA 4JPBW 5L8RE 2QEXQ 2GF7A 1IHVA 4IUUA 3PBIA 3RKYA 4JLGA 2EPDA 2QASA 4FSSA 1YBYA 4J9FA 2BZ8A 2VXEA 1VQ6Q 2YLCA 4ZN1A 4QW2A 2ATCB 2RQRA 3A8GB 1X2QA 4BACA 4L5GA 8AT1B 1SEMA 2JM8A 3OYIA 5LJ3g 3SB2A 1GCQA 2RO0A 4WF2A 1AEYA 3CCMA 4PJOF 2W0ZA 1PD0A 5GAN7 2DZ9A 1FX7A 2B8AA 2QEXT 2KGTA 3DB4A 4M7AE 4C92C 4AMCA 1NYGA 1VOMA 1TWBA 4ZGEB 2XIVA 5M9OA 2DEQA 1YHQA 4HT9A 4C8QA 5GANh 1OPKA 4MDWA 3BDLA 1KD1R 1RAAB 2KRMA 3NE0A 2C0TA 1BBZA 3BFMA 4M77G 3UF4A 2M0YA 3QG1A 3RESA 5GAOl 3A1PA 2AIRB 3OSVA 2DTOA 4Z8AA 3CPFA 1M3CA 3QPHA 1VQLQ 2M1HA 1S72Q 2E41A 3SFMA 1TSFA 2QDYB 2ENMA 2VYTA 3LH0A 1QWEA 4RG2A 4PLIA 5GAOp 4EOBA 5LJ5d 3PBCA 3CCUA 5DM7R 5KYWA 4M75E 3H41A 1VYTA 3QWYA 2M9UA 1W70A 2FZGB 2ROLA 1VQLT 3CD6T 2LRJA 2GQIA 3M0SA 1K8AR 2EWNA 1WX6A 2RH2A 1NJIR 3EAEA 4FIBA 4F7UG 5HK3A 1NEBA 2EQIA 1G3SA 2XHCA 4M7DD 3VRYA 1AT1B 4C0FA 4KGXB 1X69A 1H641 3JCMf 1UE9A 4K11A 3PE0A 2COYA 1KD1C 2A3LA 5L23A 1M2OA 3JCMW 4MZPA 2DZCA 1GCQC 3M53A 2DPPB 2O4XA 2QGGA 1YJNT 1KQ1A 3H0FA 3EBQA 5GAOr 3QDFA 2PU9B 2WSEE 2A37A 5CCAA 4FSXA 4X9CA 5LL6S 5DLQE 1VQ6A 2WACA 1ZSZA 4N4HA 5A0DA 3OQ5A 1RAGB 4M7AD 5HCKA 2FHDA 4C8QC 3OW2S 3QJ6A 4EQAA 2LX9A 4AT1B 3HFNA 1FMKA 3EH1A 2LRQA 3LGFA 4A63B 4R55A 4IUTA 1WA7A 2FEIA 2YUPA 4WTOB 3QZ5B 3QWXX 3VPIA 2X4WA 2LX7A 2DVJA 2YUNA 3EFOB 3CCJQ 1SKUB 2FRWA 3HPWA 1K73C 1K0SA 1TUGB 4OMNA 1ZBXA 2DO3A 6AT1B 2HQXA 4HCZA 5CAIA 2DILA 4J6YA 1K9AA 3I35A 1RACB 2DM1A 4N4GA 2WP7A 2YSQA 2R5AA 5CO7A 2ABLA 3JCMP 2HL5C 2OTLT 4J5YA 1VQLA 1S72A 1D3BA 4HT8A 1BCOA 4M75D 3C95A 1M90U 3S0QA 3CCJT 4C0DC 1N8RR 3PFSA 4PFZA 1VQPQ 3G4ST 1K76A 3TEEA 2VUBA 4D6WA 4RCCA 2P0QA 3HRSA 3NGPA 4M7DG 1IRXA 2SRCA 3CCQT 4II1A 2DK3A 3H8ZA 4M77A 1SSFA 3M55A 4QVZA 3OYCA 2JUFA 1RI9A 3L2WA 4LJ1A 4J32A 3RKXA 2MWPA 1ACMB 4E7HA 4RCBA 1M27C 1VQ5Q 2JNGA 1NBEB 5GJVB 1VQPT 2IVWA 4XTXA 3ZEHA 1OU8A 5LJ3e 4JJDA 2YUQA 1YCYA 2ZPHB 4M7AG 1H92A 3LX7A 2RPNA 4JXBA 3FJ5A 2AHJB 2CGHA 2O9VA 1PWTA 2LC4A 2IOBA 1XJWB 2DVEA 1KC8U 2JM9A 5D6WA 4BY6B 1D1AA 1Z9ZA 4BE2A 1T3SA 2LNVA 3EHQA 4M78F 1Y0MA 1E7OA 1CKAA 3A8OB 4J6WA 2K6DA 4Q4TA 1G2BA 1M2VA 3M9QA 5KH6A 3BW1A 2JOYA 2ZZDA 3LYIA 5KYUA 2DETA 2HQHA 1H3ZA 5GAMh 4OP0A 3GNFB 3S3MA 3JB9H 3OW2A 5AT1B 1RAFB 4DQ2A 1BI2A 2BZYA 1Y57A 2PUKB 3CCJA 1W2BA 2VWFA 2GQVA 3MO8A 4JURA 3J80E 3G7ZA 2RHIA 3OYDA 4M75G 3OYKA 2K5IA 1JXMA 1KQSP 1YJ9T 2K3AA 4GLKA 2FL7A 4A4FA 4LXCA 3CC4Q 3H0HA 4C92F 3OS5A 2DMOA 1N9RA 3UA6A 1U5SA 5CIUA 3GT2A 3A8MB 5GAN5 1XNIA 2QQSA 2Y4XA 1AWWA 3JCMX 2AK5A 5AYFA 2E3IA 2RI5A 3N5BB 4Z88A 4B9XA 3OS2A 1BCMA 3CCLQ 4DBHA 2LCLA 3V8LA 1Q7YU 4KUIA 3CC4T 2L3RA 4FYVB 5LJ5e 2P0PA 3G6EQ 3QYGB 2DLPA 2A28A 5IXFA 4BI3A 2QGFB 5CQXA 2QQBA 3PTAA 1M3BA 1LOJA 3I5SA 2MOXA 2K2MA 5EG2A 2PTKA 5GJWB 3A2YA 2K3BA 2X9HA 1VQOQ 4PJOB 3QSUA 1TS9A 1KFZA 3JRZA 1PC0A 2F2XA 1VQ5A 2L2PA 3SHWA 3VV0A 3NFCA 4KBMB 3CCLT 4JRQA 2E70A 2KEAA 2Y4YA 3JCMd 4XTYA 2V1QA 2QA4Q 3J81E 3G6ET 1GBRA 2KQWA 2VPSA 4RMOA 3VS4A 1X75C 5I11A 2DKGA 2LP5A 2MMPA 2VVKA 1M1GA 2CZ0B 2EQJA 1M4ZA 2XI9A 3FB9A 1BYMA 3LGLA 3OYGA 1YN8A 2LTOA 2LJ0A 3TVTA 3A8LB 1VQOT 2OX7A 2EJGA 1TU0B 3BE3A 4EMHA 4Q4GX 1CSKA 1ABQA 2LQNA 2GNCA 2NYSA 4KGZB 2EGAA 2EGEA 2CZ1B 2OTJA 1Q81R 3C94A 2FVUA 1MMAA 2VC8A 2QA4T 2EQKA 1B07A 4PNOA 5CKBA 5IXBA 2MPXC 3JCMg 1AZGB 4XK8E 2BE9B 2J06A 3CBOA 1SG5A 2ZCFB 1K9MC 3REAB 4M7AA 1WHLA 4PK4A 2QQRA 2CT4A 3QHSA 2K4YA 4EDUA 4Z89A 5I2SA 1IO6A 2RD1A 1VIFA 4C8QF 3CPWP 4AFUC 4LUDA 4FQBA 1JJ2A 1RAIB 5GAMf 1FMWA 3ZBDA 4FGEA 2D9TA 2R58A 3CC4A 4EMKC 2B86A 1V76A 3M0TA 2CP7A 1EX4A 2OI3A 2DL4A 5GANd 3R6NA 1AD5A 4B6MA 1AZEA 3KBGA 4JRIA 3TU4K 5GAOq 3OMGA 1HSQA 2DXCA 2J6OA 2NUPB 2RHYA 2KMTA 3HL8A 2E5QA 2E12A 2QK0A 3M59A 3M4YA 2MF2A 3CCLA 3M0UA 3VYHB 4IUVA 2DXUA 3OA6A 4FDYA 2MI6A 4PFPA 3VYGA 1SPKA 4J9GA 2C06A 1KQ2A 1GBQA 3OB9A 4M75A 3PMIA 2OAUA 5FU6C 3I55A 1WYXA 4ELZC 2K9GA 5GAMj 4BUGA 3QXEB 3L2RA 4EPCA 1M8VA 3MEWA 3R6OA 4DA4A 2Y90A 5J3BA 4IIMA 3CXCA 3CCUQ 1B34A 3RERA 4E6RA 4M7DC 3THKA 1KQSS 4RTXA 3V8KA 2DF6A 1VQNQ 1I81A 3OYYA 1E6HA 1I8FA 2SEMA 4HPEA 2DYIA 1I07A 2VB6A 1ZQ1A 1N27A 3PVLA 2C0IA 2MAMA 2ZGWA 2JS0A 5FU7B 3VUBA 1Y7XA 2CS7A 2W10A 4C5GA 4FGDA 1UGQB 3I56Q 1X43A 1PM3A 2FG0A 3CCUT 2YWWA 4CC7A 2MIOA 5GAN8 4C5HA 2RHUA 1SHGA 2I2LA 1V29B 2RQVA 3CEYA 3JB9J 1ZHIA 3KXTA 2A36A 1XOVA 4J9HA 3WVDB 2LMJA 4DOVA 1Q95G 1Q82R 3DB3A 4PLLA 5D6YA 1V1CA 2JS2A 1SSHA 1JB0E 1EIFA 5D6XA 3CCVQ 3EG9A 1QVFP 2CP3A 2PZ1A 1K0XA 4RKUE 7AT1B 1GXIE 3V7RA 1Q86U 4AG1C 2QDLA 3EGXB 2DTIA 4XAXB 3UDCA 4L59A 4N4IA 2BIVA 3QDRB 4JZ3A 3CC7A 5DY9A 4OB3B 4DBRA 3QO3A 4OLKA 5FW9A 5A0LA 1HJDA 4LD9K 2QAZA 4NL2A 5GAOm 3C4SA 2BUDA 1VQ6T 3EG2A 4M75C 1SF9A 5C0MA 3CCVT 3ZL7C 1OULA 2L3QA 1WJQA 2D8HA 2G3RA 3GF5A 4X34A 3TCJA 1UGVA 2CP2A 2KYMA 1D1CA 2CUBA 3GLXA 4M78E 1IXDA 2PNIA 1OYXA 3JCMJ 1N9SA 3SWNB 1IGUA 1GL5A 2NUTB 2OJ2A 4XU3A 1TOVA 3M54A 2EFIA 5I22A 1BU1A 4J9BA 1I1JA 2DL7A 2ED0A 4M78B 4E2FB 4HVUA 1Q82C 3EFRA 3VUZA 1YNZA 3OY9A 4AG2C 4NL3A 2YRDA 4FM4B 1PHTA 4LNPA 2CH4W 1MGQA 3RMQA 3P8HA 3CPWS 1X27A 2IO8A 2GBQA 2O9SA 1YIJA 1WNLA 2A0FB 1VQNA 2DD4A 1CKBA 1WXUA 4CSHA 1BK2A 4PKCC 2KAFA 1WJRA 2HAXA 2X3XD 1M8MA 1ARKA 1S72T 1WHKA 4BDYA 2K7AA 4ZGJB 3BDUA 2XDPA 1K73R 1KQSA 3JCMe 1G83A 2DBMA 4NS5A 3LWIA 2EQMA 2CUDA 3I56A 2NUZA 4MMKA 4IKFA 1MNEA 1K1ZA 2ZAEA 1BI1A 1U3OA 4ANJA 2RJEA 3MP6A 1RAHB 2LJ1A 2XU8A 4C92B 1UJYA 5LJ5g 1SHFA 1E6GA 2J6FA 1YWPA 2K5FA 1KC8R 4TVRA 2H8HA 3VJPA 4F7UF 3T9NA 2KDSA 1YWOA 3EGDB 1M90C 3OYJA 2JN0A 5LJ3h 2AZVA 3OS0A 1W6XA 3JCMc 3ASKA 3GPLA 2LQKA 4RG8A 4JJNK 2VV5A 1UFFA 3CCVA 4F04B 2CZ6B 2L5QA 3META 1Y96B 3EGUA 4BDZA 3TQ7P 1HK9A 1NYFA 1VQ7Q 4J6XA 1T3LA 4KH1B 4AFQC 5GMKj 5GAMd 5CQYA 4M4ZA 3CCRA 3EG1A 2MK5A 3EG0A 4M78D 2XDDA 3GP8A 3OYBA 3HFOA 3M0PA 1OEBA 1WHHA 2Z0WA 3AT1B 4LDUA 1JEGA 1SRMA 1BB9A 3C0CA 3WXMB 4KULA 5FRNA 4HZ9A 1UGSB 3M56A 1U8RA 3SEMA 3D7SB 3JB9D 1PKTA 4PJJA 1VIEA 3OYLA 1W1FA 3HP9A 5GANf 3TSZA 3RUXA 4BE1A 3RDVA 1KC8C 3VS5A 2JXBA 1FWZA 1QVFS 1MV3A 1YCSB 1I0CA 2R5MA 2CKKA 3H0IA 2LQ8A 1KD1U 1VQ9Q 1NPPA 1C1AA 2DNUA 1NG2A 2K3YA 2ZPEB 1C0MA 2EIFA 2JVVA 4F17A 2HSPA 1OZ2A 3CPWA 4BD3A 1QP3A 4C8QB 4PFOA 4ELYC 2DIGA 4GLMA 1GRIA 2E6ZA 2FB7A 4A4EA 5GANj 2KI7A 2KT8A 3GNGA 2O88A 3VRZA 3KUFA 4M7DF 1G3TA 2HZYA 2DD5A 1Y07A 1ZSZC 2NWMA 2DXTA 1Z9QA 3RBBB 5CKFA 1AWXA 4ATOA 2COWA 3X28B 2E4HA 1TG0A 1WFWA 2QQAA 1PRMC 4FL6A 2YT6A 4Y28E 4RTUA 2DFUA 1ABOA 1M1KR 2LCCA 5CVIA 4ME7A 1O75A 1U1TA 2XIDA 1K8AU 5I2MA 4CRIA 1PNJA 1JRIA 1NJIU 1R8OB 4OF1A 2EBPA 1VQ5T 4M78G 1Q7YC 1B3QA 2OTJQ 3S3NA 2F5TX 1UEBA 3VU3C 4MZTA 1RADB 1VQ7A 4J30A 1WPYA 3VS3A 2LNHB 4CC4B 2D0NA 4HKEA 1WGSA 4C0DB 3JB9G 1SRLA 1S1NA 1D0XA 2RK1A 2X4XA 1MMNA 1XTDA 2NUPA 2FZCB 1RABB 5KYYB 3U23A 1VQMQ 2DJZA 3M5AA 4CT3A 3VPJA 1W4SA 4JLIA 2F2WA 3L42A 4VUBA 2XKOC 1YI2Q 2FO0A 2OTJT 4DOWA 4Q4NA 2V8KA 2O4XB 1R77A 4FGIA 3J7AF 1ZUKA 4PJMA 2IOAA 1ZA1B 2K5LA 1WXTA 3H9NA 3JV3A 3KFVA 4LDVA 2L89A 5KYXB 1WIEA 4R56A 1ZSZB 2I0NA 4LDXA 2QXFA 2O2OA 4M77C 1ZX6A 1M1KC 4CC3A 1BI0A 2WSCE 3NTIA 3M0RA 4Z02A 2CP5A 2CP0A 1VQ4Q 1ZBJA 4PJOE 1VQ9A 3OBYA 2JMAA 1PD1A 1KG1A 1PG5B 1NZ9A 1K9MR 3I55Q 2KRSA 3INZA 3REBB 2DX1A 5A2QE 4JRPA 1AVZC 3HHTB 2V8JA 5CKDA 3NPFA 1YITQ 3VS7A 2HCKA 4F16A 4JZ4A 5GAOn 3E9GA 2RQUA 4KT0E 1VQKQ 1G8XA 3NHNA 3O5ZA 4MDXA 5A0GA 4JRKA 2GFAA 1VQ4T 1N8RU 2MWOA 2K2VA 4Y91A 1MNDA 4LN2A 1IB8A 4JJBA 4C0ZA 1D3BB 3BY7A 3I55T 2ECZA 3L1AA 3CMEQ 3M57A 2EJ9A 4OVAA 4LD6A 1YITT 1WZOA 2DBKA 3DKMA 2VGMA 4A53A 3CC2Q 4IUQA 3JCMQ 4JS4A 3EGXA 3ZFJA 1JXOA 3E2UA 3I5RA 1QVGP 4XU1A 2XK0A 4A54A 3E1SA 2PVDB 1WLPB 1TUDA 2G6FX 4E7IA 3GOXA 1WQ7A 4JUVA 1J3TA 2AT1B 4M77B 2M02A 1FYNA 1NE8A 4OMOA 3QYHB 4KRTA 1AWOA 2KXCA 4BE0A 1A0NB 2LZ6B 2CSQA 1PKSA 2DL8A 3M0QA 1VQMA 4BI8B 2WSFE 3SWNA 1QKXA 5IHIA 1YI2A 1KJWA 4GBQA 3RIRA 2XMFA 4BB7A 4O6JA 1O9SA 4OMMA 3CC7Q 4OMQA 1UG1A 2DIQA 2DYBA 2E10A 4M78A 2FPFA 1QP2A 4HVWA 4BI4A 4R0KA 3I9QA 4OB1B 4PJOD 3UWNA 4HFLA 1I5LA 1G3YA 4F14A 1G3WA 1VQ4A 1M2VB 4F7UB 3MCAB 3CC7T 2O31A 2ESWA 5KYUB 3FRNA 2P4RA 2JTEA 4QQGA 1P92A 1ZA2B 3O8VA 5IH2A 3SDZA 4LDWA 3MP8A 3QJYA 3EH2A 1PSEA 1UHFA 2CH4A 4FQAA 1ZLMA 2HQEA 4J9DA 2HL3A 1YITA 1Q86C 1RAEB 3EHRA 3CCSQ 5GANg 1VQKA 1M9SA 1YP5A 1YIJQ 3GIBA 3V8JA 2LVMA 1OI1A 5GAN3 2VPMA 4QKUA 5J26A 3EGDA 2RK2A 4ESRA 2GFUA 4XU0A 2HKNA 2HSEB 5CR2A 2XD0A 2P84A 3PMTA 3CBMA 2OAWA 4X1VA 2KBTA 1X2KA 3CMEA 4OGEA 3X24B 1DJ7B 2JMCA 3JCMb 2J7IA 3CCEQ 1Y96A 3LWHA 3CMAA 4FCYA 1OV3A 5GMKm 3CC2A 4M7AC 3OYAA 1YIJT 4RTVA 2X51A 4EMKB 3JCMh 1W2BP 3VS1A 4QVCA 1U06A 1VQNT 2K57A 3RNJA 4HCKA 2CYZB 4OGCA 1TXQA 3SD4A 3RMSA 3FDRA 4XTUA 4C5IA 2E64A 5LJ3d 2HD0A 5GMKl 2E1HA 2IO7A 3EFOA 4ORZA 4FYWB 2KROA 2M51A 3MEVA 3I56T 3CCET 3A2ZA 1JBMA 3MP1A 1OQKA 2FYKA 1WQWA 4M7DE 3OYMA 3X26B 4A4KA 2M16A 4DEXA 1M5Q1 5CKEA 4J9IA 4HA8A 2GTOA 5FU6B 4PJOG 4A4HA 3QZ9B 3FIFA 4J7IA 1ZSGA 1Q81U 4JJCA 3CCRQ 4LE9A 4M7DB 3NTHA 3S6WA 1KHIA 1QWFA 3M58A 2D8JA 3ME9A 1QVGS 2BTTA 1FXXA 1RUWA 2K3XA 2R57A 2YRCA 2JTFA 1QCOA 3OYFA 1VYVA 1R0CB 4PJNA 4MMLA 1M90R 4J7FA 3CCRT 2L3PA 5IHKA 3VS0A 1OPLA 1N5ZA 4FT4A 2AKKA 2E65A 2F5KA 2V26A 2VKNA 2QQ9A 2CT3A 4M7AB 1N6AA 1WHMA 4IUPA 3M4GA 4M77F 3RR6A 4XQ3A 2E6NA 3FLGA 1GFCA 2CSIA 3CCSA 1H3HA 3A30A 4GY5A 2HDAA 4HFFA 2D6FA 1WHJA 5FROA 1XQHA 2KK4A 3CD6Q 2EYQA 1VQ8A 4KGVB 3ER0A 4QVDA 1AOJA 5HKCA 2IO9A 1NLOC 2HBWA 4C92E 5J39A 3S3OA 5GMKe 3KW0A 2ZPFB 3JSCA 2RMOA 3JB9I 5IAYA 1C6VX 2HNIA 4B9WA 2LT4A 2O01E 4FW1A 5KE2A 3C12A 4RTYA 3CCEA 1TTHB 3X25B 1G5VA 1YJNQ 1RL2A 4EIKA 3OYHA 5IT9E 1QVPA 1UGRB 1KSWA 4FW2A 3QBYA 1JJ2P 1UGPB 3L2QA 9ATCB 2KE9A 1R0BG 4E7ZA 4FYYB 4M75B 2RNAA 2YHTA 4J8OA 2D1XA 5KYYA 2KYBA 2PVOB 2CP6A 3HKSA 3TREA 3UATA 2EYYA 2M0OA 3P8BB 4J9EA 1AHJB 3URGA 1RI0A 1B34B 1QMCA 4DBQA 2FRYA 1WJSA 4C5EA 2QEXA 3OS1A 3P8DA 2PUOB 2RB6A 2DL3A 2HBPA 2FPDA 4V2SA 2RQWA 5KYXA 3MEUA 1NM7A 1NPRA 5KCHA 4UC4A 4J83A 2KVQG 4QQ6A 5IHNA 3PGGA 1Q82U 4KUDK 3FEOA 1VUBA 3NTKA 1GFDA 2XG8D 3QUIA 2DRKA 2YXYA 1W2BS 3E9FA 3MPUB 5GANe 1NLPC 1TH7A 3CXCP 3V7CA 3OBWA 2LT1A 5GAN6 5CK9A 2OTLQ 2KSSA 2EYZA 2DTHA 4HZBA 1VQ7T 4XU2A 3V7SA 5KE3A 1I4K1 1EFNA 2ZPGB 3PIOA 1K8AC 4EQ8A 1QVGA 1NJIC 5GAMg 4PJOA 1OX8A 3EG9B 2QG9B 3G4SQ 2EGCA 2YRVA 4DEYA 1Q7YR 3DLLA 4BY6C 2JJ9A 4LUEA 2GCXA 2BE7D 2EKHA 4C92D 4XTWA 4C8QE 4HXJA 3CCQQ 4ZTFA 1QLYA 2DEUA 5KYNA 3CD6A 2NLUA 1JQQA 2H3EB 3G1JA 2DXBA 1X6BA 2JT4A 2YUOA 1LCKA 3MEAA
chains in the Genus database with same CATH topology
2DX1A 1AVZC 1QWEA 3NPFA 3VS7A 2HCKA 4F16A 4JZ4A 4EOBA 2RQUA 2X3WD 4IIMA 3ULRB 3PBCA 4F0WA 4RUGA 2GGRA 4D8KA 4E6RA 3THKA 2RF0A 3NHNA 3O5ZA 3H41A 4RTXA 1VYTA 2DF6A 3QWYA 1W70A 1E6HA 4HPEA 2SEMA 4RTTA 1I07A 4AFZC 1X6GA 2ROLA 3PVLA 4WCIA 4F0VA 2C0IA 2LRJA 4LN2A 4JJBA 1QCFA 2GQIA 3M0SA 2JS0A 2KXDA 1WX6A 2ECZA 3GBQA 2W10A 1OOTA 2EVRA 1UUEA 1NEBA 4FGDA 2EQIA 1UTIA 2GTJA 3IQLA 1X43A 4F4MA 4IIOA 2F2VA 3VRYA 2DBKA 5FWBA 2FG0A 4CC7A 1X69A 2MIOA 1JXOA 1UE9A 3CQTA 4K11A 3PE0A 3I5RA 5L23A 1SHGA 1GCQC 2RQVA 2DL5A 2C0OA 3H0FA 3TSWA 1WLPB 1TUDA 1XOVA 2A36A 4J9HA 2A37A 2G6FX 2LMJA 2DA9A 1J3TA 2IIMA 1FYNA 1VYUA 1V1CA 2JS2A 1SSHA 4OMOA 2RN8A 4KRTA 1AWOA 2KXCA 1TUCA 1A0NB 5HCKA 2LZ6B 2PZ1A 1K0XA 2CSQA 1PKSA 2DL8A 3M0QA 3LH5A 3VS6A 4EQAA 4AG1C 2QDLA 1QKXA 5IHIA 1KJWA 4GBQA 1FMKA 2XMFA 2DRMA 4JZ3A 4OMMA 4A63B 4OMQA 1QKWA 1UG1A 2DYBA 1WA7A 2V1RA 2FEIA 2YUPA 4OLKA 1M3AA 5FW9A 3QWXX 1WXBA 1HJDA 3VPIA 2EYXA 2LX7A 2FPFA 4HVWA 2DVJA 2YUNA 2EW3A 3EG2A 4R0KA 2FRWA 1KIKA 1K0SA 3ZL7C 2L3QA 4HVVA 2D8HA 2YDLA 3I9QA 2HEQA 4OMNA 1UGVA 1ZUUA 2KYMA 1MV0B 2CUBA 2DILA 4F14A 2IF6A 1K9AA 3I35A 2DM1A 2PNIA 2YSQA 2ABLA 1GL5A 1MUZA 2O31A 2AKLA 2ESWA 2OJ2A 1NEGA 2P4RA 2JTEA 2K79A 5I22A 5IH2A 1BU1A 2ED1A 4J9BA 1I1JA 2DL7A 2ED0A 1UHFA 2CH4A 4HVUA 4FQAA 3S0QA 1YNZA 1ZLMA 4AG2C 4J9DA 1K4US 1PHTA 3EHRA 2CH4W 2J6KA 4LNPA 1UECA 1X27A 1JO8A 2IO8A 2GBQA 1K76A 2FPEA 1YP5A 2O9SA 3NGPA 5FWCA 3NMZC 1CKBA 1WXUA 2SRCA 4CSHA 1BK2A 2VPMA 2ROTA 1ARKA 2X3XD 1M8MA 4ESRA 1HD3A 4CGKA 2K7AA 2OAWA 1RI9A 4LJ1A 1G83A 2L0AA 2DBMA 4X1VA 2KBTA 1X2KA 1UHCA 1RLQC 2CUDA 1M27C 2NUZA 2JMCA 2A08A 2BZXA 2J7IA 4OMPA 1K1ZA 5GJVB 1UDLA 1OV3A 1U3OA 2LJ1A 1UJYA 2J05A 2KR3A 4JJDA 4QT7A 4RTVA 3UA7A 1PRLC 2YUQA 3VS1A 1U06A 1SHFA 2LJ3A 1E6GA 2LQWA 1H92A 2J6FA 3RNJA 2VOBA 1YWPA 2RPNA 4JXBA 4HCKA 3FJ5A 2H8HA 4D8DA 2O9VA 1PWTA 1YWOA 2IOBA 2AZVA 2IO7A 2KT1A 1W6XA 2DE0X 4ORZA 2JM9A 2KROA 1Z9ZA 2M51A 1UFFA 1T3SA 3EHQA 3A2ZA 1Y0MA 1E7OA 1CKAA 3I86A 3EGUA 2K6DA 3O98A 2DJQA 1G2BA 4Q4TA 3A98A 1NYFA 4DEXA 1GCPA 4J9IA 2GTOA 1T3LA 4AFQC 1ZSGA 4M4ZA 4JJCA 3EG1A 3EG0A 2LCSA 4LE9A 1M30A 3M0PA 2BZYA 1OEBA 1Y57A 1JEGA 2JW4A 1SRMA 2VWFA 1BB9A 2KRNA 1QWFA 3C0CA 2AZSA 4HZ9A 1JXMA 2D8JA 2E5KA 2BTTA 2K3AA 3M1UA 1RUWA 3SEMA 2MCNA 1PKTA 3PVQA 3H0HA 1VYVA 2DMOA 2RQTA 1W1FA 3TSZA 3UA6A 1WI7A 1U5SA 3GT2A 2L3PA 5IHKA 3VS0A 3VS5A 1OPLA 1N5ZA 2JXBA 2AKKA 1AWWA 2AK5A 2VKNA 2CT3A 4AFSC 1MV3A 1T0HA 1YCSB 1I0CA 4Z88A 3H0IA 1GFCA 2CSIA 1H3HA 3A30A 2HDAA 3VS2A 1JU5C 4Y92A 2DLPA 2A28A 4OMLA 2KNBB 5IXFA 2DNUA 1NG2A 1M3BA 3I5SA 1AOJA 2K1GA 2IO9A 1NLOC 2HBWA 4F17A 2HSPA 1VA7A 2MOXA 3EG3A 3KW0A 2K2MA 2RMOA 4GLMA 1GRIA 2PTKA 5GJWB 3A2YA 2K3BA 4CC2A 1KFZA 2F2XA 1ZUYA 2KT8A 2L2PA 4RTYA 2O88A 3SHWA 3VRZA 2YUOA 2NWMA 2KEAA 4RTWA 1RLPC 4RTZA 1UJ0A 4EIKA 1Z9QA 3RBBB 2V1QA 1AWXA 1KSWA 1GBRA 2VPSA 3VS4A 1TG0A 5I11A 1WFWA 2KE9A 2LP5A 2VVKA 1PRMC 2EYWA 4J9CA 1H8KA 2YT6A 4RTUA 5EC7A 2CDTA 2RNAA 2D1XA 1ABOA 2KYBA 1YN8A 1T0JA 4ZNXA 2L3SA 3UATA 1WDXA 2LJ0A 2EYYA 3TVTA 4J9EA 1PNJA 4Q4GX 1CSKA 1ABQA 2EBPA 2LQNA 2GNCA 2EGAA 5ECAA 2CREA 2EGEA 2FRYA 1B3QA 1AWJA 4JPBW 1B07A 2DL3A 5IXBA 2FPDA 3PBIA 2RQWA 3VS3A 1AZGB 2LNHB 2D0NA 4CC4B 2EPDA 2J06A 4FSSA 4J9FA 2BZ8A 1SRLA 1S1NA 1NM7A 3REAB 2RQRA 1X2QA 2CT4A 5IHNA 1SEMA 4Z89A 3U23A 2JM8A 1IO6A 4CT3A 3VPJA 1GCQA 4AFUC 1AEYA 2F2WA 4LUDA 1GFDA 4FQBA 2DRKA 2FO0A 2W0ZA 4Q4NA 1NLPC 4FGEA 2KGTA 2EYZA 4HZBA 4FGIA 2B86A 1NYGA 1ZUKA 3M0TA 2IOAA 2XIVA 2OI3A 1EFNA 1WXTA 2DL4A 3R6NA 1AD5A 4EQ8A 3JV3A 1AZEA 1OPKA 3KFVA 1WIEA 2I0NA 1HSQA 2O2OA 1ZX6A 2J6OA 2KRMA 2EGCA 3NE0A 4DEYA 4CC3A 2C0TA 1BBZA 4LUEA 3M0RA 3UF4A 2M0YA 2EKHA 3M0UA 4HXJA 1ZBJA 4FDYA 4Z8AA 1QLYA 1SPKA 1M3CA 4J9GA 1JQQA 1GBQA 2JMAA 2ENMA 1X6BA 1WYXA 2JT4A 2K9GA 2KRSA 1LCKA 3REBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DX1 A;  1AVZ C;  1QWE A;  3NPF A;  3VS7 A;  2HCK A;  4F16 A;  4JZ4 A;  4EOB A;  2RQU A;  2X3W D;  4IIM A;  3ULR B;  3PBC A;  4F0W A;  4RUG A;  2GGR A;  4D8K A;  4E6R A;  3THK A;  2RF0 A;  3NHN A;  3O5Z A;  3H41 A;  4RTX A;  1VYT A;  2DF6 A;  3QWY A;  1W70 A;  1E6H A;  4HPE A;  2SEM A;  4RTT A;  1I07 A;  4AFZ C;  1X6G A;  2ROL A;  3PVL A;  4WCI A;  4F0V A;  2C0I A;  2LRJ A;  4LN2 A;  4JJB A;  1QCF A;  2GQI A;  3M0S A;  2JS0 A;  2KXD A;  1WX6 A;  2ECZ A;  3GBQ A;  2W10 A;  1OOT A;  2EVR A;  1UUE A;  1NEB A;  4FGD A;  2EQI A;  1UTI A;  2GTJ A;  3IQL A;  1X43 A;  4F4M A;  4IIO A;  2F2V A;  3VRY A;  2DBK A;  5FWB A;  2FG0 A;  4CC7 A;  1X69 A;  2MIO A;  1JXO A;  1UE9 A;  3CQT A;  4K11 A;  3PE0 A;  3I5R A;  5L23 A;  1SHG A;  1GCQ C;  2RQV A;  2DL5 A;  2C0O A;  3H0F A;  3TSW A;  1WLP B;  1TUD A;  1XOV A;  2A36 A;  4J9H A;  2A37 A;  2G6F X;  2LMJ A;  2DA9 A;  1J3T A;  2IIM A;  1FYN A;  1VYU A;  1V1C A;  2JS2 A;  1SSH A;  4OMO A;  2RN8 A;  4KRT A;  1AWO A;  2KXC A;  1TUC A;  1A0N B;  5HCK A;  2LZ6 B;  2PZ1 A;  1K0X A;  2CSQ A;  1PKS A;  2DL8 A;  3M0Q A;  3LH5 A;  3VS6 A;  4EQA A;  4AG1 C;  2QDL A;  1QKX A;  5IHI A;  1KJW A;  4GBQ A;  1FMK A;  2XMF A;  2DRM A;  4JZ3 A;  4OMM A;  4A63 B;  4OMQ A;  1QKW A;  1UG1 A;  2DYB A;  1WA7 A;  2V1R A;  2FEI A;  2YUP A;  4OLK A;  1M3A A;  5FW9 A;  3QWX X;  1WXB A;  1HJD A;  3VPI A;  2EYX A;  2LX7 A;  2FPF A;  4HVW A;  2DVJ A;  2YUN A;  2EW3 A;  3EG2 A;  4R0K A;  2FRW A;  1KIK A;  1K0S A;  3ZL7 C;  2L3Q A;  4HVV A;  2D8H A;  2YDL A;  3I9Q A;  2HEQ A;  4OMN A;  1UGV A;  1ZUU A;  2KYM A;  1MV0 B;  2CUB A;  2DIL A;  4F14 A;  2IF6 A;  1K9A A;  3I35 A;  2DM1 A;  2PNI A;  2YSQ A;  2ABL A;  1GL5 A;  1MUZ A;  2O31 A;  2AKL A;  2ESW A;  2OJ2 A;  1NEG A;  2P4R A;  2JTE A;  2K79 A;  5I22 A;  5IH2 A;  1BU1 A;  2ED1 A;  4J9B A;  1I1J A;  2DL7 A;  2ED0 A;  1UHF A;  2CH4 A;  4HVU A;  4FQA A;  3S0Q A;  1YNZ A;  1ZLM A;  4AG2 C;  4J9D A;  1K4U S;  1PHT A;  3EHR A;  2CH4 W;  2J6K A;  4LNP A;  1UEC A;  1X27 A;  1JO8 A;  2IO8 A;  2GBQ A;  1K76 A;  2FPE A;  1YP5 A;  2O9S A;  3NGP A;  5FWC A;  3NMZ C;  1CKB A;  1WXU A;  2SRC A;  4CSH A;  1BK2 A;  2VPM A;  2ROT A;  1ARK A;  2X3X D;  1M8M A;  4ESR A;  1HD3 A;  4CGK A;  2K7A A;  2OAW A;  1RI9 A;  4LJ1 A;  1G83 A;  2L0A A;  2DBM A;  4X1V A;  2KBT A;  1X2K A;  1UHC A;  1RLQ C;  2CUD A;  1M27 C;  2NUZ A;  2JMC A;  2A08 A;  2BZX A;  2J7I A;  4OMP A;  1K1Z A;  5GJV B;  1UDL A;  1OV3 A;  1U3O A;  2LJ1 A;  1UJY A;  2J05 A;  2KR3 A;  4JJD A;  4QT7 A;  4RTV A;  3UA7 A;  1PRL C;  2YUQ A;  3VS1 A;  1U06 A;  1SHF A;  2LJ3 A;  1E6G A;  2LQW A;  1H92 A;  2J6F A;  3RNJ A;  2VOB A;  1YWP A;  2RPN A;  4JXB A;  4HCK A;  3FJ5 A;  2H8H A;  4D8D A;  2O9V A;  1PWT A;  1YWO A;  2IOB A;  2AZV A;  2IO7 A;  2KT1 A;  1W6X A;  2DE0 X;  4ORZ A;  2JM9 A;  2KRO A;  1Z9Z A;  2M51 A;  1UFF A;  1T3S A;  3EHQ A;  3A2Z A;  1Y0M A;  1E7O A;  1CKA A;  3I86 A;  3EGU A;  2K6D A;  3O98 A;  2DJQ A;  1G2B A;  4Q4T A;  3A98 A;  1NYF A;  4DEX A;  1GCP A;  4J9I A;  2GTO A;  1T3L A;  4AFQ C;  1ZSG A;  4M4Z A;  4JJC A;  3EG1 A;  3EG0 A;  2LCS A;  4LE9 A;  1M30 A;  3M0P A;  2BZY A;  1OEB A;  1Y57 A;  1JEG A;  2JW4 A;  1SRM A;  2VWF A;  1BB9 A;  2KRN A;  1QWF A;  3C0C A;  2AZS A;  4HZ9 A;  1JXM A;  2D8J A;  2E5K A;  2BTT A;  2K3A A;  3M1U A;  1RUW A;  3SEM A;  2MCN A;  1PKT A;  3PVQ A;  3H0H A;  1VYV A;  2DMO A;  2RQT A;  1W1F A;  3TSZ A;  3UA6 A;  1WI7 A;  1U5S A;  3GT2 A;  2L3P A;  5IHK A;  3VS0 A;  3VS5 A;  1OPL A;  1N5Z A;  2JXB A;  2AKK A;  1AWW A;  2AK5 A;  2VKN A;  2CT3 A;  4AFS C;  1MV3 A;  1T0H A;  1YCS B;  1I0C A;  4Z88 A;  3H0I A;  1GFC A;  2CSI A;  1H3H A;  3A30 A;  2HDA A;  3VS2 A;  1JU5 C;  4Y92 A;  2DLP A;  2A28 A;  4OML A;  2KNB B;  5IXF A;  2DNU A;  1NG2 A;  1M3B A;  3I5S A;  1AOJ A;  2K1G A;  2IO9 A;  1NLO C;  2HBW A;  4F17 A;  2HSP A;  1VA7 A;  2MOX A;  3EG3 A;  3KW0 A;  2K2M A;  2RMO A;  4GLM A;  1GRI A;  2PTK A;  5GJW B;  3A2Y A;  2K3B A;  4CC2 A;  1KFZ A;  2F2X A;  1ZUY A;  2KT8 A;  2L2P A;  4RTY A;  2O88 A;  3SHW A;  3VRZ A;  2YUO A;  2NWM A;  2KEA A;  4RTW A;  1RLP C;  4RTZ A;  1UJ0 A;  4EIK A;  1Z9Q A;  3RBB B;  2V1Q A;  1AWX A;  1KSW A;  1GBR A;  2VPS A;  3VS4 A;  1TG0 A;  5I11 A;  1WFW A;  2KE9 A;  2LP5 A;  2VVK A;  1PRM C;  2EYW A;  4J9C A;  1H8K A;  2YT6 A;  4RTU A;  5EC7 A;  2CDT A;  2RNA A;  2D1X A;  1ABO A;  2KYB A;  1YN8 A;  1T0J A;  4ZNX A;  2L3S A;  3UAT A;  1WDX A;  2LJ0 A;  2EYY A;  3TVT A;  4J9E A;  1PNJ A;  4Q4G X;  1CSK A;  1ABQ A;  2EBP A;  2LQN A;  2GNC A;  2EGA A;  5ECA A;  2CRE A;  2EGE A;  2FRY A;  1B3Q A;  1AWJ A;  4JPB W;  1B07 A;  2DL3 A;  5IXB A;  2FPD A;  3PBI A;  2RQW A;  3VS3 A;  1AZG B;  2LNH B;  2D0N A;  4CC4 B;  2EPD A;  2J06 A;  4FSS A;  4J9F A;  2BZ8 A;  1SRL A;  1S1N A;  1NM7 A;  3REA B;  2RQR A;  1X2Q A;  2CT4 A;  5IHN A;  1SEM A;  4Z89 A;  3U23 A;  2JM8 A;  1IO6 A;  4CT3 A;  3VPJ A;  1GCQ A;  4AFU C;  1AEY A;  2F2W A;  4LUD A;  1GFD A;  4FQB A;  2DRK A;  2FO0 A;  2W0Z A;  4Q4N A;  1NLP C;  4FGE A;  2KGT A;  2EYZ A;  4HZB A;  4FGI A;  2B86 A;  1NYG A;  1ZUK A;  3M0T A;  2IOA A;  2XIV A;  2OI3 A;  1EFN A;  1WXT A;  2DL4 A;  3R6N A;  1AD5 A;  4EQ8 A;  3JV3 A;  1AZE A;  1OPK A;  3KFV A;  1WIE A;  2I0N A;  1HSQ A;  2O2O A;  1ZX6 A;  2J6O A;  2KRM A;  2EGC A;  3NE0 A;  4DEY A;  4CC3 A;  2C0T A;  1BBZ A;  4LUE A;  3M0R A;  3UF4 A;  2M0Y A;  2EKH A;  3M0U A;  4HXJ A;  1ZBJ A;  4FDY A;  4Z8A A;  1QLY A;  1SPK A;  1M3C A;  4J9G A;  1JQQ A;  1GBQ A;  2JMA A;  2ENM A;  1X6B A;  1WYX A;  2JT4 A;  2K9G A;  2KRS A;  1LCK A;  3REB B; 
#chains in the Genus database with same CATH topology
 2X4J A;  5D7U A;  4OMF B;  4QQD A;  1UB4 A;  4EMG A;  2X3W D;  2IG0 A;  3ULR B;  5LJ5 h;  4F0W A;  2DAQ A;  4RUG A;  2F1L A;  2GGR A;  4D8K A;  2MYS A;  2RF0 A;  1IRE B;  2QI2 A;  1OU9 A;  4DBF A;  4RTT A;  1YJN A;  4AFZ C;  1X6G A;  4WCI A;  4F0V A;  3L2Z A;  1VQ9 T;  5FRM A;  4E7S A;  1QCF A;  4N0A A;  2KXD A;  2DER A;  4O5V A;  4C0G A;  4ZTJ A;  1F1B B;  2HKQ B;  3GBQ A;  4IUR A;  1OOT A;  2EVR A;  4JDS A;  1UUE A;  5GAN 2;  3X20 B;  4YTL A;  1UTI A;  2GTJ A;  3IQL A;  4F4M A;  4IIO A;  1M1F A;  2F2V A;  5GAN 4;  5FWB A;  1K73 U;  3PNW C;  3CQT A;  5KYW B;  3PIP A;  1U1S A;  4M7A F;  3MJX A;  1OZ3 A;  2DL5 A;  3HTR A;  2C0O A;  3TSW A;  3G71 Q;  2VXF A;  5LJ3 f;  1D0Y A;  1MMG A;  1YFN A;  2X35 A;  2DA9 A;  2IIM A;  4E7L A;  1VYU A;  5KCO A;  2RN8 A;  3HRT A;  5CKH A;  2HMA A;  1QCN A;  2RI2 A;  5HY6 A;  1LVK A;  1TUC A;  1PSF A;  1N8R C;  1YJ9 Q;  3LH5 A;  3VS6 A;  2KY9 A;  4PJO C;  4F7U A;  2RA2 A;  2DRM A;  2EAY A;  2V8I A;  1QKW A;  2P4T A;  1YJW Q;  1JJ2 S;  3G71 T;  3JB9 F;  2OTL A;  4ZGD B;  2V1R A;  2E3H A;  1M3A A;  1WXB A;  3LLR A;  4C92 G;  1BIA A;  4L6V 5;  4KH0 B;  2EYX A;  2EW3 A;  4C8Q D;  1KIK A;  2BKD N;  2RM4 A;  2RI3 A;  2YDL A;  4HVV A;  4JS5 A;  5LJ3 j;  2HEQ A;  4M75 F;  3JCM V;  3G4S A;  3DLM A;  1VQM T;  1ZUU A;  1MV0 B;  3QKJ A;  5DLO A;  4PJL A;  8ATC B;  2XDB A;  3MKD A;  2IF6 A;  1YI2 T;  1X6O A;  2CZ7 B;  3PT9 A;  3CCQ A;  3LW5 E;  1MUZ A;  1YJW T;  2AKL A;  2ZPB B;  1KK7 A;  3OYE A;  3RKW A;  1NEG A;  2PVG B;  3OSS C;  2K79 A;  2ED1 A;  1QVF A;  1LNX A;  4HCB A;  4N0A C;  2QYZ A;  3E19 A;  1K4U S;  1D09 B;  2J6K A;  1UEC A;  1VQP A;  1JO8 A;  1KHC A;  4EMK A;  1LJO A;  2FPE A;  5GMK i;  4PL6 A;  4E7J A;  2VGN A;  3CXC S;  5FWC A;  5FLX E;  3NMZ C;  4FT2 A;  2JTM A;  2ROT A;  3WVE B;  1D0Z A;  4NOY A;  4LDY A;  2EQU A;  1QW1 A;  1HD3 A;  4CGK A;  3UPU A;  4HCC A;  5LJ5 f;  1FMV A;  1HXD A;  2L0A A;  2COZ A;  2PQW A;  1UHC A;  2F69 A;  1B7T A;  1LPL A;  1OX9 A;  3HRU A;  1RLQ C;  3A5Z B;  2A08 A;  2BZX A;  4OMP A;  4XTV A;  4E7K A;  3CMA Q;  1UDL A;  2RJF A;  3FJP A;  2L8D A;  1VQK T;  4M77 E;  4MZM A;  2P0K A;  2J05 A;  2KR3 A;  4QT7 A;  3UA7 A;  1PCX A;  3VKI A;  1PRL C;  4CI0 C;  2LJ3 A;  2LQW A;  2VOB A;  5HK0 A;  3Q1J A;  1Y71 A;  3G71 A;  1IHW A;  4D8D A;  1BI3 A;  3FC3 A;  2XIC A;  2X4Y A;  2EKO A;  4M7D A;  1HYO A;  2KT1 A;  2DE0 X;  2ZPI B;  3CME T;  1Q86 R;  2QTV A;  3L2U A;  3UT1 A;  5GAM e;  2H3J A;  1M1K U;  3CMA T;  3AHU A;  1QQJ A;  3I86 A;  3CC2 T;  5LJ5 j;  1YJ9 A;  3O98 A;  4C8Q G;  3OYN A;  2DJQ A;  3A98 A;  1D1B A;  1GCP A;  2NUT A;  3HSB A;  1WHG A;  5I21 A;  1YJW A;  4P5N A;  3EFS A;  4OB0 B;  2LCS A;  1MMD A;  1M30 A;  4ZN3 A;  2RJC A;  4F7U E;  5FU7 C;  5C6S A;  3A8H B;  2JW4 A;  2RJD A;  2EJF A;  2KRN A;  3CCM Q;  1BKB A;  2AZS A;  2E5K A;  5IN1 A;  3M1U A;  3F70 A;  2MCN A;  3PVQ A;  1EZZ B;  2RQT A;  1YHQ Q;  1WI7 A;  4A4G A;  4HFK A;  2RHZ A;  1MHN A;  2D0Q B;  2RHX A;  2LDM A;  3L2V A;  4AFS C;  1T0H A;  3CCM T;  4OB2 B;  4C92 A;  3VS2 A;  2IPO B;  1JU5 C;  4Y92 A;  1Q81 C;  3G6E A;  4OML A;  2KNB B;  1VQ8 Q;  4Q5W A;  4X9D A;  1YHQ T;  2K1G A;  1VA7 A;  3EG3 A;  4M77 D;  1IGQ A;  2A7Y A;  2FZK B;  2YLB A;  2JZ2 A;  1VQO A;  1K9M U;  4CC2 A;  1X01 A;  3OW2 P;  3H6Z A;  1ZUY A;  3CCS T;  3QII A;  3JAM E;  5GMK h;  4RTW A;  1RLP C;  4RTZ A;  1UJ0 A;  2QA4 A;  1I5O B;  2QTX A;  3MHX A;  1VQ8 T;  3SWN C;  2EYW A;  4J9C A;  1H8K A;  5EC7 A;  2CDT A;  1IZ6 A;  1T0J A;  4ZNX A;  2L3S A;  1BIB A;  1WDX A;  3OMC A;  4FU6 A;  4M78 C;  4XTZ A;  5ECA A;  2VAS A;  2CRE A;  4FYX B;  4E47 A;  1AWJ A;  3CBP A;  4JPB W;  5L8R E;  2QEX Q;  2GF7 A;  1IHV A;  4IUU A;  3PBI A;  3RKY A;  4JLG A;  2EPD A;  2QAS A;  4FSS A;  1YBY A;  4J9F A;  2BZ8 A;  2VXE A;  1VQ6 Q;  2YLC A;  4ZN1 A;  4QW2 A;  2ATC B;  2RQR A;  3A8G B;  1X2Q A;  4BAC A;  4L5G A;  8AT1 B;  1SEM A;  2JM8 A;  3OYI A;  5LJ3 g;  3SB2 A;  1GCQ A;  2RO0 A;  4WF2 A;  1AEY A;  3CCM A;  4PJO F;  2W0Z A;  1PD0 A;  5GAN 7;  2DZ9 A;  1FX7 A;  2B8A A;  2QEX T;  2KGT A;  3DB4 A;  4M7A E;  4C92 C;  4AMC A;  1NYG A;  1VOM A;  1TWB A;  4ZGE B;  2XIV A;  5M9O A;  2DEQ A;  1YHQ A;  4HT9 A;  4C8Q A;  5GAN h;  1OPK A;  4MDW A;  3BDL A;  1KD1 R;  1RAA B;  2KRM A;  3NE0 A;  2C0T A;  1BBZ A;  3BFM A;  4M77 G;  3UF4 A;  2M0Y A;  3QG1 A;  3RES A;  5GAO l;  3A1P A;  2AIR B;  3OSV A;  2DTO A;  4Z8A A;  3CPF A;  1M3C A;  3QPH A;  1VQL Q;  2M1H A;  1S72 Q;  2E41 A;  3SFM A;  1TSF A;  2QDY B;  2ENM A;  2VYT A;  3LH0 A;  1QWE A;  4RG2 A;  4PLI A;  5GAO p;  4EOB A;  5LJ5 d;  3PBC A;  3CCU A;  5DM7 R;  5KYW A;  4M75 E;  3H41 A;  1VYT A;  3QWY A;  2M9U A;  1W70 A;  2FZG B;  2ROL A;  1VQL T;  3CD6 T;  2LRJ A;  2GQI A;  3M0S A;  1K8A R;  2EWN A;  1WX6 A;  2RH2 A;  1NJI R;  3EAE A;  4FIB A;  4F7U G;  5HK3 A;  1NEB A;  2EQI A;  1G3S A;  2XHC A;  4M7D D;  3VRY A;  1AT1 B;  4C0F A;  4KGX B;  1X69 A;  1H64 1;  3JCM f;  1UE9 A;  4K11 A;  3PE0 A;  2COY A;  1KD1 C;  2A3L A;  5L23 A;  1M2O A;  3JCM W;  4MZP A;  2DZC A;  1GCQ C;  3M53 A;  2DPP B;  2O4X A;  2QGG A;  1YJN T;  1KQ1 A;  3H0F A;  3EBQ A;  5GAO r;  3QDF A;  2PU9 B;  2WSE E;  2A37 A;  5CCA A;  4FSX A;  4X9C A;  5LL6 S;  5DLQ E;  1VQ6 A;  2WAC A;  1ZSZ A;  4N4H A;  5A0D A;  3OQ5 A;  1RAG B;  4M7A D;  5HCK A;  2FHD A;  4C8Q C;  3OW2 S;  3QJ6 A;  4EQA A;  2LX9 A;  4AT1 B;  3HFN A;  1FMK A;  3EH1 A;  2LRQ A;  3LGF A;  4A63 B;  4R55 A;  4IUT A;  1WA7 A;  2FEI A;  2YUP A;  4WTO B;  3QZ5 B;  3QWX X;  3VPI A;  2X4W A;  2LX7 A;  2DVJ A;  2YUN A;  3EFO B;  3CCJ Q;  1SKU B;  2FRW A;  3HPW A;  1K73 C;  1K0S A;  1TUG B;  4OMN A;  1ZBX A;  2DO3 A;  6AT1 B;  2HQX A;  4HCZ A;  5CAI A;  2DIL A;  4J6Y A;  1K9A A;  3I35 A;  1RAC B;  2DM1 A;  4N4G A;  2WP7 A;  2YSQ A;  2R5A A;  5CO7 A;  2ABL A;  3JCM P;  2HL5 C;  2OTL T;  4J5Y A;  1VQL A;  1S72 A;  1D3B A;  4HT8 A;  1BCO A;  4M75 D;  3C95 A;  1M90 U;  3S0Q A;  3CCJ T;  4C0D C;  1N8R R;  3PFS A;  4PFZ A;  1VQP Q;  3G4S T;  1K76 A;  3TEE A;  2VUB A;  4D6W A;  4RCC A;  2P0Q A;  3HRS A;  3NGP A;  4M7D G;  1IRX A;  2SRC A;  3CCQ T;  4II1 A;  2DK3 A;  3H8Z A;  4M77 A;  1SSF A;  3M55 A;  4QVZ A;  3OYC A;  2JUF A;  1RI9 A;  3L2W A;  4LJ1 A;  4J32 A;  3RKX A;  2MWP A;  1ACM B;  4E7H A;  4RCB A;  1M27 C;  1VQ5 Q;  2JNG A;  1NBE B;  5GJV B;  1VQP T;  2IVW A;  4XTX A;  3ZEH A;  1OU8 A;  5LJ3 e;  4JJD A;  2YUQ A;  1YCY A;  2ZPH B;  4M7A G;  1H92 A;  3LX7 A;  2RPN A;  4JXB A;  3FJ5 A;  2AHJ B;  2CGH A;  2O9V A;  1PWT A;  2LC4 A;  2IOB A;  1XJW B;  2DVE A;  1KC8 U;  2JM9 A;  5D6W A;  4BY6 B;  1D1A A;  1Z9Z A;  4BE2 A;  1T3S A;  2LNV A;  3EHQ A;  4M78 F;  1Y0M A;  1E7O A;  1CKA A;  3A8O B;  4J6W A;  2K6D A;  4Q4T A;  1G2B A;  1M2V A;  3M9Q A;  5KH6 A;  3BW1 A;  2JOY A;  2ZZD A;  3LYI A;  5KYU A;  2DET A;  2HQH A;  1H3Z A;  5GAM h;  4OP0 A;  3GNF B;  3S3M A;  3JB9 H;  3OW2 A;  5AT1 B;  1RAF B;  4DQ2 A;  1BI2 A;  2BZY A;  1Y57 A;  2PUK B;  3CCJ A;  1W2B A;  2VWF A;  2GQV A;  3MO8 A;  4JUR A;  3J80 E;  3G7Z A;  2RHI A;  3OYD A;  4M75 G;  3OYK A;  2K5I A;  1JXM A;  1KQS P;  1YJ9 T;  2K3A A;  4GLK A;  2FL7 A;  4A4F A;  4LXC A;  3CC4 Q;  3H0H A;  4C92 F;  3OS5 A;  2DMO A;  1N9R A;  3UA6 A;  1U5S A;  5CIU A;  3GT2 A;  3A8M B;  5GAN 5;  1XNI A;  2QQS A;  2Y4X A;  1AWW A;  3JCM X;  2AK5 A;  5AYF A;  2E3I A;  2RI5 A;  3N5B B;  4Z88 A;  4B9X A;  3OS2 A;  1BCM A;  3CCL Q;  4DBH A;  2LCL A;  3V8L A;  1Q7Y U;  4KUI A;  3CC4 T;  2L3R A;  4FYV B;  5LJ5 e;  2P0P A;  3G6E Q;  3QYG B;  2DLP A;  2A28 A;  5IXF A;  4BI3 A;  2QGF B;  5CQX A;  2QQB A;  3PTA A;  1M3B A;  1LOJ A;  3I5S A;  2MOX A;  2K2M A;  5EG2 A;  2PTK A;  5GJW B;  3A2Y A;  2K3B A;  2X9H A;  1VQO Q;  4PJO B;  3QSU A;  1TS9 A;  1KFZ A;  3JRZ A;  1PC0 A;  2F2X A;  1VQ5 A;  2L2P A;  3SHW A;  3VV0 A;  3NFC A;  4KBM B;  3CCL T;  4JRQ A;  2E70 A;  2KEA A;  2Y4Y A;  3JCM d;  4XTY A;  2V1Q A;  2QA4 Q;  3J81 E;  3G6E T;  1GBR A;  2KQW A;  2VPS A;  4RMO A;  3VS4 A;  1X75 C;  5I11 A;  2DKG A;  2LP5 A;  2MMP A;  2VVK A;  1M1G A;  2CZ0 B;  2EQJ A;  1M4Z A;  2XI9 A;  3FB9 A;  1BYM A;  3LGL A;  3OYG A;  1YN8 A;  2LTO A;  2LJ0 A;  3TVT A;  3A8L B;  1VQO T;  2OX7 A;  2EJG A;  1TU0 B;  3BE3 A;  4EMH A;  4Q4G X;  1CSK A;  1ABQ A;  2LQN A;  2GNC A;  2NYS A;  4KGZ B;  2EGA A;  2EGE A;  2CZ1 B;  2OTJ A;  1Q81 R;  3C94 A;  2FVU A;  1MMA A;  2VC8 A;  2QA4 T;  2EQK A;  1B07 A;  4PNO A;  5CKB A;  5IXB A;  2MPX C;  3JCM g;  1AZG B;  4XK8 E;  2BE9 B;  2J06 A;  3CBO A;  1SG5 A;  2ZCF B;  1K9M C;  3REA B;  4M7A A;  1WHL A;  4PK4 A;  2QQR A;  2CT4 A;  3QHS A;  2K4Y A;  4EDU A;  4Z89 A;  5I2S A;  1IO6 A;  2RD1 A;  1VIF A;  4C8Q F;  3CPW P;  4AFU C;  4LUD A;  4FQB A;  1JJ2 A;  1RAI B;  5GAM f;  1FMW A;  3ZBD A;  4FGE A;  2D9T A;  2R58 A;  3CC4 A;  4EMK C;  2B86 A;  1V76 A;  3M0T A;  2CP7 A;  1EX4 A;  2OI3 A;  2DL4 A;  5GAN d;  3R6N A;  1AD5 A;  4B6M A;  1AZE A;  3KBG A;  4JRI A;  3TU4 K;  5GAO q;  3OMG A;  1HSQ A;  2DXC A;  2J6O A;  2NUP B;  2RHY A;  2KMT A;  3HL8 A;  2E5Q A;  2E12 A;  2QK0 A;  3M59 A;  3M4Y A;  2MF2 A;  3CCL A;  3M0U A;  3VYH B;  4IUV A;  2DXU A;  3OA6 A;  4FDY A;  2MI6 A;  4PFP A;  3VYG A;  1SPK A;  4J9G A;  2C06 A;  1KQ2 A;  1GBQ A;  3OB9 A;  4M75 A;  3PMI A;  2OAU A;  5FU6 C;  3I55 A;  1WYX A;  4ELZ C;  2K9G A;  5GAM j;  4BUG A;  3QXE B;  3L2R A;  4EPC A;  1M8V A;  3MEW A;  3R6O A;  4DA4 A;  2Y90 A;  5J3B A;  4IIM A;  3CXC A;  3CCU Q;  1B34 A;  3RER A;  4E6R A;  4M7D C;  3THK A;  1KQS S;  4RTX A;  3V8K A;  2DF6 A;  1VQN Q;  1I81 A;  3OYY A;  1E6H A;  1I8F A;  2SEM A;  4HPE A;  2DYI A;  1I07 A;  2VB6 A;  1ZQ1 A;  1N27 A;  3PVL A;  2C0I A;  2MAM A;  2ZGW A;  2JS0 A;  5FU7 B;  3VUB A;  1Y7X A;  2CS7 A;  2W10 A;  4C5G A;  4FGD A;  1UGQ B;  3I56 Q;  1X43 A;  1PM3 A;  2FG0 A;  3CCU T;  2YWW A;  4CC7 A;  2MIO A;  5GAN 8;  4C5H A;  2RHU A;  1SHG A;  2I2L A;  1V29 B;  2RQV A;  3CEY A;  3JB9 J;  1ZHI A;  3KXT A;  2A36 A;  1XOV A;  4J9H A;  3WVD B;  2LMJ A;  4DOV A;  1Q95 G;  1Q82 R;  3DB3 A;  4PLL A;  5D6Y A;  1V1C A;  2JS2 A;  1SSH A;  1JB0 E;  1EIF A;  5D6X A;  3CCV Q;  3EG9 A;  1QVF P;  2CP3 A;  2PZ1 A;  1K0X A;  4RKU E;  7AT1 B;  1GXI E;  3V7R A;  1Q86 U;  4AG1 C;  2QDL A;  3EGX B;  2DTI A;  4XAX B;  3UDC A;  4L59 A;  4N4I A;  2BIV A;  3QDR B;  4JZ3 A;  3CC7 A;  5DY9 A;  4OB3 B;  4DBR A;  3QO3 A;  4OLK A;  5FW9 A;  5A0L A;  1HJD A;  4LD9 K;  2QAZ A;  4NL2 A;  5GAO m;  3C4S A;  2BUD A;  1VQ6 T;  3EG2 A;  4M75 C;  1SF9 A;  5C0M A;  3CCV T;  3ZL7 C;  1OUL A;  2L3Q A;  1WJQ A;  2D8H A;  2G3R A;  3GF5 A;  4X34 A;  3TCJ A;  1UGV A;  2CP2 A;  2KYM A;  1D1C A;  2CUB A;  3GLX A;  4M78 E;  1IXD A;  2PNI A;  1OYX A;  3JCM J;  1N9S A;  3SWN B;  1IGU A;  1GL5 A;  2NUT B;  2OJ2 A;  4XU3 A;  1TOV A;  3M54 A;  2EFI A;  5I22 A;  1BU1 A;  4J9B A;  1I1J A;  2DL7 A;  2ED0 A;  4M78 B;  4E2F B;  4HVU A;  1Q82 C;  3EFR A;  3VUZ A;  1YNZ A;  3OY9 A;  4AG2 C;  4NL3 A;  2YRD A;  4FM4 B;  1PHT A;  4LNP A;  2CH4 W;  1MGQ A;  3RMQ A;  3P8H A;  3CPW S;  1X27 A;  2IO8 A;  2GBQ A;  2O9S A;  1YIJ A;  1WNL A;  2A0F B;  1VQN A;  2DD4 A;  1CKB A;  1WXU A;  4CSH A;  1BK2 A;  4PKC C;  2KAF A;  1WJR A;  2HAX A;  2X3X D;  1M8M A;  1ARK A;  1S72 T;  1WHK A;  4BDY A;  2K7A A;  4ZGJ B;  3BDU A;  2XDP A;  1K73 R;  1KQS A;  3JCM e;  1G83 A;  2DBM A;  4NS5 A;  3LWI A;  2EQM A;  2CUD A;  3I56 A;  2NUZ A;  4MMK A;  4IKF A;  1MNE A;  1K1Z A;  2ZAE A;  1BI1 A;  1U3O A;  4ANJ A;  2RJE A;  3MP6 A;  1RAH B;  2LJ1 A;  2XU8 A;  4C92 B;  1UJY A;  5LJ5 g;  1SHF A;  1E6G A;  2J6F A;  1YWP A;  2K5F A;  1KC8 R;  4TVR A;  2H8H A;  3VJP A;  4F7U F;  3T9N A;  2KDS A;  1YWO A;  3EGD B;  1M90 C;  3OYJ A;  2JN0 A;  5LJ3 h;  2AZV A;  3OS0 A;  1W6X A;  3JCM c;  3ASK A;  3GPL A;  2LQK A;  4RG8 A;  4JJN K;  2VV5 A;  1UFF A;  3CCV A;  4F04 B;  2CZ6 B;  2L5Q A;  3MET A;  1Y96 B;  3EGU A;  4BDZ A;  3TQ7 P;  1HK9 A;  1NYF A;  1VQ7 Q;  4J6X A;  1T3L A;  4KH1 B;  4AFQ C;  5GMK j;  5GAM d;  5CQY A;  4M4Z A;  3CCR A;  3EG1 A;  2MK5 A;  3EG0 A;  4M78 D;  2XDD A;  3GP8 A;  3OYB A;  3HFO A;  3M0P A;  1OEB A;  1WHH A;  2Z0W A;  3AT1 B;  4LDU A;  1JEG A;  1SRM A;  1BB9 A;  3C0C A;  3WXM B;  4KUL A;  5FRN A;  4HZ9 A;  1UGS B;  3M56 A;  1U8R A;  3SEM A;  3D7S B;  3JB9 D;  1PKT A;  4PJJ A;  1VIE A;  3OYL A;  1W1F A;  3HP9 A;  5GAN f;  3TSZ A;  3RUX A;  4BE1 A;  3RDV A;  1KC8 C;  3VS5 A;  2JXB A;  1FWZ A;  1QVF S;  1MV3 A;  1YCS B;  1I0C A;  2R5M A;  2CKK A;  3H0I A;  2LQ8 A;  1KD1 U;  1VQ9 Q;  1NPP A;  1C1A A;  2DNU A;  1NG2 A;  2K3Y A;  2ZPE B;  1C0M A;  2EIF A;  2JVV A;  4F17 A;  2HSP A;  1OZ2 A;  3CPW A;  4BD3 A;  1QP3 A;  4C8Q B;  4PFO A;  4ELY C;  2DIG A;  4GLM A;  1GRI A;  2E6Z A;  2FB7 A;  4A4E A;  5GAN j;  2KI7 A;  2KT8 A;  3GNG A;  2O88 A;  3VRZ A;  3KUF A;  4M7D F;  1G3T A;  2HZY A;  2DD5 A;  1Y07 A;  1ZSZ C;  2NWM A;  2DXT A;  1Z9Q A;  3RBB B;  5CKF A;  1AWX A;  4ATO A;  2COW A;  3X28 B;  2E4H A;  1TG0 A;  1WFW A;  2QQA A;  1PRM C;  4FL6 A;  2YT6 A;  4Y28 E;  4RTU A;  2DFU A;  1ABO A;  1M1K R;  2LCC A;  5CVI A;  4ME7 A;  1O75 A;  1U1T A;  2XID A;  1K8A U;  5I2M A;  4CRI A;  1PNJ A;  1JRI A;  1NJI U;  1R8O B;  4OF1 A;  2EBP A;  1VQ5 T;  4M78 G;  1Q7Y C;  1B3Q A;  2OTJ Q;  3S3N A;  2F5T X;  1UEB A;  3VU3 C;  4MZT A;  1RAD B;  1VQ7 A;  4J30 A;  1WPY A;  3VS3 A;  2LNH B;  4CC4 B;  2D0N A;  4HKE A;  1WGS A;  4C0D B;  3JB9 G;  1SRL A;  1S1N A;  1D0X A;  2RK1 A;  2X4X A;  1MMN A;  1XTD A;  2NUP A;  2FZC B;  1RAB B;  5KYY B;  3U23 A;  1VQM Q;  2DJZ A;  3M5A A;  4CT3 A;  3VPJ A;  1W4S A;  4JLI A;  2F2W A;  3L42 A;  4VUB A;  2XKO C;  1YI2 Q;  2FO0 A;  2OTJ T;  4DOW A;  4Q4N A;  2V8K A;  2O4X B;  1R77 A;  4FGI A;  3J7A F;  1ZUK A;  4PJM A;  2IOA A;  1ZA1 B;  2K5L A;  1WXT A;  3H9N A;  3JV3 A;  3KFV A;  4LDV A;  2L89 A;  5KYX B;  1WIE A;  4R56 A;  1ZSZ B;  2I0N A;  4LDX A;  2QXF A;  2O2O A;  4M77 C;  1ZX6 A;  1M1K C;  4CC3 A;  1BI0 A;  2WSC E;  3NTI A;  3M0R A;  4Z02 A;  2CP5 A;  2CP0 A;  1VQ4 Q;  1ZBJ A;  4PJO E;  1VQ9 A;  3OBY A;  2JMA A;  1PD1 A;  1KG1 A;  1PG5 B;  1NZ9 A;  1K9M R;  3I55 Q;  2KRS A;  3INZ A;  3REB B;  2DX1 A;  5A2Q E;  4JRP A;  1AVZ C;  3HHT B;  2V8J A;  5CKD A;  3NPF A;  1YIT Q;  3VS7 A;  2HCK A;  4F16 A;  4JZ4 A;  5GAO n;  3E9G A;  2RQU A;  4KT0 E;  1VQK Q;  1G8X A;  3NHN A;  3O5Z A;  4MDX A;  5A0G A;  4JRK A;  2GFA A;  1VQ4 T;  1N8R U;  2MWO A;  2K2V A;  4Y91 A;  1MND A;  4LN2 A;  1IB8 A;  4JJB A;  4C0Z A;  1D3B B;  3BY7 A;  3I55 T;  2ECZ A;  3L1A A;  3CME Q;  3M57 A;  2EJ9 A;  4OVA A;  4LD6 A;  1YIT T;  1WZO A;  2DBK A;  3DKM A;  2VGM A;  4A53 A;  3CC2 Q;  4IUQ A;  3JCM Q;  4JS4 A;  3EGX A;  3ZFJ A;  1JXO A;  3E2U A;  3I5R A;  1QVG P;  4XU1 A;  2XK0 A;  4A54 A;  3E1S A;  2PVD B;  1WLP B;  1TUD A;  2G6F X;  4E7I A;  3GOX A;  1WQ7 A;  4JUV A;  1J3T A;  2AT1 B;  4M77 B;  2M02 A;  1FYN A;  1NE8 A;  4OMO A;  3QYH B;  4KRT A;  1AWO A;  2KXC A;  4BE0 A;  1A0N B;  2LZ6 B;  2CSQ A;  1PKS A;  2DL8 A;  3M0Q A;  1VQM A;  4BI8 B;  2WSF E;  3SWN A;  1QKX A;  5IHI A;  1YI2 A;  1KJW A;  4GBQ A;  3RIR A;  2XMF A;  4BB7 A;  4O6J A;  1O9S A;  4OMM A;  3CC7 Q;  4OMQ A;  1UG1 A;  2DIQ A;  2DYB A;  2E10 A;  4M78 A;  2FPF A;  1QP2 A;  4HVW A;  4BI4 A;  4R0K A;  3I9Q A;  4OB1 B;  4PJO D;  3UWN A;  4HFL A;  1I5L A;  1G3Y A;  4F14 A;  1G3W A;  1VQ4 A;  1M2V B;  4F7U B;  3MCA B;  3CC7 T;  2O31 A;  2ESW A;  5KYU B;  3FRN A;  2P4R A;  2JTE A;  4QQG A;  1P92 A;  1ZA2 B;  3O8V A;  5IH2 A;  3SDZ A;  4LDW A;  3MP8 A;  3QJY A;  3EH2 A;  1PSE A;  1UHF A;  2CH4 A;  4FQA A;  1ZLM A;  2HQE A;  4J9D A;  2HL3 A;  1YIT A;  1Q86 C;  1RAE B;  3EHR A;  3CCS Q;  5GAN g;  1VQK A;  1M9S A;  1YP5 A;  1YIJ Q;  3GIB A;  3V8J A;  2LVM A;  1OI1 A;  5GAN 3;  2VPM A;  4QKU A;  5J26 A;  3EGD A;  2RK2 A;  4ESR A;  2GFU A;  4XU0 A;  2HKN A;  2HSE B;  5CR2 A;  2XD0 A;  2P84 A;  3PMT A;  3CBM A;  2OAW A;  4X1V A;  2KBT A;  1X2K A;  3CME A;  4OGE A;  3X24 B;  1DJ7 B;  2JMC A;  3JCM b;  2J7I A;  3CCE Q;  1Y96 A;  3LWH A;  3CMA A;  4FCY A;  1OV3 A;  5GMK m;  3CC2 A;  4M7A C;  3OYA A;  1YIJ T;  4RTV A;  2X51 A;  4EMK B;  3JCM h;  1W2B P;  3VS1 A;  4QVC A;  1U06 A;  1VQN T;  2K57 A;  3RNJ A;  4HCK A;  2CYZ B;  4OGC A;  1TXQ A;  3SD4 A;  3RMS A;  3FDR A;  4XTU A;  4C5I A;  2E64 A;  5LJ3 d;  2HD0 A;  5GMK l;  2E1H A;  2IO7 A;  3EFO A;  4ORZ A;  4FYW B;  2KRO A;  2M51 A;  3MEV A;  3I56 T;  3CCE T;  3A2Z A;  1JBM A;  3MP1 A;  1OQK A;  2FYK A;  1WQW A;  4M7D E;  3OYM A;  3X26 B;  4A4K A;  2M16 A;  4DEX A;  1M5Q 1;  5CKE A;  4J9I A;  4HA8 A;  2GTO A;  5FU6 B;  4PJO G;  4A4H A;  3QZ9 B;  3FIF A;  4J7I A;  1ZSG A;  1Q81 U;  4JJC A;  3CCR Q;  4LE9 A;  4M7D B;  3NTH A;  3S6W A;  1KHI A;  1QWF A;  3M58 A;  2D8J A;  3ME9 A;  1QVG S;  2BTT A;  1FXX A;  1RUW A;  2K3X A;  2R57 A;  2YRC A;  2JTF A;  1QCO A;  3OYF A;  1VYV A;  1R0C B;  4PJN A;  4MML A;  1M90 R;  4J7F A;  3CCR T;  2L3P A;  5IHK A;  3VS0 A;  1OPL A;  1N5Z A;  4FT4 A;  2AKK A;  2E65 A;  2F5K A;  2V26 A;  2VKN A;  2QQ9 A;  2CT3 A;  4M7A B;  1N6A A;  1WHM A;  4IUP A;  3M4G A;  4M77 F;  3RR6 A;  4XQ3 A;  2E6N A;  3FLG A;  1GFC A;  2CSI A;  3CCS A;  1H3H A;  3A30 A;  4GY5 A;  2HDA A;  4HFF A;  2D6F A;  1WHJ A;  5FRO A;  1XQH A;  2KK4 A;  3CD6 Q;  2EYQ A;  1VQ8 A;  4KGV B;  3ER0 A;  4QVD A;  1AOJ A;  5HKC A;  2IO9 A;  1NLO C;  2HBW A;  4C92 E;  5J39 A;  3S3O A;  5GMK e;  3KW0 A;  2ZPF B;  3JSC A;  2RMO A;  3JB9 I;  5IAY A;  1C6V X;  2HNI A;  4B9W A;  2LT4 A;  2O01 E;  4FW1 A;  5KE2 A;  3C12 A;  4RTY A;  3CCE A;  1TTH B;  3X25 B;  1G5V A;  1YJN Q;  1RL2 A;  4EIK A;  3OYH A;  5IT9 E;  1QVP A;  1UGR B;  1KSW A;  4FW2 A;  3QBY A;  1JJ2 P;  1UGP B;  3L2Q A;  9ATC B;  2KE9 A;  1R0B G;  4E7Z A;  4FYY B;  4M75 B;  2RNA A;  2YHT A;  4J8O A;  2D1X A;  5KYY A;  2KYB A;  2PVO B;  2CP6 A;  3HKS A;  3TRE A;  3UAT A;  2EYY A;  2M0O A;  3P8B B;  4J9E A;  1AHJ B;  3URG A;  1RI0 A;  1B34 B;  1QMC A;  4DBQ A;  2FRY A;  1WJS A;  4C5E A;  2QEX A;  3OS1 A;  3P8D A;  2PUO B;  2RB6 A;  2DL3 A;  2HBP A;  2FPD A;  4V2S A;  2RQW A;  5KYX A;  3MEU A;  1NM7 A;  1NPR A;  5KCH A;  4UC4 A;  4J83 A;  2KVQ G;  4QQ6 A;  5IHN A;  3PGG A;  1Q82 U;  4KUD K;  3FEO A;  1VUB A;  3NTK A;  1GFD A;  2XG8 D;  3QUI A;  2DRK A;  2YXY A;  1W2B S;  3E9F A;  3MPU B;  5GAN e;  1NLP C;  1TH7 A;  3CXC P;  3V7C A;  3OBW A;  2LT1 A;  5GAN 6;  5CK9 A;  2OTL Q;  2KSS A;  2EYZ A;  2DTH A;  4HZB A;  1VQ7 T;  4XU2 A;  3V7S A;  5KE3 A;  1I4K 1;  1EFN A;  2ZPG B;  3PIO A;  1K8A C;  4EQ8 A;  1QVG A;  1NJI C;  5GAM g;  4PJO A;  1OX8 A;  3EG9 B;  2QG9 B;  3G4S Q;  2EGC A;  2YRV A;  4DEY A;  1Q7Y R;  3DLL A;  4BY6 C;  2JJ9 A;  4LUE A;  2GCX A;  2BE7 D;  2EKH A;  4C92 D;  4XTW A;  4C8Q E;  4HXJ A;  3CCQ Q;  4ZTF A;  1QLY A;  2DEU A;  5KYN A;  3CD6 A;  2NLU A;  1JQQ A;  2H3E B;  3G1J A;  2DXB A;  1X6B A;  2JT4 A;  2YUO A;  1LCK A;  3MEA A; 
#chains in the Genus database with same CATH homology
 2DX1 A;  1AVZ C;  1QWE A;  3NPF A;  3VS7 A;  2HCK A;  4F16 A;  4JZ4 A;  4EOB A;  2RQU A;  2X3W D;  4IIM A;  3ULR B;  3PBC A;  4F0W A;  4RUG A;  2GGR A;  4D8K A;  4E6R A;  3THK A;  2RF0 A;  3NHN A;  3O5Z A;  3H41 A;  4RTX A;  1VYT A;  2DF6 A;  3QWY A;  1W70 A;  1E6H A;  4HPE A;  2SEM A;  4RTT A;  1I07 A;  4AFZ C;  1X6G A;  2ROL A;  3PVL A;  4WCI A;  4F0V A;  2C0I A;  2LRJ A;  4LN2 A;  4JJB A;  1QCF A;  2GQI A;  3M0S A;  2JS0 A;  2KXD A;  1WX6 A;  2ECZ A;  3GBQ A;  2W10 A;  1OOT A;  2EVR A;  1UUE A;  1NEB A;  4FGD A;  2EQI A;  1UTI A;  2GTJ A;  3IQL A;  1X43 A;  4F4M A;  4IIO A;  2F2V A;  3VRY A;  2DBK A;  5FWB A;  2FG0 A;  4CC7 A;  1X69 A;  2MIO A;  1JXO A;  1UE9 A;  3CQT A;  4K11 A;  3PE0 A;  3I5R A;  5L23 A;  1SHG A;  1GCQ C;  2RQV A;  2DL5 A;  2C0O A;  3H0F A;  3TSW A;  1WLP B;  1TUD A;  1XOV A;  2A36 A;  4J9H A;  2A37 A;  2G6F X;  2LMJ A;  2DA9 A;  1J3T A;  2IIM A;  1FYN A;  1VYU A;  1V1C A;  2JS2 A;  1SSH A;  4OMO A;  2RN8 A;  4KRT A;  1AWO A;  2KXC A;  1TUC A;  1A0N B;  5HCK A;  2LZ6 B;  2PZ1 A;  1K0X A;  2CSQ A;  1PKS A;  2DL8 A;  3M0Q A;  3LH5 A;  3VS6 A;  4EQA A;  4AG1 C;  2QDL A;  1QKX A;  5IHI A;  1KJW A;  4GBQ A;  1FMK A;  2XMF A;  2DRM A;  4JZ3 A;  4OMM A;  4A63 B;  4OMQ A;  1QKW A;  1UG1 A;  2DYB A;  1WA7 A;  2V1R A;  2FEI A;  2YUP A;  4OLK A;  1M3A A;  5FW9 A;  3QWX X;  1WXB A;  1HJD A;  3VPI A;  2EYX A;  2LX7 A;  2FPF A;  4HVW A;  2DVJ A;  2YUN A;  2EW3 A;  3EG2 A;  4R0K A;  2FRW A;  1KIK A;  1K0S A;  3ZL7 C;  2L3Q A;  4HVV A;  2D8H A;  2YDL A;  3I9Q A;  2HEQ A;  4OMN A;  1UGV A;  1ZUU A;  2KYM A;  1MV0 B;  2CUB A;  2DIL A;  4F14 A;  2IF6 A;  1K9A A;  3I35 A;  2DM1 A;  2PNI A;  2YSQ A;  2ABL A;  1GL5 A;  1MUZ A;  2O31 A;  2AKL A;  2ESW A;  2OJ2 A;  1NEG A;  2P4R A;  2JTE A;  2K79 A;  5I22 A;  5IH2 A;  1BU1 A;  2ED1 A;  4J9B A;  1I1J A;  2DL7 A;  2ED0 A;  1UHF A;  2CH4 A;  4HVU A;  4FQA A;  3S0Q A;  1YNZ A;  1ZLM A;  4AG2 C;  4J9D A;  1K4U S;  1PHT A;  3EHR A;  2CH4 W;  2J6K A;  4LNP A;  1UEC A;  1X27 A;  1JO8 A;  2IO8 A;  2GBQ A;  1K76 A;  2FPE A;  1YP5 A;  2O9S A;  3NGP A;  5FWC A;  3NMZ C;  1CKB A;  1WXU A;  2SRC A;  4CSH A;  1BK2 A;  2VPM A;  2ROT A;  1ARK A;  2X3X D;  1M8M A;  4ESR A;  1HD3 A;  4CGK A;  2K7A A;  2OAW A;  1RI9 A;  4LJ1 A;  1G83 A;  2L0A A;  2DBM A;  4X1V A;  2KBT A;  1X2K A;  1UHC A;  1RLQ C;  2CUD A;  1M27 C;  2NUZ A;  2JMC A;  2A08 A;  2BZX A;  2J7I A;  4OMP A;  1K1Z A;  5GJV B;  1UDL A;  1OV3 A;  1U3O A;  2LJ1 A;  1UJY A;  2J05 A;  2KR3 A;  4JJD A;  4QT7 A;  4RTV A;  3UA7 A;  1PRL C;  2YUQ A;  3VS1 A;  1U06 A;  1SHF A;  2LJ3 A;  1E6G A;  2LQW A;  1H92 A;  2J6F A;  3RNJ A;  2VOB A;  1YWP A;  2RPN A;  4JXB A;  4HCK A;  3FJ5 A;  2H8H A;  4D8D A;  2O9V A;  1PWT A;  1YWO A;  2IOB A;  2AZV A;  2IO7 A;  2KT1 A;  1W6X A;  2DE0 X;  4ORZ A;  2JM9 A;  2KRO A;  1Z9Z A;  2M51 A;  1UFF A;  1T3S A;  3EHQ A;  3A2Z A;  1Y0M A;  1E7O A;  1CKA A;  3I86 A;  3EGU A;  2K6D A;  3O98 A;  2DJQ A;  1G2B A;  4Q4T A;  3A98 A;  1NYF A;  4DEX A;  1GCP A;  4J9I A;  2GTO A;  1T3L A;  4AFQ C;  1ZSG A;  4M4Z A;  4JJC A;  3EG1 A;  3EG0 A;  2LCS A;  4LE9 A;  1M30 A;  3M0P A;  2BZY A;  1OEB A;  1Y57 A;  1JEG A;  2JW4 A;  1SRM A;  2VWF A;  1BB9 A;  2KRN A;  1QWF A;  3C0C A;  2AZS A;  4HZ9 A;  1JXM A;  2D8J A;  2E5K A;  2BTT A;  2K3A A;  3M1U A;  1RUW A;  3SEM A;  2MCN A;  1PKT A;  3PVQ A;  3H0H A;  1VYV A;  2DMO A;  2RQT A;  1W1F A;  3TSZ A;  3UA6 A;  1WI7 A;  1U5S A;  3GT2 A;  2L3P A;  5IHK A;  3VS0 A;  3VS5 A;  1OPL A;  1N5Z A;  2JXB A;  2AKK A;  1AWW A;  2AK5 A;  2VKN A;  2CT3 A;  4AFS C;  1MV3 A;  1T0H A;  1YCS B;  1I0C A;  4Z88 A;  3H0I A;  1GFC A;  2CSI A;  1H3H A;  3A30 A;  2HDA A;  3VS2 A;  1JU5 C;  4Y92 A;  2DLP A;  2A28 A;  4OML A;  2KNB B;  5IXF A;  2DNU A;  1NG2 A;  1M3B A;  3I5S A;  1AOJ A;  2K1G A;  2IO9 A;  1NLO C;  2HBW A;  4F17 A;  2HSP A;  1VA7 A;  2MOX A;  3EG3 A;  3KW0 A;  2K2M A;  2RMO A;  4GLM A;  1GRI A;  2PTK A;  5GJW B;  3A2Y A;  2K3B A;  4CC2 A;  1KFZ A;  2F2X A;  1ZUY A;  2KT8 A;  2L2P A;  4RTY A;  2O88 A;  3SHW A;  3VRZ A;  2YUO A;  2NWM A;  2KEA A;  4RTW A;  1RLP C;  4RTZ A;  1UJ0 A;  4EIK A;  1Z9Q A;  3RBB B;  2V1Q A;  1AWX A;  1KSW A;  1GBR A;  2VPS A;  3VS4 A;  1TG0 A;  5I11 A;  1WFW A;  2KE9 A;  2LP5 A;  2VVK A;  1PRM C;  2EYW A;  4J9C A;  1H8K A;  2YT6 A;  4RTU A;  5EC7 A;  2CDT A;  2RNA A;  2D1X A;  1ABO A;  2KYB A;  1YN8 A;  1T0J A;  4ZNX A;  2L3S A;  3UAT A;  1WDX A;  2LJ0 A;  2EYY A;  3TVT A;  4J9E A;  1PNJ A;  4Q4G X;  1CSK A;  1ABQ A;  2EBP A;  2LQN A;  2GNC A;  2EGA A;  5ECA A;  2CRE A;  2EGE A;  2FRY A;  1B3Q A;  1AWJ A;  4JPB W;  1B07 A;  2DL3 A;  5IXB A;  2FPD A;  3PBI A;  2RQW A;  3VS3 A;  1AZG B;  2LNH B;  2D0N A;  4CC4 B;  2EPD A;  2J06 A;  4FSS A;  4J9F A;  2BZ8 A;  1SRL A;  1S1N A;  1NM7 A;  3REA B;  2RQR A;  1X2Q A;  2CT4 A;  5IHN A;  1SEM A;  4Z89 A;  3U23 A;  2JM8 A;  1IO6 A;  4CT3 A;  3VPJ A;  1GCQ A;  4AFU C;  1AEY A;  2F2W A;  4LUD A;  1GFD A;  4FQB A;  2DRK A;  2FO0 A;  2W0Z A;  4Q4N A;  1NLP C;  4FGE A;  2KGT A;  2EYZ A;  4HZB A;  4FGI A;  2B86 A;  1NYG A;  1ZUK A;  3M0T A;  2IOA A;  2XIV A;  2OI3 A;  1EFN A;  1WXT A;  2DL4 A;  3R6N A;  1AD5 A;  4EQ8 A;  3JV3 A;  1AZE A;  1OPK A;  3KFV A;  1WIE A;  2I0N A;  1HSQ A;  2O2O A;  1ZX6 A;  2J6O A;  2KRM A;  2EGC A;  3NE0 A;  4DEY A;  4CC3 A;  2C0T A;  1BBZ A;  4LUE A;  3M0R A;  3UF4 A;  2M0Y A;  2EKH A;  3M0U A;  4HXJ A;  1ZBJ A;  4FDY A;  4Z8A A;  1QLY A;  1SPK A;  1M3C A;  4J9G A;  1JQQ A;  1GBQ A;  2JMA A;  2ENM A;  1X6B A;  1WYX A;  2JT4 A;  2K9G A;  2KRS A;  1LCK A;  3REB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...