2FG0A

Crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
222
structure length
222
Chain Sequence
KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTSQKATHVGLYLADGYYIHSSGKDQGRDGIGIDILSEQGDAVSLSYYQQLRGAGRVFKSYEPQRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG0791: Cell wall-associated hydrolases (invasion-associate
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Hydrolase
total genus 65
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fg0A01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2fg0A02
1RI9A 1WA7A 2EGEA 2RPNA 1YWPA 3EG1A 2EGAA 5EC7A 1ZBJA 1NYFA 4JJDA 1WX6A 2O9SA 3PBCA 2DX1A 2DVJA 2DJQA 1AWOA 4FGIA 1E6HA 4OMLA 2IF6A 4ORZA 2KXDA 1I1JA 2KYMA 2EPDA 1X6GA 2YUNA 1T3SA 2HBWA 3EG2A 4J9CA 2IO7A 3I35A 2EBPA 1WXTA 2L0AA 1W1FA 3VRZA 1KJWA 2IOBA 1NM7A 1X2KA 1HSQA 1ZUUA 1NLPC 1M3CA 1OPKA 1U3OA 5HCKA 3H41A 4E6RA 1ARKA 1AVZC 4Q4NA 2RNAA 3GBQA 4AFUC 1UG1A 1JXMA 2MIOA 4A63B 2K6DA 2QDLA 1WI7A 2D1XA 1WXBA 2LX7A 3ULRB 5IH2A 1SSHA 4AG1C 2JM9A 2YUQA 5FWBA 1WFWA 5FWCA 5I22A 1HD3A 2EYXA 3H0IA 3H0HA 1GCQC 3KFVA 3M0UA 2DL4A 4CC2A 3SEMA 2CREA 4Z89A 2K7AA 1YWOA 2C0TA 2IO9A 4IIOA 1ZSGA 4J9IA 1K4US 2HEQA 2SRCA 4F4MA 2CH4A 2KRNA 3CQTA 4GBQA 1GRIA 2K2MA 2OI3A 1OPLA 1AWXA 2G6FX 4FDYA 4Z88A 1E6GA 3VS6A 2O88A 1UTIA 1S1NA 3IQLA 1ZUKA 4EIKA 4RTTA 1CKAA 4QT7A 3NHNA 1LCKA 1AOJA 1JU5C 2GNCA 1VYVA 1AD5A 4D8DA 4F16A 1UE9A 4CSHA 4J9DA 2J6OA 4JXBA 4LNPA 2DILA 1K1ZA 2O31A 2JM8A 2MOXA 3A30A 4DEXA 1ABOA 4LUDA 2KNBB 2PTKA 2K3AA 1QLYA 2VKNA 1KIKA 3VS4A 1RLPC 2FPDA 4EQAA 4F0WA 4JZ3A 1CSKA 3NE0A 2V1RA 2AKLA 4K11A 1T0HA 2RQWA 1X27A 2A28A 4ZNXA 1N5ZA 2P4RA 3M0SA 2YUOA 1K0SA 3I5RA 1BB9A 4HZ9A 2D8HA 4CC7A 2B86A 3REBB 3I86A 1WYXA 3NMZC 2AZSA 2L2PA 1W70A 1JO8A 3RNJA 2EYWA 1AWJA 1UFFA 3A2ZA 1NG2A 1Z9ZA 3PE0A 1I0CA 1X43A 2EKHA 1NEBA 1QCFA 1VYTA 2I0NA 4IIMA 1I07A 2ROLA 1TG0A 2VPMA 2DBMA 4RTUA 4CC4B 1B3QA 5IXBA 3TVTA 1M27C 2F2WA 5FW9A 1OEBA 1W6XA 5IXFA 2ECZA 3M0RA 4LE9A 3THKA 1T3LA 3QWXX 2CT4A 1AWWA 3M0QA 2GBQA 2C0OA 2A08A 1FMKA 2KRMA 4OMPA 1PWTA 2VWFA 2GTOA 3I5SA 4EQ8A 1GBQA 3PVLA 2DNUA 4HXJA 2DM1A 2YUPA 2W10A 4J9BA 4OMQA 1PHTA 1G83A 3U23A 1SPKA 2HCKA 2J06A 1PKTA 2JMCA 3GT2A 4J9GA 4RTYA 5IHNA 1U5SA 2DL3A 3VS2A 3ZL7C 4HVVA 2K3BA 1HJDA 2FG0A 1RUWA 2DRMA 3UA7A 2K1GA 3M0TA 4J9HA 1SRMA 1PNJA 2JTEA 5GJWB 3R6NA 4X1VA 3VS0A 2C0IA 1SHGA 2A37A 1WXUA 3O98A 2DA9A 2JXBA 4OLKA 1H8KA 1UHFA 2O2OA 4KRTA 1PKSA 2F2VA 3S0QA 3C0CA 1AZGB 2LQNA 2RQTA 2DL7A 1MUZA 3TSZA 1OOTA 1YN8A 3UATA 2ED1A 4M4ZA 3A2YA 1KSWA 2RMOA 2JMAA 4GLMA 2FEIA 3EHRA 4RTXA 1KFZA 2DE0X 1XOVA 1VA7A 2IO8A 4Z8AA 1JQQA 1UJ0A 2FPFA 4FGDA 4LJ1A 2JS0A 2RQUA 1Z9QA 1M3AA 1U06A 3PVQA 1WLPB 2GTJA 4FSSA 2DL5A 2HDAA 2PNIA 4OMNA 2VOBA 2OAWA 4RUGA 2KYBA 4OMMA 2DYBA 1ZLMA 3LH5A 3VPJA 2RQVA 3JV3A 1CKBA 1AEYA 3M1UA 1VYUA 4HPEA 5IHIA 3NGPA 1B07A 4OMOA 1QKWA 3FJ5A 2D0NA 2L3SA 4HVWA 2KGTA 2KROA 1NEGA 2M0YA 3H0FA 1UUEA 2IOAA 3RBBB 2CSQA 2EGCA 1MV3A 1K76A 2YSQA 2YDLA 1RLQC 2ENMA 4LUEA 1UDLA 4AG2C 2LP5A 2KT1A 2DBKA 1QKXA 1TUDA 2JT4A 3O5ZA 1GL5A 2A36A 2DLPA 4JJCA 3QWYA 3PBIA 2J7IA 4HZBA 2DRKA 2MCNA 4AFZC 4EOBA 2XMFA 4DEYA 1QWEA 1AZEA 2J6KA 1T0JA 1TUCA 4JJBA 1UECA 1YCSB 1ZX6A 1JEGA 5I11A 4AFQC 4FQBA 1ZUYA 1WIEA 2CUBA 4JZ4A 1G2BA 2V1QA 1A0NB 1NYGA 3TSWA 2CSIA 2KEAA 1K0XA 4CT3A 2RN8A 2LCSA 1GFDA 2LMJA 2AKKA 2CUDA 2JS2A 1IO6A 3VS7A 2JW4A 4F17A 2CDTA 2CH4W 2VPSA 1YNZA 4F0VA 3EHQA 4RTVA 4Q4GX 1YP5A 2X3XD 2L3PA 4Q4TA 2M51A 2BZ8A 4HVUA 2FRWA 2EVRA 2O9VA 1BU1A 2SEMA 2EW3A 4HCKA 4J9FA 1ABQA 2VVKA 3I9QA 3KW0A 1FYNA 2LJ1A 3NPFA 2KT8A 3EG0A 1WDXA 2ROTA 3EG3A 2X3WD 1Y0MA 2E5KA 2LNHB 4AFSC 3VS3A 2GGRA 2NUZA 4F14A 2FPEA 1X2QA 2XIVA 5L23A 2BZYA 2DL8A 2W0ZA 3A98A 2L3QA 4CGKA 1OV3A 2YT6A 4CC3A 1SEMA 4LN2A 3VRYA 2KR3A 2K9GA 5IHKA 1E7OA 4WCIA 3M0PA 2LQWA 2ED0A 1GFCA 1V1CA 1PRMC 1SRLA 4RTZA 1PRLC 1EFNA 3EGUA 4R0KA 1UJYA 2KRSA 1X69A 2EYZA 2K79A 1GBRA 2RF0A 2BZXA 4J9EA 3UA6A 2LRJA 1MV0B 1M8MA 3VS1A 5GJVB 4ESRA 2D8JA 2PZ1A 2LJ0A 3VPIA 1M3BA 2BTTA 2FRYA 1M30A 2NWMA 3SHWA 2DF6A 2LJ3A 1GCPA 2ABLA 2OJ2A 1BK2A 2IIMA 1NLOC 2KBTA 1J3TA 4JPBW 4D8KA 1QWFA 2DMOA 2AK5A 1K9AA 1GCQA 2RQRA 5ECAA 1BBZA 2ESWA 4FQAA 1X6BA 2H8HA 2KE9A 2CT3A 2AZVA 2J6FA 4RTWA 2F2XA 4Y92A 2FO0A 2LZ6B 2J05A 1H92A 2KXCA 3UF4A 2EYYA 1JXOA 3REAB 4FGEA 1SHFA 2GQIA 1H3HA 2EQIA 2HSPA 1UGVA 1UHCA 1Y57A 3VS5A
chains in the Genus database with same CATH superfamily
1RI9A 2EGEA 2RPNA 4J7IA 4C8QB 1NYFA 1BCMA 1QVGS 4DOWA 2XICA 3PBCA 8AT1B 2DVJA 4EDUA 1OZ2A 4FGIA 1E6HA 4PJOE 1UB4A 2M02A 2EPDA 1Y96A 4M78C 1ACMB 3J7AF 4J9CA 3I35A 2EBPA 2VC8A 1WXTA 1NM7A 5KH6A 1NPPA 1VQPT 1M3CA 3CCJQ 1AVZC 3DB4A 2ZPEB 4E7KA 4A54A 3G4SA 5EG2A 4PLIA 3TQ7P 2VXFA 3L2UA 2QDLA 1VQMQ 2LX7A 2ZPFB 1SSHA 4AG1C 2YUQA 2VGMA 2EAYA 3JB9I 1WFWA 1MMGA 3H0HA 1GCQC 2DTIA 2IG0A 4C8QA 1IRXA 1YJWA 3SEMA 2CREA 4Z02A 1K8AC 5GMKl 5GANd 2IO9A 3CMAQ 1VQ5Q 5CKBA 3VV0A 1YJWQ 1YJNT 3O8VA 2OI3A 1OPLA 3SDZA 3OYLA 1LJOA 1S1NA 4M7AE 3IQLA 4IURA 3GPLA 1ZUKA 4EIKA 4M77G 1AOJA 1NBEB 4F16A 1UE9A 1Q82C 3R6OA 3HFNA 2J6OA 3L1AA 2DILA 1K1ZA 2JM8A 5GANh 3J80E 2KNBB 3GIBA 1QLYA 1VQOT 2P4TA 2VKNA 3JB9G 1RLPC 2DIQA 1D1CA 2JVVA 3EH1A 1QCOA 5A2QE 2A28A 4WF2A 2RHYA 1K0SA 3EFRA 3ME9A 1BB9A 4CI0C 2DTOA 4HZ9A 4CC7A 4LXCA 3REBB 2OTLA 3QG1A 4GY5A 1VQ7T 1W70A 1O9SA 1MGQA 1WHLA 1AWJA 1UFFA 2EJ9A 1S72T 2OTLQ 1MMAA 4KUIA 4F7UG 1NEBA 2QEXQ 1D0ZA 3H8ZA 4IIMA 1VQLA 2ROLA 2LX9A 1TG0A 1RL2A 4RTUA 4M7DG 3TVTA 1M90R 1M27C 1W2BA 2LQ8A 5IXFA 1VQLQ 3PMTA 2BUDA 2X35A 3JRZA 2GBQA 1NJIC 2KMTA 1FMKA 1YJ9T 2ZAEA 2ZPBB 3I5SA 1YITQ 2DNUA 3OB9A 3CMET 4HXJA 2DXUA 4XTYA 5M9OA 1RI0A 3X24B 4OMQA 1YHQT 4LDYA 2YXYA 2RJCA 4JLGA 4HFLA 2J06A 4J83A 4E7JA 2CKKA 4NL2A 2L8DA 2DXBA 4YTLA 5IHNA 1G3SA 3M4YA 3EG9B 4C92E 2FG0A 5GAMd 1RUWA 2XU8A 3FLGA 1QMCA 3HHTB 2K1GA 4J9HA 4OGEA 1VQ9Q 5GJWB 2K5LA 5A0GA 5J26A 3V8JA 1YI2T 3RR6A 3S0QA 2ZPHB 1Y07A 3C0CA 4XU2A 4BE0A 1Q7YC 2RI2A 3KBGA 1IB8A 1VQNA 1PD0A 2COZA 4M4ZA 4GLMA 2RMOA 5GMKj 3E2UA 1Q81C 1KFZA 4RG2A 3UWNA 1JQQA 1UJ0A 4FGDA 3GP8A 3CC7A 3DKMA 2JTMA 2HZYA 3PVQA 4FSSA 2DL5A 1PSEA 4OMNA 1D0XA 2VOBA 2RJFA 2E6NA 5GAMh 1RABB 5KYNA 1KC8C 2M9UA 1ZLMA 1R8OB 3HP9A 2DTHA 3LH5A 3CCST 3JSCA 4M78F 3RIRA 1ZA1B 4N0AA 2KSSA 1VYUA 4HPEA 4EMKB 5LJ3e 1PG5B 2YWWA 3G7ZA 4L59A 2M0YA 4MMLA 3A5ZB 3BDLA 2CSQA 4HFFA 4LDWA 1K76A 2YSQA 2LQKA 1JB0E 2XK0A 4LUEA 2EKOA 3OYEA 1W4SA 4MDXA 4M75D 2CZ6B 1QKXA 1TUDA 1Q86R 1IREB 2RJEA 4FYWB 2X9HA 4C8QC 1IHWA 2DRKA 2XMFA 3QHSA 3GF5A 4FW2A 1UGPB 3BY7A 1TUCA 1QVFS 2FYKA 3CCQT 2MWOA 1VOMA 1ZX6A 1KQSA 1JEGA 5J39A 4J30A 4JZ4A 4C0GA 4N4GA 1I4K1 5IN1A 2HMAA 3MKDA 3I56Q 2E6ZA 2CUDA 1KHCA 1FWZA 2JS2A 4EMKA 2WP7A 4M78B 4OB3B 1OX8A 5KYYB 3M9QA 4ZGEB 3FEOA 2RHXA 4RTVA 2FL7A 1OX9A 5LJ5j 2QXFA 4Q4TA 1RAEB 2M51A 2JUFA 3M57A 1W2BP 3EBQA 4EMHA 4HCKA 4J9FA 3I9QA 5CKFA 3CPWS 2LJ1A 3P8HA 1NZ9A 3RKYA 2E65A 1QCNA 5KE2A 1WDXA 2ROTA 3FJPA 2LNHB 5IAYA 3VS3A 1VQKQ 2A7YA 4C8QD 3BFMA 5GAOq 2NUZA 4F14A 2FPEA 3UT1A 2X4YA 2NUPA 2L3QA 3OBYA 2COYA 4OF1A 3VRYA 3I55T 4L5GA 1M2OA 2P0QA 4BE2A 4M78A 2LQWA 5KYYA 4C0DB 2ED0A 4C5HA 1MHNA 4RTZA 2OX7A 2HL5C 1UJYA 1NE8A 3GNGA 3CPFA 2BZXA 2M0OA 2LRJA 2ZZDA 1MV0B 2QG9B 4PJMA 3VYHB 1TXQA 1WHHA 1WHMA 4JRQA 4MDWA 1M30A 3S3MA 3SHWA 1VIEA 1GCPA 3A1PA 3CCUQ 3H6ZA 4IUQA 1M4ZA 1BIBA 1J3TA 3V8LA 1QWFA 4M75G 3A8GB 1GCQA 1Y7XA 5ECAA 1N8RU 1WQWA 1ZQ1A 1X6BA 3LLRA 3LWHA 3CCRQ 2J6FA 1H641 1U1TA 1D1BA 3E19A 2QAZA 5LL6S 2VASA 1DJ7B 3FIFA 1IGUA 1VQ6T 1AHJB 1M1FA 2GCXA 4C92F 5CIUA 1LPLA 5A0LA 4BB7A 1UGVA 4WTOB 1Y57A 1YIJT 3G6EA 3VS5A 3TEEA 1WA7A 3BW1A 1RAFB 3EG1A 2BIVA 5EC7A 1OYXA 1ZBJA 2CP6A 4JJDA 5LJ3g 3QBYA 5GAOm 3G1JA 4MZPA 4QQ6A 1VQ8Q 3CXCS 2DETA 3EG2A 3RKXA 5GAOr 1I81A 1W1FA 5DY9A 1X2KA 1HSQA 1SKUB 3SB2A 1ZUUA 3CCEA 1NLPC 1OPKA 5D7UA 5FU6C 3RMSA 3NTKA 2X4WA 4E6RA 1ARKA 5CQYA 5KYWB 3CCJT 4JLIA 4FW1A 1AT1B 3GBQA 1WHJA 1UG1A 1JXMA 2ZCFB 2WSCE 3UPUA 3P8DA 3META 3LWIA 2D1XA 1P92A 2DERA 1VQMT 1QVGA 2EYQA 2DXTA 3UDCA 2JM9A 2QTXA 5GAN3 5FWCA 3H0IA 4M77E 4C92B 2DZCA 2BE7D 3CD6A 1HK9A 2ZPGB 2C0TA 5CVIA 3QDFA 4J9IA 1V76A 3CMAT 2HEQA 1VQ5T 2PVDB 2DK3A 5D6WA 4Z88A 1E6GA 2O88A 2G3RA 2DPPB 1Q86U 4RTTA 4QT7A 3NHNA 5KYWA 2GNCA 1WJQA 4D8DA 5DM7R 3FC3A 2OTJQ 4CSHA 2IVWA 2VGNA 4EMKC 4A53A 1LNXA 1M5Q1 3JCMX 5GANe 5HK3A 4PLLA 2MOXA 4LUDA 1M1KR 2K3AA 1KIKA 2QQBA 4FCYA 4X34A 4MZTA 1MNEA 4JZ3A 1CSKA 4C92A 4F7UE 3CC4Q 4CRIA 4K11A 2LDMA 2D9TA 1X27A 3OYIA 1K9MU 2P4RA 3M0SA 2YUOA 4M7DE 1SF9A 3QSUA 1VQ4A 2YLBA 3WVDB 1WYXA 3E1SA 3NMZC 2AZSA 5GAN5 3OYHA 2JJ9A 4JJNK 1NPRA 1JO8A 1WPYA 3RNJA 2EYWA 2CZ7B 3ER0A 4PJOC 2E12A 4PNOA 1Z9ZA 1HXDA 2OTLT 2XIDA 2YRCA 3JCMh 2I0NA 2QEXT 2DBMA 3C12A 5FW9A 5FROA 4NS5A 1W6XA 3OYCA 2XDDA 1VQLT 2CT4A 4PL6A 2C0OA 2CZ1B 4Y28E 5I21A 4ZTFA 4OMPA 2VWFA 2GTOA 4EQ8A 1YITT 1QP3A 3HPWA 2DKGA 1VIFA 4J9BA 2LC4A 3MPUB 3G4SQ 3U23A 2B8AA 1N6AA 1N8RC 5GMKh 1PKTA 2JMCA 3GT2A 4PKCC 2EWNA 4J9GA 3WXMB 1U5SA 1Q95G 3A8MB 1SSFA 3V7CA 3QUIA 2EQJA 1BIAA 3OW2S 2DRMA 1YFNA 3UA7A 1BI3A 1JJ2S 4MMKA 5GMKm 3CCMA 2JTEA 3R6NA 3AT1B 4C0DC 1G5VA 1OQKA 1VQ9T 3OYMA 2HAXA 1QVGP 3O98A 1K73R 2JXBA 4M78D 4IUTA 1C0MA 2O2OA 4ZGDB 4M7AC 2DD5A 2WSEE 2DL7A 3TSZA 2F5KA 3UATA 2LCCA 3QIIA 2LT1A 3OYYA 1VA7A 4Z8AA 4LJ1A 2JS0A 2M1HA 4BUGA 1M3AA 3ZFJA 3VYGA 2MAMA 5GAMe 2QGFB 1C1AA 5LJ5d 4FT4A 4EMGA 1U1SA 5GAN7 2DYBA 4HT9A 3LH0A 1UGSB 4JRIA 2QASA 1AEYA 3CC2A 2V8JA 5IHIA 4OMOA 1QKWA 2QQAA 3DB3A 2L3SA 1LVKA 4JUVA 3H9NA 2RB6A 3VUZA 1UDLA 5GAOp 4AG2C 2BKDN 2CP3A 2KT1A 4J7FA 2DBKA 1WNLA 2A36A 1D1AA 2DVEA 4FIBA 5LJ5h 5GAN8 4JJCA 2LNVA 2MF2A 2AT1B 5KCHA 5GANg 3X25B 3V7RA 1KD1U 4RCBA 4KGXB 4PK4A 2J6KA 4XTVA 4RMOA 4JJBA 3C4SA 5FRNA 4AFQC 4FQBA 1ZUYA 2CP7A 2CUBA 1G2BA 1A0NB 1NYGA 4J5YA 2KK4A 2VYTA 1K0XA 5CKHA 4XTXA 1GFDA 2X4XA 3I56T 3M53A 2XKOC 2CDTA 2VPSA 2F69A 1YNZA 1YCYA 3EHQA 3L2WA 4Q4GX 5L8RE 1YP5A 5HY6A 2DZ9A 3NFCA 4HVUA 4E2FB 2EVRA 5FU6B 1BU1A 3G71A 2EW3A 2VVKA 3QPHA 3L2RA 1PSFA 2XHCA 1YBYA 5I2MA 3RDVA 2RK1A 1K8AR 4C92C 3G71Q 1K9MC 5KE3A 2DEQA 3EG3A 3VKIA 1Y0MA 8ATCB 3X20B 1VQKT 5LJ3f 1X2QA 2L3RA 3VUBA 2XIVA 2BZYA 3A98A 4M7DF 4J8OA 2KVQG 5FU7C 4CGKA 3HRSA 1YJNA 1OV3A 2E4HA 2Y4XA 1C6VX 2HNIA 4ZTJA 3DLLA 1B7TA 2KR3A 2XI9A 4PJJA 1PD1A 4XQ3A 5AYFA 1EX4A 1Q82R 1YJNQ 1GFCA 1V1CA 1SRLA 2VXEA 4M75E 1EFNA 3EGUA 1VQNQ 4R0KA 4PJOF 2KRSA 3A8LB 2K79A 1FMVA 2RF0A 4J9EA 3CC7Q 3VS1A 2VB6A 5GJVB 4ESRA 2D8JA 1VQOA 3EG9A 4Q5WA 2BTTA 2DF6A 2LJ3A 2ABLA 2OJ2A 3TCJA 4BACA 4C92D 1BK2A 2H3EB 3CCUT 3VJPA 2DMOA 2VUBA 1K9AA 2F1LA 4C0FA 4C5EA 2KE9A 2RHIA 5DLQE 4RTWA 4KGVB 3CCRT 1VQ7A 4Y92A 4M7DB 2QA4A 3UF4A 3OYJA 5GAMg 2EYYA 2CYZB 1JXOA 4QQGA 5CO7A 4ME7A 2QA4Q 3LW5E 2HSPA 3MHXA 4J6XA 4PJOB 1WX6A 1JBMA 2O9SA 4OVAA 4XU3A 1NJIR 2DJQA 1AWOA 1WJRA 4MZMA 3CCVA 1RAIB 4ORZA 4HCZA 4DBFA 1I1JA 1X6GA 2DYIA 4D6WA 1VQ8T 2HKQB 2HBWA 4M7AF 3L42A 2JN0A 5D6YA 3URGA 3CCVQ 1YJ9A 1TU0B 2L0AA 3VRZA 2HQEA 3CMEA 3GNFB 3OMGA 3QYHB 1FMWA 1OI1A 1TOVA 1U3OA 4BDYA 2RJDA 1K73U 2XDPA 9ATCB 1YHQA 3OY9A 1YJ9Q 4Q4NA 3CCLA 1OZ3A 1WGSA 5KYXB 3QDRB 2L5QA 4M7DA 4A63B 2YLCA 1ZHIA 2K6DA 2CP2A 2R5MA 4BI8B 1WI7A 3M54A 5GMKi 4AT1B 3ULRB 2QQSA 3CCLQ 2PUKB 4UC4A 3C94A 4HT8A 5I22A 1HD3A 3CXCA 3QYGB 1Q7YR 4F04B 3KFVA 3M0UA 2DL4A 3OS0A 4PJOA 2K57A 2K7AA 1YWOA 3JCMV 1YI2A 3SWNC 4IIOA 1Q81R 1KD1C 1I5OB 1K4US 4F4MA 2CH4A 2KRNA 5CCAA 2RO0A 3CQTA 2IPOB 1AWXA 1KC8R 1FX7A 4M7AB 4JRKA 3CCSA 4RKUE 4J6WA 5KYXA 1LCKA 1JU5C 5CKDA 1R0BG 4BI3A 1AD5A 4O5VA 4J9DA 2RHUA 2OTJT 3HKSA 4JXBA 3D7SB 1OU9A 2O31A 3A8OB 1R77A 1ABOA 3A30A 4C5IA 3CPWP 1WZOA 1M2VB 2PTKA 1M90U 3P8BB 4F0WA 2FPDA 4KULA 4E7LA 1KQSS 3NE0A 2RQWA 1BI1A 3CC4T 1D3BB 4N4IA 1RACB 4QVDA 1BI0A 2CS7A 2MI6A 2RA2A 3QXEB 3EGDB 2GFUA 2JOYA 4OP0A 1EIFA 2D8HA 4DBRA 2D6FA 2B86A 3MEVA 4FYYB 2LT4A 4VUBA 2RH2A 2RK2A 4M7AA 2P0PA 3CCQA 1EZZB 3A2ZA 1NG2A 3WVEB 1K8AU 3JCMe 4FL6A 1I0CA 3G6EQ 1X43A 2EKHA 2EQMA 4XTUA 4E7SA 3HRUA 3JCMQ 2M16A 4CC4B 4A4FA 1TUGB 1B3QA 5IXBA 2I2LA 5GAOl 3J81E 3PMIA 1M2VA 1TH7A 3THKA 4M75F 4DBQA 1T3LA 4QVCA 2HKNA 3FB9A 2FHDA 2CZ0B 3EGXB 2LVMA 2A08A 2KRMA 1PWTA 3CCEQ 2DIGA 1GBQA 2K4YA 3PVLA 4C8QG 2VV5A 3X26B 2DM1A 2QYZA 3EGDA 1N27A 3CBOA 1G83A 5GMKe 2HCKA 4IUUA 2QDYB 3G4ST 2Y90A 4PFZA 4QVZA 4M77C 4RTYA 2P0KA 2L89A 5GANf 1N9RA 3OYNA 3VS2A 2E10A 1D09B 3ZL7C 5GAN6 4FYXB 1JRIA 4Y91A 2R5AA 5KYUB 2QGGA 1PNJA 2LTOA 2NLUA 4ANJA 3CD6Q 4J32A 2JZ2A 3VS0A 3RKWA 2OAUA 1SHGA 1YJWT 3JCMJ 2FZGB 5FU7B 2DA9A 4OLKA 3Q1JA 3M56A 2F2VA 5GAN4 4LDUA 4QKUA 3CXCP 1MUZA 3OS2A 3FRNA 3A2YA 2WACA 3EHRA 4RTXA 2DE0X 1XOVA 2IO8A 1U06A 1WLPB 3MEUA 2X4JA 2C06A 2OAWA 3LX7A 4RUGA 2KYBA 2KY9A 4OMMA 2RQVA 5IT9E 3HFOA 2RD1A 3OW2A 1BYMA 4IUVA 1JJ2A 3NGPA 1B07A 3FJ5A 4HVWA 2KGTA 2KROA 2KAFA 1NEGA 4BE1A 4M7DC 4E7ZA 4OB1B 5KYUA 2O4XB 3EFOB 3RBBB 2DAQA 1MV3A 2MMPA 1RLQC 2ENMA 1O75A 1XQHA 1VQ6A 3O5ZA 5LJ5e 5A0DA 1GL5A 5HKCA 2MK5A 2AHJB 1HYOA 1VQ4Q 1YIJA 2J7IA 3ASKA 4BY6C 2MCNA 2E5QA 4AFZC 4EOBA 4DEYA 4LD9K 1QWEA 1AZEA 1PC0A 1H3ZA 2H3JA 5I11A 1ZSZB 5LJ3j 1G3YA 3TSWA 2CSIA 2KEAA 2RN8A 2LCSA 1Q7YU 4KH0B 1G3WA 2LMJA 2K2VA 3VS7A 1G3TA 3OYKA 3JCMP 3OMCA 2GQVA 2HSEB 2CH4W 1Q81U 4QW2A 2QQRA 3A8HB 4FT2A 4F0VA 1X75C 4M78E 3CCJA 2X3XD 2O4XA 3EFOA 5CQXA 4P5NA 5CK9A 2BZ8A 1M90C 3MP1A 4M7DD 1KC8U 4EPCA 1VQMA 3KW0A 1FYNA 2P84A 4ELZC 3JCMg 5GAMf 2KT8A 3EG0A 3S3NA 2GF7A 2V8KA 2YRDA 5DLOA 2X3WD 3G71T 2YRVA 2ZGWA 4JS4A 2E5KA 4AFSC 2GGRA 4BI4A 5GAOn 4PJOD 5AT1B 1KHIA 3CMAA 1ZSZA 1VQ5A 2YT6A 4CC3A 3CCMQ 3SWNB 1VUBA 3PFSA 5IHKA 3OYFA 3QO3A 1PRMC 3MEWA 3OSVA 3PT9A 1UGRB 3OYBA 3KXTA 3BDUA 2A0FB 1VQNT 3E9FA 4AMCA 3QKJA 3RUXA 1WJSA 3UA6A 1M8MA 3F70A 3ZEHA 2AIRB 2KDSA 3JCMW 3CC7T 1TWBA 2NUTB 2HL3A 2LJ0A 3VPIA 1M3BA 2FRYA 4BDZA 3M5AA 4HA8A 2R57A 4B6MA 4OB0B 3EFSA 4XK8E 3HRTA 3CC2Q 2IIMA 3DLMA 4JPBW 3L2VA 4R55A 4DOVA 3FDRA 2K5IA 2FZKB 1XJWB 4FQAA 2H8HA 4RCCA 4DA4A 3OW2P 2F2XA 1OULA 3SWNA 4NL3A 4KBMB 3OBWA 2FO0A 1JJ2P 5CKEA 2J05A 2KXCA 4M7AD 3GLXA 4M77F 4PJNA 1TSFA 2PVOB 1M9SA 1SHFA 2V8IA 5FRMA 2GQIA 1MMNA 1UHCA 2QA4T 2BE9B 2HBPA 2QEXA 1YWPA 2EGAA 3HTRA 4JRPA 1Q86C 4KT0E 2KQWA 2DX1A 3RESA 3JB9F 2NUTA 4OMLA 2IF6A 1VQPA 2KXDA 2KYMA 2ZPIB 2YUNA 1T3SA 3M59A 2DD4A 3QJ6A 4XU1A 3AHUA 2IO7A 3PGGA 1VQPQ 1KJWA 2IOBA 3C95A 3CCVT 2DO3A 1N8RR 4C0ZA 1YITA 4ATOA 5LJ5g 5HCKA 3H41A 2V26A 2XDBA 4PFPA 2MPXC 4JS5A 4A4EA 2RNAA 3RMQA 4AFUC 3QZ5B 4DBHA 4ZGJB 2MIOA 4KH1B 3L2ZA 2E3HA 1QVFA 2HQXA 4PJOG 1OU8A 2EJFA 2DXCA 1WXBA 5IH2A 4F7UF 3JAME 2K3YA 2EIFA 4M78G 3CCLT 6AT1B 2PQWA 5FWBA 4M77B 1M1KU 4FSXA 2EYXA 1VQ9A 4CC2A 1D0YA 1ZA2B 3S6WA 4IKFA 4Z89A 3M58A 1ZSGA 2SRCA 3HSBA 4KUDK 4M75C 4GBQA 1I5LA 1GRIA 2K2MA 4L6V5 2CGHA 1QW1A 3CPWA 4FU6A 2RI3A 2JTFA 1RAGB 1MNDA 2CP5A 2G6FX 4FDYA 1M1GA 3VS6A 1UTIA 2PVGB 4N4HA 1XNIA 1N9SA 3PIPA 3JCMb 1KK7A 1CKAA 2A3LA 1PM3A 1VYVA 2GFAA 2D0QB 3MCAB 4LNPA 1SG5A 3L2QA 3INZA 4DEXA 3M4GA 1VQOQ 4QQDA 3SD4A 2MYSA 4M77A 2E41A 3OQ5A 3VS4A 4EQAA 4F7UB 3BE3A 2COWA 3PNWC 1W2BS 5CAIA 2EQUA 1BI2A 1XTDA 2V1RA 4ZN3A 4M7AG 2AKLA 2WSFE 1T0HA 1BCOA 4ZNXA 1N5ZA 3T9NA 2RHZA 1KQ1A 3I5RA 1S72A 4B9XA 2DEUA 1VQ7Q 3E9GA 3I86A 2E70A 4FYVB 2L2PA 4PJLA 5D6XA 3OS1A 1ZSZC 1S72Q 5J3BA 4HKEA 1UEBA 2K3XA 5GANj 4PFOA 2PU9B 3PTAA 4C8QE 3PE0A 4BY6B 3RERA 1G8XA 1QCFA 1VYTA 1I07A 3G6ET 2E3IA 3I56A 3TU4K 2VPMA 4TVRA 2DJZA 2NUPB 2EFIA 1V29B 2F2WA 1OEBA 1RADB 4XU0A 2ECZA 3M0RA 4LE9A 2E1HA 4DQ2A 4F7UA 3QWXX 1AWWA 3M0QA 2RI5A 3MEAA 1LOJA 1WHGA 4A4KA 3CMEQ 1K9MR 3CCET 1QP2A 2YUPA 4RG8A 2F5TX 2W10A 1YHQQ 2XD0A 1PHTA 5FLXE 4O6JA 1SPKA 2QI2A 2R58A 3MP6A 4E7HA 1Y71A 1VQKA 2HD0A 4XTWA 2KI7A 4JURA 2DL3A 3QJYA 4HVVA 3JB9J 2K3BA 4IUPA 1HJDA 3QZ9B 1QQJA 4J6YA 4LDXA 3M0TA 4OGCA 1QVFP 1SRMA 2LRQA 4X1VA 3V7SA 2C0IA 2K5FA 2Z0WA 3CD6T 2A37A 1YI2Q 1I8FA 1WXUA 4OMFB 5C0MA 5LJ3d 5I2SA 1H8KA 1UHFA 4KRTA 3S3OA 1PKSA 3OYGA 4V2SA 1AZGB 1ZBXA 2LQNA 2RQTA 1OOTA 3ZBDA 1YN8A 5HK0A 2ED1A 1KSWA 2JMAA 2FEIA 1TTHB 4C92G 2FPFA 1BKBA 2RQUA 1Z9QA 4NOYA 4X9CA 4LD6A 2GTJA 1F1BB 2HDAA 2PNIA 2LCLA 3CCSQ 4ELYC 4HCCA 4E7IA 3JCMf 3VPJA 3JV3A 2QTVA 1CKBA 4XTZA 3M1UA 3CCUA 2PUOB 2XG8D 1RAAB 7AT1B 2D0NA 3GOXA 5LJ3h 3OYAA 5KCOA 5GAN2 3H0FA 1UUEA 3KUFA 2IOAA 3CCRA 3LYIA 2MWPA 1RAHB 2EGCA 3MP8A 1M1KC 2YDLA 1KG1A 2CP0A 2LP5A 3EAEA 4JDSA 2JT4A 1FXXA 1GXIE 2FVUA 2EQKA 3JCMc 2DLPA 5GAMj 1B34B 3CBPA 3QWYA 3PBIA 3LGFA 1VQ4T 4LDVA 4HZBA 4ZN1A 1U8RA 3CCQQ 1T0JA 1UECA 1YCSB 3LGLA 2X51A 2DFUA 1VQ8A 1QVPA 1WIEA 3SFMA 2V1QA 2FB7A 4CT3A 2AKKA 4HFKA 1IO6A 2JW4A 4F17A 3PIOA 1D3BA 4XAXB 2E64A 4A4HA 1Q82U 3M55A 2L3PA 2QK0A 3OSSC 2FRWA 4GLKA 2O9VA 5C6SA 1KQSP 2NYSA 2SEMA 1ABQA 2Y4YA 4N0AC 3NPFA 2EJGA 1WHKA 3HL8A 2HQHA 1B34A 3MO8A 1KD1R 3OYDA 3I55A 1R0CB 4C5GA 5L23A 2DL8A 2W0ZA 2ATCB 3OA6A 3TREA 1M8VA 3OS5A 3I55Q 1SEMA 4LN2A 3CBMA 3JB9H 3CCMT 2K9GA 3NTIA 3EGXA 3VU3C 1E7OA 3EH2A 4WCIA 4E47A 3M0PA 4A4GA 3MJXA 4M75B 5LJ5f 1PRLC 4C8QF 1TS9A 2O01E 4KGZB 1IXDA 1X69A 2OTJA 2EYZA 1K73C 2JNGA 1GBRA 3CEYA 4HCBA 1X6OA 2PZ1A 1NJIU 2NWMA 1IZ6A 2RM4A 4FM4B 1Y96B 4M77D 3CC4A 1NLOC 2KBTA 1IHVA 4D8KA 3CC2T 2AK5A 2RQRA 3JCMd 4B9WA 1BBZA 2ESWA 2QQ9A 2YHTA 2CT3A 2AZVA 3V8KA 4OB2B 3JB9D 4R56A 1KQ2A 5CR2A 1PCXA 2LZ6B 1H92A 1IGQA 1VQ6Q 4M75A 3NTHA 3X28B 1X01A 2FZCB 4II1A 4BD3A 3REAB 4FGEA 1MMDA 1WQ7A 1YIJQ 2EQIA 1H3HA 1UGQB 3N5BB 4X9DA
chains in the Genus database with same CATH topology
1RI9A 1WA7A 2EGEA 2RPNA 1YWPA 3EG1A 2EGAA 5EC7A 1ZBJA 1NYFA 4JJDA 1WX6A 2O9SA 3PBCA 2DX1A 2DVJA 2DJQA 1AWOA 4FGIA 1E6HA 4OMLA 2IF6A 4ORZA 2KXDA 1I1JA 2KYMA 2EPDA 1X6GA 2YUNA 1T3SA 2HBWA 3EG2A 4J9CA 2IO7A 3I35A 2EBPA 1WXTA 2L0AA 1W1FA 3VRZA 1KJWA 2IOBA 1NM7A 1X2KA 1HSQA 1ZUUA 1NLPC 1M3CA 1OPKA 1U3OA 5HCKA 3H41A 4E6RA 1ARKA 1AVZC 4Q4NA 2RNAA 3GBQA 4AFUC 1UG1A 1JXMA 2MIOA 4A63B 2K6DA 2QDLA 1WI7A 2D1XA 1WXBA 2LX7A 3ULRB 5IH2A 1SSHA 4AG1C 2JM9A 2YUQA 5FWBA 1WFWA 5FWCA 5I22A 1HD3A 2EYXA 3H0IA 3H0HA 1GCQC 3KFVA 3M0UA 2DL4A 4CC2A 3SEMA 2CREA 4Z89A 2K7AA 1YWOA 2C0TA 2IO9A 4IIOA 1ZSGA 4J9IA 1K4US 2HEQA 2SRCA 4F4MA 2CH4A 2KRNA 3CQTA 4GBQA 1GRIA 2K2MA 2OI3A 1OPLA 1AWXA 2G6FX 4FDYA 4Z88A 1E6GA 3VS6A 2O88A 1UTIA 1S1NA 3IQLA 1ZUKA 4EIKA 4RTTA 1CKAA 4QT7A 3NHNA 1LCKA 1AOJA 1JU5C 2GNCA 1VYVA 1AD5A 4D8DA 4F16A 1UE9A 4CSHA 4J9DA 2J6OA 4JXBA 4LNPA 2DILA 1K1ZA 2O31A 2JM8A 2MOXA 3A30A 4DEXA 1ABOA 4LUDA 2KNBB 2PTKA 2K3AA 1QLYA 2VKNA 1KIKA 3VS4A 1RLPC 2FPDA 4EQAA 4F0WA 4JZ3A 1CSKA 3NE0A 2V1RA 2AKLA 4K11A 1T0HA 2RQWA 1X27A 2A28A 4ZNXA 1N5ZA 2P4RA 3M0SA 2YUOA 1K0SA 3I5RA 1BB9A 4HZ9A 2D8HA 4CC7A 2B86A 3REBB 3I86A 1WYXA 3NMZC 2AZSA 2L2PA 1W70A 1JO8A 3RNJA 2EYWA 1AWJA 1UFFA 3A2ZA 1NG2A 1Z9ZA 3PE0A 1I0CA 1X43A 2EKHA 1NEBA 1QCFA 1VYTA 2I0NA 4IIMA 1I07A 2ROLA 1TG0A 2VPMA 2DBMA 4RTUA 4CC4B 1B3QA 5IXBA 3TVTA 1M27C 2F2WA 5FW9A 1OEBA 1W6XA 5IXFA 2ECZA 3M0RA 4LE9A 3THKA 1T3LA 3QWXX 2CT4A 1AWWA 3M0QA 2GBQA 2C0OA 2A08A 1FMKA 2KRMA 4OMPA 1PWTA 2VWFA 2GTOA 3I5SA 4EQ8A 1GBQA 3PVLA 2DNUA 4HXJA 2DM1A 2YUPA 2W10A 4J9BA 4OMQA 1PHTA 1G83A 3U23A 1SPKA 2HCKA 2J06A 1PKTA 2JMCA 3GT2A 4J9GA 4RTYA 5IHNA 1U5SA 2DL3A 3VS2A 3ZL7C 4HVVA 2K3BA 1HJDA 2FG0A 1RUWA 2DRMA 3UA7A 2K1GA 3M0TA 4J9HA 1SRMA 1PNJA 2JTEA 5GJWB 3R6NA 4X1VA 3VS0A 2C0IA 1SHGA 2A37A 1WXUA 3O98A 2DA9A 2JXBA 4OLKA 1H8KA 1UHFA 2O2OA 4KRTA 1PKSA 2F2VA 3S0QA 3C0CA 1AZGB 2LQNA 2RQTA 2DL7A 1MUZA 3TSZA 1OOTA 1YN8A 3UATA 2ED1A 4M4ZA 3A2YA 1KSWA 2RMOA 2JMAA 4GLMA 2FEIA 3EHRA 4RTXA 1KFZA 2DE0X 1XOVA 1VA7A 2IO8A 4Z8AA 1JQQA 1UJ0A 2FPFA 4FGDA 4LJ1A 2JS0A 2RQUA 1Z9QA 1M3AA 1U06A 3PVQA 1WLPB 2GTJA 4FSSA 2DL5A 2HDAA 2PNIA 4OMNA 2VOBA 2OAWA 4RUGA 2KYBA 4OMMA 2DYBA 1ZLMA 3LH5A 3VPJA 2RQVA 3JV3A 1CKBA 1AEYA 3M1UA 1VYUA 4HPEA 5IHIA 3NGPA 1B07A 4OMOA 1QKWA 3FJ5A 2D0NA 2L3SA 4HVWA 2KGTA 2KROA 1NEGA 2M0YA 3H0FA 1UUEA 2IOAA 3RBBB 2CSQA 2EGCA 1MV3A 1K76A 2YSQA 2YDLA 1RLQC 2ENMA 4LUEA 1UDLA 4AG2C 2LP5A 2KT1A 2DBKA 1QKXA 1TUDA 2JT4A 3O5ZA 1GL5A 2A36A 2DLPA 4JJCA 3QWYA 3PBIA 2J7IA 4HZBA 2DRKA 2MCNA 4AFZC 4EOBA 2XMFA 4DEYA 1QWEA 1AZEA 2J6KA 1T0JA 1TUCA 4JJBA 1UECA 1YCSB 1ZX6A 1JEGA 5I11A 4AFQC 4FQBA 1ZUYA 1WIEA 2CUBA 4JZ4A 1G2BA 2V1QA 1A0NB 1NYGA 3TSWA 2CSIA 2KEAA 1K0XA 4CT3A 2RN8A 2LCSA 1GFDA 2LMJA 2AKKA 2CUDA 2JS2A 1IO6A 3VS7A 2JW4A 4F17A 2CDTA 2CH4W 2VPSA 1YNZA 4F0VA 3EHQA 4RTVA 4Q4GX 1YP5A 2X3XD 2L3PA 4Q4TA 2M51A 2BZ8A 4HVUA 2FRWA 2EVRA 2O9VA 1BU1A 2SEMA 2EW3A 4HCKA 4J9FA 1ABQA 2VVKA 3I9QA 3KW0A 1FYNA 2LJ1A 3NPFA 2KT8A 3EG0A 1WDXA 2ROTA 3EG3A 2X3WD 1Y0MA 2E5KA 2LNHB 4AFSC 3VS3A 2GGRA 2NUZA 4F14A 2FPEA 1X2QA 2XIVA 5L23A 2BZYA 2DL8A 2W0ZA 3A98A 2L3QA 4CGKA 1OV3A 2YT6A 4CC3A 1SEMA 4LN2A 3VRYA 2KR3A 2K9GA 5IHKA 1E7OA 4WCIA 3M0PA 2LQWA 2ED0A 1GFCA 1V1CA 1PRMC 1SRLA 4RTZA 1PRLC 1EFNA 3EGUA 4R0KA 1UJYA 2KRSA 1X69A 2EYZA 2K79A 1GBRA 2RF0A 2BZXA 4J9EA 3UA6A 2LRJA 1MV0B 1M8MA 3VS1A 5GJVB 4ESRA 2D8JA 2PZ1A 2LJ0A 3VPIA 1M3BA 2BTTA 2FRYA 1M30A 2NWMA 3SHWA 2DF6A 2LJ3A 1GCPA 2ABLA 2OJ2A 1BK2A 2IIMA 1NLOC 2KBTA 1J3TA 4JPBW 4D8KA 1QWFA 2DMOA 2AK5A 1K9AA 1GCQA 2RQRA 5ECAA 1BBZA 2ESWA 4FQAA 1X6BA 2H8HA 2KE9A 2CT3A 2AZVA 2J6FA 4RTWA 2F2XA 4Y92A 2FO0A 2LZ6B 2J05A 1H92A 2KXCA 3UF4A 2EYYA 1JXOA 3REAB 4FGEA 1SHFA 2GQIA 1H3HA 2EQIA 2HSPA 1UGVA 1UHCA 1Y57A 3VS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RI9 A;  1WA7 A;  2EGE A;  2RPN A;  1YWP A;  3EG1 A;  2EGA A;  5EC7 A;  1ZBJ A;  1NYF A;  4JJD A;  1WX6 A;  2O9S A;  3PBC A;  2DX1 A;  2DVJ A;  2DJQ A;  1AWO A;  4FGI A;  1E6H A;  4OML A;  2IF6 A;  4ORZ A;  2KXD A;  1I1J A;  2KYM A;  2EPD A;  1X6G A;  2YUN A;  1T3S A;  2HBW A;  3EG2 A;  4J9C A;  2IO7 A;  3I35 A;  2EBP A;  1WXT A;  2L0A A;  1W1F A;  3VRZ A;  1KJW A;  2IOB A;  1NM7 A;  1X2K A;  1HSQ A;  1ZUU A;  1NLP C;  1M3C A;  1OPK A;  1U3O A;  5HCK A;  3H41 A;  4E6R A;  1ARK A;  1AVZ C;  4Q4N A;  2RNA A;  3GBQ A;  4AFU C;  1UG1 A;  1JXM A;  2MIO A;  4A63 B;  2K6D A;  2QDL A;  1WI7 A;  2D1X A;  1WXB A;  2LX7 A;  3ULR B;  5IH2 A;  1SSH A;  4AG1 C;  2JM9 A;  2YUQ A;  5FWB A;  1WFW A;  5FWC A;  5I22 A;  1HD3 A;  2EYX A;  3H0I A;  3H0H A;  1GCQ C;  3KFV A;  3M0U A;  2DL4 A;  4CC2 A;  3SEM A;  2CRE A;  4Z89 A;  2K7A A;  1YWO A;  2C0T A;  2IO9 A;  4IIO A;  1ZSG A;  4J9I A;  1K4U S;  2HEQ A;  2SRC A;  4F4M A;  2CH4 A;  2KRN A;  3CQT A;  4GBQ A;  1GRI A;  2K2M A;  2OI3 A;  1OPL A;  1AWX A;  2G6F X;  4FDY A;  4Z88 A;  1E6G A;  3VS6 A;  2O88 A;  1UTI A;  1S1N A;  3IQL A;  1ZUK A;  4EIK A;  4RTT A;  1CKA A;  4QT7 A;  3NHN A;  1LCK A;  1AOJ A;  1JU5 C;  2GNC A;  1VYV A;  1AD5 A;  4D8D A;  4F16 A;  1UE9 A;  4CSH A;  4J9D A;  2J6O A;  4JXB A;  4LNP A;  2DIL A;  1K1Z A;  2O31 A;  2JM8 A;  2MOX A;  3A30 A;  4DEX A;  1ABO A;  4LUD A;  2KNB B;  2PTK A;  2K3A A;  1QLY A;  2VKN A;  1KIK A;  3VS4 A;  1RLP C;  2FPD A;  4EQA A;  4F0W A;  4JZ3 A;  1CSK A;  3NE0 A;  2V1R A;  2AKL A;  4K11 A;  1T0H A;  2RQW A;  1X27 A;  2A28 A;  4ZNX A;  1N5Z A;  2P4R A;  3M0S A;  2YUO A;  1K0S A;  3I5R A;  1BB9 A;  4HZ9 A;  2D8H A;  4CC7 A;  2B86 A;  3REB B;  3I86 A;  1WYX A;  3NMZ C;  2AZS A;  2L2P A;  1W70 A;  1JO8 A;  3RNJ A;  2EYW A;  1AWJ A;  1UFF A;  3A2Z A;  1NG2 A;  1Z9Z A;  3PE0 A;  1I0C A;  1X43 A;  2EKH A;  1NEB A;  1QCF A;  1VYT A;  2I0N A;  4IIM A;  1I07 A;  2ROL A;  1TG0 A;  2VPM A;  2DBM A;  4RTU A;  4CC4 B;  1B3Q A;  5IXB A;  3TVT A;  1M27 C;  2F2W A;  5FW9 A;  1OEB A;  1W6X A;  5IXF A;  2ECZ A;  3M0R A;  4LE9 A;  3THK A;  1T3L A;  3QWX X;  2CT4 A;  1AWW A;  3M0Q A;  2GBQ A;  2C0O A;  2A08 A;  1FMK A;  2KRM A;  4OMP A;  1PWT A;  2VWF A;  2GTO A;  3I5S A;  4EQ8 A;  1GBQ A;  3PVL A;  2DNU A;  4HXJ A;  2DM1 A;  2YUP A;  2W10 A;  4J9B A;  4OMQ A;  1PHT A;  1G83 A;  3U23 A;  1SPK A;  2HCK A;  2J06 A;  1PKT A;  2JMC A;  3GT2 A;  4J9G A;  4RTY A;  5IHN A;  1U5S A;  2DL3 A;  3VS2 A;  3ZL7 C;  4HVV A;  2K3B A;  1HJD A;  2FG0 A;  1RUW A;  2DRM A;  3UA7 A;  2K1G A;  3M0T A;  4J9H A;  1SRM A;  1PNJ A;  2JTE A;  5GJW B;  3R6N A;  4X1V A;  3VS0 A;  2C0I A;  1SHG A;  2A37 A;  1WXU A;  3O98 A;  2DA9 A;  2JXB A;  4OLK A;  1H8K A;  1UHF A;  2O2O A;  4KRT A;  1PKS A;  2F2V A;  3S0Q A;  3C0C A;  1AZG B;  2LQN A;  2RQT A;  2DL7 A;  1MUZ A;  3TSZ A;  1OOT A;  1YN8 A;  3UAT A;  2ED1 A;  4M4Z A;  3A2Y A;  1KSW A;  2RMO A;  2JMA A;  4GLM A;  2FEI A;  3EHR A;  4RTX A;  1KFZ A;  2DE0 X;  1XOV A;  1VA7 A;  2IO8 A;  4Z8A A;  1JQQ A;  1UJ0 A;  2FPF A;  4FGD A;  4LJ1 A;  2JS0 A;  2RQU A;  1Z9Q A;  1M3A A;  1U06 A;  3PVQ A;  1WLP B;  2GTJ A;  4FSS A;  2DL5 A;  2HDA A;  2PNI A;  4OMN A;  2VOB A;  2OAW A;  4RUG A;  2KYB A;  4OMM A;  2DYB A;  1ZLM A;  3LH5 A;  3VPJ A;  2RQV A;  3JV3 A;  1CKB A;  1AEY A;  3M1U A;  1VYU A;  4HPE A;  5IHI A;  3NGP A;  1B07 A;  4OMO A;  1QKW A;  3FJ5 A;  2D0N A;  2L3S A;  4HVW A;  2KGT A;  2KRO A;  1NEG A;  2M0Y A;  3H0F A;  1UUE A;  2IOA A;  3RBB B;  2CSQ A;  2EGC A;  1MV3 A;  1K76 A;  2YSQ A;  2YDL A;  1RLQ C;  2ENM A;  4LUE A;  1UDL A;  4AG2 C;  2LP5 A;  2KT1 A;  2DBK A;  1QKX A;  1TUD A;  2JT4 A;  3O5Z A;  1GL5 A;  2A36 A;  2DLP A;  4JJC A;  3QWY A;  3PBI A;  2J7I A;  4HZB A;  2DRK A;  2MCN A;  4AFZ C;  4EOB A;  2XMF A;  4DEY A;  1QWE A;  1AZE A;  2J6K A;  1T0J A;  1TUC A;  4JJB A;  1UEC A;  1YCS B;  1ZX6 A;  1JEG A;  5I11 A;  4AFQ C;  4FQB A;  1ZUY A;  1WIE A;  2CUB A;  4JZ4 A;  1G2B A;  2V1Q A;  1A0N B;  1NYG A;  3TSW A;  2CSI A;  2KEA A;  1K0X A;  4CT3 A;  2RN8 A;  2LCS A;  1GFD A;  2LMJ A;  2AKK A;  2CUD A;  2JS2 A;  1IO6 A;  3VS7 A;  2JW4 A;  4F17 A;  2CDT A;  2CH4 W;  2VPS A;  1YNZ A;  4F0V A;  3EHQ A;  4RTV A;  4Q4G X;  1YP5 A;  2X3X D;  2L3P A;  4Q4T A;  2M51 A;  2BZ8 A;  4HVU A;  2FRW A;  2EVR A;  2O9V A;  1BU1 A;  2SEM A;  2EW3 A;  4HCK A;  4J9F A;  1ABQ A;  2VVK A;  3I9Q A;  3KW0 A;  1FYN A;  2LJ1 A;  3NPF A;  2KT8 A;  3EG0 A;  1WDX A;  2ROT A;  3EG3 A;  2X3W D;  1Y0M A;  2E5K A;  2LNH B;  4AFS C;  3VS3 A;  2GGR A;  2NUZ A;  4F14 A;  2FPE A;  1X2Q A;  2XIV A;  5L23 A;  2BZY A;  2DL8 A;  2W0Z A;  3A98 A;  2L3Q A;  4CGK A;  1OV3 A;  2YT6 A;  4CC3 A;  1SEM A;  4LN2 A;  3VRY A;  2KR3 A;  2K9G A;  5IHK A;  1E7O A;  4WCI A;  3M0P A;  2LQW A;  2ED0 A;  1GFC A;  1V1C A;  1PRM C;  1SRL A;  4RTZ A;  1PRL C;  1EFN A;  3EGU A;  4R0K A;  1UJY A;  2KRS A;  1X69 A;  2EYZ A;  2K79 A;  1GBR A;  2RF0 A;  2BZX A;  4J9E A;  3UA6 A;  2LRJ A;  1MV0 B;  1M8M A;  3VS1 A;  5GJV B;  4ESR A;  2D8J A;  2PZ1 A;  2LJ0 A;  3VPI A;  1M3B A;  2BTT A;  2FRY A;  1M30 A;  2NWM A;  3SHW A;  2DF6 A;  2LJ3 A;  1GCP A;  2ABL A;  2OJ2 A;  1BK2 A;  2IIM A;  1NLO C;  2KBT A;  1J3T A;  4JPB W;  4D8K A;  1QWF A;  2DMO A;  2AK5 A;  1K9A A;  1GCQ A;  2RQR A;  5ECA A;  1BBZ A;  2ESW A;  4FQA A;  1X6B A;  2H8H A;  2KE9 A;  2CT3 A;  2AZV A;  2J6F A;  4RTW A;  2F2X A;  4Y92 A;  2FO0 A;  2LZ6 B;  2J05 A;  1H92 A;  2KXC A;  3UF4 A;  2EYY A;  1JXO A;  3REA B;  4FGE A;  1SHF A;  2GQI A;  1H3H A;  2EQI A;  2HSP A;  1UGV A;  1UHC A;  1Y57 A;  3VS5 A; 
#chains in the Genus database with same CATH topology
 1RI9 A;  2EGE A;  2RPN A;  4J7I A;  4C8Q B;  1NYF A;  1BCM A;  1QVG S;  4DOW A;  2XIC A;  3PBC A;  8AT1 B;  2DVJ A;  4EDU A;  1OZ2 A;  4FGI A;  1E6H A;  4PJO E;  1UB4 A;  2M02 A;  2EPD A;  1Y96 A;  4M78 C;  1ACM B;  3J7A F;  4J9C A;  3I35 A;  2EBP A;  2VC8 A;  1WXT A;  1NM7 A;  5KH6 A;  1NPP A;  1VQP T;  1M3C A;  3CCJ Q;  1AVZ C;  3DB4 A;  2ZPE B;  4E7K A;  4A54 A;  3G4S A;  5EG2 A;  4PLI A;  3TQ7 P;  2VXF A;  3L2U A;  2QDL A;  1VQM Q;  2LX7 A;  2ZPF B;  1SSH A;  4AG1 C;  2YUQ A;  2VGM A;  2EAY A;  3JB9 I;  1WFW A;  1MMG A;  3H0H A;  1GCQ C;  2DTI A;  2IG0 A;  4C8Q A;  1IRX A;  1YJW A;  3SEM A;  2CRE A;  4Z02 A;  1K8A C;  5GMK l;  5GAN d;  2IO9 A;  3CMA Q;  1VQ5 Q;  5CKB A;  3VV0 A;  1YJW Q;  1YJN T;  3O8V A;  2OI3 A;  1OPL A;  3SDZ A;  3OYL A;  1LJO A;  1S1N A;  4M7A E;  3IQL A;  4IUR A;  3GPL A;  1ZUK A;  4EIK A;  4M77 G;  1AOJ A;  1NBE B;  4F16 A;  1UE9 A;  1Q82 C;  3R6O A;  3HFN A;  2J6O A;  3L1A A;  2DIL A;  1K1Z A;  2JM8 A;  5GAN h;  3J80 E;  2KNB B;  3GIB A;  1QLY A;  1VQO T;  2P4T A;  2VKN A;  3JB9 G;  1RLP C;  2DIQ A;  1D1C A;  2JVV A;  3EH1 A;  1QCO A;  5A2Q E;  2A28 A;  4WF2 A;  2RHY A;  1K0S A;  3EFR A;  3ME9 A;  1BB9 A;  4CI0 C;  2DTO A;  4HZ9 A;  4CC7 A;  4LXC A;  3REB B;  2OTL A;  3QG1 A;  4GY5 A;  1VQ7 T;  1W70 A;  1O9S A;  1MGQ A;  1WHL A;  1AWJ A;  1UFF A;  2EJ9 A;  1S72 T;  2OTL Q;  1MMA A;  4KUI A;  4F7U G;  1NEB A;  2QEX Q;  1D0Z A;  3H8Z A;  4IIM A;  1VQL A;  2ROL A;  2LX9 A;  1TG0 A;  1RL2 A;  4RTU A;  4M7D G;  3TVT A;  1M90 R;  1M27 C;  1W2B A;  2LQ8 A;  5IXF A;  1VQL Q;  3PMT A;  2BUD A;  2X35 A;  3JRZ A;  2GBQ A;  1NJI C;  2KMT A;  1FMK A;  1YJ9 T;  2ZAE A;  2ZPB B;  3I5S A;  1YIT Q;  2DNU A;  3OB9 A;  3CME T;  4HXJ A;  2DXU A;  4XTY A;  5M9O A;  1RI0 A;  3X24 B;  4OMQ A;  1YHQ T;  4LDY A;  2YXY A;  2RJC A;  4JLG A;  4HFL A;  2J06 A;  4J83 A;  4E7J A;  2CKK A;  4NL2 A;  2L8D A;  2DXB A;  4YTL A;  5IHN A;  1G3S A;  3M4Y A;  3EG9 B;  4C92 E;  2FG0 A;  5GAM d;  1RUW A;  2XU8 A;  3FLG A;  1QMC A;  3HHT B;  2K1G A;  4J9H A;  4OGE A;  1VQ9 Q;  5GJW B;  2K5L A;  5A0G A;  5J26 A;  3V8J A;  1YI2 T;  3RR6 A;  3S0Q A;  2ZPH B;  1Y07 A;  3C0C A;  4XU2 A;  4BE0 A;  1Q7Y C;  2RI2 A;  3KBG A;  1IB8 A;  1VQN A;  1PD0 A;  2COZ A;  4M4Z A;  4GLM A;  2RMO A;  5GMK j;  3E2U A;  1Q81 C;  1KFZ A;  4RG2 A;  3UWN A;  1JQQ A;  1UJ0 A;  4FGD A;  3GP8 A;  3CC7 A;  3DKM A;  2JTM A;  2HZY A;  3PVQ A;  4FSS A;  2DL5 A;  1PSE A;  4OMN A;  1D0X A;  2VOB A;  2RJF A;  2E6N A;  5GAM h;  1RAB B;  5KYN A;  1KC8 C;  2M9U A;  1ZLM A;  1R8O B;  3HP9 A;  2DTH A;  3LH5 A;  3CCS T;  3JSC A;  4M78 F;  3RIR A;  1ZA1 B;  4N0A A;  2KSS A;  1VYU A;  4HPE A;  4EMK B;  5LJ3 e;  1PG5 B;  2YWW A;  3G7Z A;  4L59 A;  2M0Y A;  4MML A;  3A5Z B;  3BDL A;  2CSQ A;  4HFF A;  4LDW A;  1K76 A;  2YSQ A;  2LQK A;  1JB0 E;  2XK0 A;  4LUE A;  2EKO A;  3OYE A;  1W4S A;  4MDX A;  4M75 D;  2CZ6 B;  1QKX A;  1TUD A;  1Q86 R;  1IRE B;  2RJE A;  4FYW B;  2X9H A;  4C8Q C;  1IHW A;  2DRK A;  2XMF A;  3QHS A;  3GF5 A;  4FW2 A;  1UGP B;  3BY7 A;  1TUC A;  1QVF S;  2FYK A;  3CCQ T;  2MWO A;  1VOM A;  1ZX6 A;  1KQS A;  1JEG A;  5J39 A;  4J30 A;  4JZ4 A;  4C0G A;  4N4G A;  1I4K 1;  5IN1 A;  2HMA A;  3MKD A;  3I56 Q;  2E6Z A;  2CUD A;  1KHC A;  1FWZ A;  2JS2 A;  4EMK A;  2WP7 A;  4M78 B;  4OB3 B;  1OX8 A;  5KYY B;  3M9Q A;  4ZGE B;  3FEO A;  2RHX A;  4RTV A;  2FL7 A;  1OX9 A;  5LJ5 j;  2QXF A;  4Q4T A;  1RAE B;  2M51 A;  2JUF A;  3M57 A;  1W2B P;  3EBQ A;  4EMH A;  4HCK A;  4J9F A;  3I9Q A;  5CKF A;  3CPW S;  2LJ1 A;  3P8H A;  1NZ9 A;  3RKY A;  2E65 A;  1QCN A;  5KE2 A;  1WDX A;  2ROT A;  3FJP A;  2LNH B;  5IAY A;  3VS3 A;  1VQK Q;  2A7Y A;  4C8Q D;  3BFM A;  5GAO q;  2NUZ A;  4F14 A;  2FPE A;  3UT1 A;  2X4Y A;  2NUP A;  2L3Q A;  3OBY A;  2COY A;  4OF1 A;  3VRY A;  3I55 T;  4L5G A;  1M2O A;  2P0Q A;  4BE2 A;  4M78 A;  2LQW A;  5KYY A;  4C0D B;  2ED0 A;  4C5H A;  1MHN A;  4RTZ A;  2OX7 A;  2HL5 C;  1UJY A;  1NE8 A;  3GNG A;  3CPF A;  2BZX A;  2M0O A;  2LRJ A;  2ZZD A;  1MV0 B;  2QG9 B;  4PJM A;  3VYH B;  1TXQ A;  1WHH A;  1WHM A;  4JRQ A;  4MDW A;  1M30 A;  3S3M A;  3SHW A;  1VIE A;  1GCP A;  3A1P A;  3CCU Q;  3H6Z A;  4IUQ A;  1M4Z A;  1BIB A;  1J3T A;  3V8L A;  1QWF A;  4M75 G;  3A8G B;  1GCQ A;  1Y7X A;  5ECA A;  1N8R U;  1WQW A;  1ZQ1 A;  1X6B A;  3LLR A;  3LWH A;  3CCR Q;  2J6F A;  1H64 1;  1U1T A;  1D1B A;  3E19 A;  2QAZ A;  5LL6 S;  2VAS A;  1DJ7 B;  3FIF A;  1IGU A;  1VQ6 T;  1AHJ B;  1M1F A;  2GCX A;  4C92 F;  5CIU A;  1LPL A;  5A0L A;  4BB7 A;  1UGV A;  4WTO B;  1Y57 A;  1YIJ T;  3G6E A;  3VS5 A;  3TEE A;  1WA7 A;  3BW1 A;  1RAF B;  3EG1 A;  2BIV A;  5EC7 A;  1OYX A;  1ZBJ A;  2CP6 A;  4JJD A;  5LJ3 g;  3QBY A;  5GAO m;  3G1J A;  4MZP A;  4QQ6 A;  1VQ8 Q;  3CXC S;  2DET A;  3EG2 A;  3RKX A;  5GAO r;  1I81 A;  1W1F A;  5DY9 A;  1X2K A;  1HSQ A;  1SKU B;  3SB2 A;  1ZUU A;  3CCE A;  1NLP C;  1OPK A;  5D7U A;  5FU6 C;  3RMS A;  3NTK A;  2X4W A;  4E6R A;  1ARK A;  5CQY A;  5KYW B;  3CCJ T;  4JLI A;  4FW1 A;  1AT1 B;  3GBQ A;  1WHJ A;  1UG1 A;  1JXM A;  2ZCF B;  2WSC E;  3UPU A;  3P8D A;  3MET A;  3LWI A;  2D1X A;  1P92 A;  2DER A;  1VQM T;  1QVG A;  2EYQ A;  2DXT A;  3UDC A;  2JM9 A;  2QTX A;  5GAN 3;  5FWC A;  3H0I A;  4M77 E;  4C92 B;  2DZC A;  2BE7 D;  3CD6 A;  1HK9 A;  2ZPG B;  2C0T A;  5CVI A;  3QDF A;  4J9I A;  1V76 A;  3CMA T;  2HEQ A;  1VQ5 T;  2PVD B;  2DK3 A;  5D6W A;  4Z88 A;  1E6G A;  2O88 A;  2G3R A;  2DPP B;  1Q86 U;  4RTT A;  4QT7 A;  3NHN A;  5KYW A;  2GNC A;  1WJQ A;  4D8D A;  5DM7 R;  3FC3 A;  2OTJ Q;  4CSH A;  2IVW A;  2VGN A;  4EMK C;  4A53 A;  1LNX A;  1M5Q 1;  3JCM X;  5GAN e;  5HK3 A;  4PLL A;  2MOX A;  4LUD A;  1M1K R;  2K3A A;  1KIK A;  2QQB A;  4FCY A;  4X34 A;  4MZT A;  1MNE A;  4JZ3 A;  1CSK A;  4C92 A;  4F7U E;  3CC4 Q;  4CRI A;  4K11 A;  2LDM A;  2D9T A;  1X27 A;  3OYI A;  1K9M U;  2P4R A;  3M0S A;  2YUO A;  4M7D E;  1SF9 A;  3QSU A;  1VQ4 A;  2YLB A;  3WVD B;  1WYX A;  3E1S A;  3NMZ C;  2AZS A;  5GAN 5;  3OYH A;  2JJ9 A;  4JJN K;  1NPR A;  1JO8 A;  1WPY A;  3RNJ A;  2EYW A;  2CZ7 B;  3ER0 A;  4PJO C;  2E12 A;  4PNO A;  1Z9Z A;  1HXD A;  2OTL T;  2XID A;  2YRC A;  3JCM h;  2I0N A;  2QEX T;  2DBM A;  3C12 A;  5FW9 A;  5FRO A;  4NS5 A;  1W6X A;  3OYC A;  2XDD A;  1VQL T;  2CT4 A;  4PL6 A;  2C0O A;  2CZ1 B;  4Y28 E;  5I21 A;  4ZTF A;  4OMP A;  2VWF A;  2GTO A;  4EQ8 A;  1YIT T;  1QP3 A;  3HPW A;  2DKG A;  1VIF A;  4J9B A;  2LC4 A;  3MPU B;  3G4S Q;  3U23 A;  2B8A A;  1N6A A;  1N8R C;  5GMK h;  1PKT A;  2JMC A;  3GT2 A;  4PKC C;  2EWN A;  4J9G A;  3WXM B;  1U5S A;  1Q95 G;  3A8M B;  1SSF A;  3V7C A;  3QUI A;  2EQJ A;  1BIA A;  3OW2 S;  2DRM A;  1YFN A;  3UA7 A;  1BI3 A;  1JJ2 S;  4MMK A;  5GMK m;  3CCM A;  2JTE A;  3R6N A;  3AT1 B;  4C0D C;  1G5V A;  1OQK A;  1VQ9 T;  3OYM A;  2HAX A;  1QVG P;  3O98 A;  1K73 R;  2JXB A;  4M78 D;  4IUT A;  1C0M A;  2O2O A;  4ZGD B;  4M7A C;  2DD5 A;  2WSE E;  2DL7 A;  3TSZ A;  2F5K A;  3UAT A;  2LCC A;  3QII A;  2LT1 A;  3OYY A;  1VA7 A;  4Z8A A;  4LJ1 A;  2JS0 A;  2M1H A;  4BUG A;  1M3A A;  3ZFJ A;  3VYG A;  2MAM A;  5GAM e;  2QGF B;  1C1A A;  5LJ5 d;  4FT4 A;  4EMG A;  1U1S A;  5GAN 7;  2DYB A;  4HT9 A;  3LH0 A;  1UGS B;  4JRI A;  2QAS A;  1AEY A;  3CC2 A;  2V8J A;  5IHI A;  4OMO A;  1QKW A;  2QQA A;  3DB3 A;  2L3S A;  1LVK A;  4JUV A;  3H9N A;  2RB6 A;  3VUZ A;  1UDL A;  5GAO p;  4AG2 C;  2BKD N;  2CP3 A;  2KT1 A;  4J7F A;  2DBK A;  1WNL A;  2A36 A;  1D1A A;  2DVE A;  4FIB A;  5LJ5 h;  5GAN 8;  4JJC A;  2LNV A;  2MF2 A;  2AT1 B;  5KCH A;  5GAN g;  3X25 B;  3V7R A;  1KD1 U;  4RCB A;  4KGX B;  4PK4 A;  2J6K A;  4XTV A;  4RMO A;  4JJB A;  3C4S A;  5FRN A;  4AFQ C;  4FQB A;  1ZUY A;  2CP7 A;  2CUB A;  1G2B A;  1A0N B;  1NYG A;  4J5Y A;  2KK4 A;  2VYT A;  1K0X A;  5CKH A;  4XTX A;  1GFD A;  2X4X A;  3I56 T;  3M53 A;  2XKO C;  2CDT A;  2VPS A;  2F69 A;  1YNZ A;  1YCY A;  3EHQ A;  3L2W A;  4Q4G X;  5L8R E;  1YP5 A;  5HY6 A;  2DZ9 A;  3NFC A;  4HVU A;  4E2F B;  2EVR A;  5FU6 B;  1BU1 A;  3G71 A;  2EW3 A;  2VVK A;  3QPH A;  3L2R A;  1PSF A;  2XHC A;  1YBY A;  5I2M A;  3RDV A;  2RK1 A;  1K8A R;  4C92 C;  3G71 Q;  1K9M C;  5KE3 A;  2DEQ A;  3EG3 A;  3VKI A;  1Y0M A;  8ATC B;  3X20 B;  1VQK T;  5LJ3 f;  1X2Q A;  2L3R A;  3VUB A;  2XIV A;  2BZY A;  3A98 A;  4M7D F;  4J8O A;  2KVQ G;  5FU7 C;  4CGK A;  3HRS A;  1YJN A;  1OV3 A;  2E4H A;  2Y4X A;  1C6V X;  2HNI A;  4ZTJ A;  3DLL A;  1B7T A;  2KR3 A;  2XI9 A;  4PJJ A;  1PD1 A;  4XQ3 A;  5AYF A;  1EX4 A;  1Q82 R;  1YJN Q;  1GFC A;  1V1C A;  1SRL A;  2VXE A;  4M75 E;  1EFN A;  3EGU A;  1VQN Q;  4R0K A;  4PJO F;  2KRS A;  3A8L B;  2K79 A;  1FMV A;  2RF0 A;  4J9E A;  3CC7 Q;  3VS1 A;  2VB6 A;  5GJV B;  4ESR A;  2D8J A;  1VQO A;  3EG9 A;  4Q5W A;  2BTT A;  2DF6 A;  2LJ3 A;  2ABL A;  2OJ2 A;  3TCJ A;  4BAC A;  4C92 D;  1BK2 A;  2H3E B;  3CCU T;  3VJP A;  2DMO A;  2VUB A;  1K9A A;  2F1L A;  4C0F A;  4C5E A;  2KE9 A;  2RHI A;  5DLQ E;  4RTW A;  4KGV B;  3CCR T;  1VQ7 A;  4Y92 A;  4M7D B;  2QA4 A;  3UF4 A;  3OYJ A;  5GAM g;  2EYY A;  2CYZ B;  1JXO A;  4QQG A;  5CO7 A;  4ME7 A;  2QA4 Q;  3LW5 E;  2HSP A;  3MHX A;  4J6X A;  4PJO B;  1WX6 A;  1JBM A;  2O9S A;  4OVA A;  4XU3 A;  1NJI R;  2DJQ A;  1AWO A;  1WJR A;  4MZM A;  3CCV A;  1RAI B;  4ORZ A;  4HCZ A;  4DBF A;  1I1J A;  1X6G A;  2DYI A;  4D6W A;  1VQ8 T;  2HKQ B;  2HBW A;  4M7A F;  3L42 A;  2JN0 A;  5D6Y A;  3URG A;  3CCV Q;  1YJ9 A;  1TU0 B;  2L0A A;  3VRZ A;  2HQE A;  3CME A;  3GNF B;  3OMG A;  3QYH B;  1FMW A;  1OI1 A;  1TOV A;  1U3O A;  4BDY A;  2RJD A;  1K73 U;  2XDP A;  9ATC B;  1YHQ A;  3OY9 A;  1YJ9 Q;  4Q4N A;  3CCL A;  1OZ3 A;  1WGS A;  5KYX B;  3QDR B;  2L5Q A;  4M7D A;  4A63 B;  2YLC A;  1ZHI A;  2K6D A;  2CP2 A;  2R5M A;  4BI8 B;  1WI7 A;  3M54 A;  5GMK i;  4AT1 B;  3ULR B;  2QQS A;  3CCL Q;  2PUK B;  4UC4 A;  3C94 A;  4HT8 A;  5I22 A;  1HD3 A;  3CXC A;  3QYG B;  1Q7Y R;  4F04 B;  3KFV A;  3M0U A;  2DL4 A;  3OS0 A;  4PJO A;  2K57 A;  2K7A A;  1YWO A;  3JCM V;  1YI2 A;  3SWN C;  4IIO A;  1Q81 R;  1KD1 C;  1I5O B;  1K4U S;  4F4M A;  2CH4 A;  2KRN A;  5CCA A;  2RO0 A;  3CQT A;  2IPO B;  1AWX A;  1KC8 R;  1FX7 A;  4M7A B;  4JRK A;  3CCS A;  4RKU E;  4J6W A;  5KYX A;  1LCK A;  1JU5 C;  5CKD A;  1R0B G;  4BI3 A;  1AD5 A;  4O5V A;  4J9D A;  2RHU A;  2OTJ T;  3HKS A;  4JXB A;  3D7S B;  1OU9 A;  2O31 A;  3A8O B;  1R77 A;  1ABO A;  3A30 A;  4C5I A;  3CPW P;  1WZO A;  1M2V B;  2PTK A;  1M90 U;  3P8B B;  4F0W A;  2FPD A;  4KUL A;  4E7L A;  1KQS S;  3NE0 A;  2RQW A;  1BI1 A;  3CC4 T;  1D3B B;  4N4I A;  1RAC B;  4QVD A;  1BI0 A;  2CS7 A;  2MI6 A;  2RA2 A;  3QXE B;  3EGD B;  2GFU A;  2JOY A;  4OP0 A;  1EIF A;  2D8H A;  4DBR A;  2D6F A;  2B86 A;  3MEV A;  4FYY B;  2LT4 A;  4VUB A;  2RH2 A;  2RK2 A;  4M7A A;  2P0P A;  3CCQ A;  1EZZ B;  3A2Z A;  1NG2 A;  3WVE B;  1K8A U;  3JCM e;  4FL6 A;  1I0C A;  3G6E Q;  1X43 A;  2EKH A;  2EQM A;  4XTU A;  4E7S A;  3HRU A;  3JCM Q;  2M16 A;  4CC4 B;  4A4F A;  1TUG B;  1B3Q A;  5IXB A;  2I2L A;  5GAO l;  3J81 E;  3PMI A;  1M2V A;  1TH7 A;  3THK A;  4M75 F;  4DBQ A;  1T3L A;  4QVC A;  2HKN A;  3FB9 A;  2FHD A;  2CZ0 B;  3EGX B;  2LVM A;  2A08 A;  2KRM A;  1PWT A;  3CCE Q;  2DIG A;  1GBQ A;  2K4Y A;  3PVL A;  4C8Q G;  2VV5 A;  3X26 B;  2DM1 A;  2QYZ A;  3EGD A;  1N27 A;  3CBO A;  1G83 A;  5GMK e;  2HCK A;  4IUU A;  2QDY B;  3G4S T;  2Y90 A;  4PFZ A;  4QVZ A;  4M77 C;  4RTY A;  2P0K A;  2L89 A;  5GAN f;  1N9R A;  3OYN A;  3VS2 A;  2E10 A;  1D09 B;  3ZL7 C;  5GAN 6;  4FYX B;  1JRI A;  4Y91 A;  2R5A A;  5KYU B;  2QGG A;  1PNJ A;  2LTO A;  2NLU A;  4ANJ A;  3CD6 Q;  4J32 A;  2JZ2 A;  3VS0 A;  3RKW A;  2OAU A;  1SHG A;  1YJW T;  3JCM J;  2FZG B;  5FU7 B;  2DA9 A;  4OLK A;  3Q1J A;  3M56 A;  2F2V A;  5GAN 4;  4LDU A;  4QKU A;  3CXC P;  1MUZ A;  3OS2 A;  3FRN A;  3A2Y A;  2WAC A;  3EHR A;  4RTX A;  2DE0 X;  1XOV A;  2IO8 A;  1U06 A;  1WLP B;  3MEU A;  2X4J A;  2C06 A;  2OAW A;  3LX7 A;  4RUG A;  2KYB A;  2KY9 A;  4OMM A;  2RQV A;  5IT9 E;  3HFO A;  2RD1 A;  3OW2 A;  1BYM A;  4IUV A;  1JJ2 A;  3NGP A;  1B07 A;  3FJ5 A;  4HVW A;  2KGT A;  2KRO A;  2KAF A;  1NEG A;  4BE1 A;  4M7D C;  4E7Z A;  4OB1 B;  5KYU A;  2O4X B;  3EFO B;  3RBB B;  2DAQ A;  1MV3 A;  2MMP A;  1RLQ C;  2ENM A;  1O75 A;  1XQH A;  1VQ6 A;  3O5Z A;  5LJ5 e;  5A0D A;  1GL5 A;  5HKC A;  2MK5 A;  2AHJ B;  1HYO A;  1VQ4 Q;  1YIJ A;  2J7I A;  3ASK A;  4BY6 C;  2MCN A;  2E5Q A;  4AFZ C;  4EOB A;  4DEY A;  4LD9 K;  1QWE A;  1AZE A;  1PC0 A;  1H3Z A;  2H3J A;  5I11 A;  1ZSZ B;  5LJ3 j;  1G3Y A;  3TSW A;  2CSI A;  2KEA A;  2RN8 A;  2LCS A;  1Q7Y U;  4KH0 B;  1G3W A;  2LMJ A;  2K2V A;  3VS7 A;  1G3T A;  3OYK A;  3JCM P;  3OMC A;  2GQV A;  2HSE B;  2CH4 W;  1Q81 U;  4QW2 A;  2QQR A;  3A8H B;  4FT2 A;  4F0V A;  1X75 C;  4M78 E;  3CCJ A;  2X3X D;  2O4X A;  3EFO A;  5CQX A;  4P5N A;  5CK9 A;  2BZ8 A;  1M90 C;  3MP1 A;  4M7D D;  1KC8 U;  4EPC A;  1VQM A;  3KW0 A;  1FYN A;  2P84 A;  4ELZ C;  3JCM g;  5GAM f;  2KT8 A;  3EG0 A;  3S3N A;  2GF7 A;  2V8K A;  2YRD A;  5DLO A;  2X3W D;  3G71 T;  2YRV A;  2ZGW A;  4JS4 A;  2E5K A;  4AFS C;  2GGR A;  4BI4 A;  5GAO n;  4PJO D;  5AT1 B;  1KHI A;  3CMA A;  1ZSZ A;  1VQ5 A;  2YT6 A;  4CC3 A;  3CCM Q;  3SWN B;  1VUB A;  3PFS A;  5IHK A;  3OYF A;  3QO3 A;  1PRM C;  3MEW A;  3OSV A;  3PT9 A;  1UGR B;  3OYB A;  3KXT A;  3BDU A;  2A0F B;  1VQN T;  3E9F A;  4AMC A;  3QKJ A;  3RUX A;  1WJS A;  3UA6 A;  1M8M A;  3F70 A;  3ZEH A;  2AIR B;  2KDS A;  3JCM W;  3CC7 T;  1TWB A;  2NUT B;  2HL3 A;  2LJ0 A;  3VPI A;  1M3B A;  2FRY A;  4BDZ A;  3M5A A;  4HA8 A;  2R57 A;  4B6M A;  4OB0 B;  3EFS A;  4XK8 E;  3HRT A;  3CC2 Q;  2IIM A;  3DLM A;  4JPB W;  3L2V A;  4R55 A;  4DOV A;  3FDR A;  2K5I A;  2FZK B;  1XJW B;  4FQA A;  2H8H A;  4RCC A;  4DA4 A;  3OW2 P;  2F2X A;  1OUL A;  3SWN A;  4NL3 A;  4KBM B;  3OBW A;  2FO0 A;  1JJ2 P;  5CKE A;  2J05 A;  2KXC A;  4M7A D;  3GLX A;  4M77 F;  4PJN A;  1TSF A;  2PVO B;  1M9S A;  1SHF A;  2V8I A;  5FRM A;  2GQI A;  1MMN A;  1UHC A;  2QA4 T;  2BE9 B;  2HBP A;  2QEX A;  1YWP A;  2EGA A;  3HTR A;  4JRP A;  1Q86 C;  4KT0 E;  2KQW A;  2DX1 A;  3RES A;  3JB9 F;  2NUT A;  4OML A;  2IF6 A;  1VQP A;  2KXD A;  2KYM A;  2ZPI B;  2YUN A;  1T3S A;  3M59 A;  2DD4 A;  3QJ6 A;  4XU1 A;  3AHU A;  2IO7 A;  3PGG A;  1VQP Q;  1KJW A;  2IOB A;  3C95 A;  3CCV T;  2DO3 A;  1N8R R;  4C0Z A;  1YIT A;  4ATO A;  5LJ5 g;  5HCK A;  3H41 A;  2V26 A;  2XDB A;  4PFP A;  2MPX C;  4JS5 A;  4A4E A;  2RNA A;  3RMQ A;  4AFU C;  3QZ5 B;  4DBH A;  4ZGJ B;  2MIO A;  4KH1 B;  3L2Z A;  2E3H A;  1QVF A;  2HQX A;  4PJO G;  1OU8 A;  2EJF A;  2DXC A;  1WXB A;  5IH2 A;  4F7U F;  3JAM E;  2K3Y A;  2EIF A;  4M78 G;  3CCL T;  6AT1 B;  2PQW A;  5FWB A;  4M77 B;  1M1K U;  4FSX A;  2EYX A;  1VQ9 A;  4CC2 A;  1D0Y A;  1ZA2 B;  3S6W A;  4IKF A;  4Z89 A;  3M58 A;  1ZSG A;  2SRC A;  3HSB A;  4KUD K;  4M75 C;  4GBQ A;  1I5L A;  1GRI A;  2K2M A;  4L6V 5;  2CGH A;  1QW1 A;  3CPW A;  4FU6 A;  2RI3 A;  2JTF A;  1RAG B;  1MND A;  2CP5 A;  2G6F X;  4FDY A;  1M1G A;  3VS6 A;  1UTI A;  2PVG B;  4N4H A;  1XNI A;  1N9S A;  3PIP A;  3JCM b;  1KK7 A;  1CKA A;  2A3L A;  1PM3 A;  1VYV A;  2GFA A;  2D0Q B;  3MCA B;  4LNP A;  1SG5 A;  3L2Q A;  3INZ A;  4DEX A;  3M4G A;  1VQO Q;  4QQD A;  3SD4 A;  2MYS A;  4M77 A;  2E41 A;  3OQ5 A;  3VS4 A;  4EQA A;  4F7U B;  3BE3 A;  2COW A;  3PNW C;  1W2B S;  5CAI A;  2EQU A;  1BI2 A;  1XTD A;  2V1R A;  4ZN3 A;  4M7A G;  2AKL A;  2WSF E;  1T0H A;  1BCO A;  4ZNX A;  1N5Z A;  3T9N A;  2RHZ A;  1KQ1 A;  3I5R A;  1S72 A;  4B9X A;  2DEU A;  1VQ7 Q;  3E9G A;  3I86 A;  2E70 A;  4FYV B;  2L2P A;  4PJL A;  5D6X A;  3OS1 A;  1ZSZ C;  1S72 Q;  5J3B A;  4HKE A;  1UEB A;  2K3X A;  5GAN j;  4PFO A;  2PU9 B;  3PTA A;  4C8Q E;  3PE0 A;  4BY6 B;  3RER A;  1G8X A;  1QCF A;  1VYT A;  1I07 A;  3G6E T;  2E3I A;  3I56 A;  3TU4 K;  2VPM A;  4TVR A;  2DJZ A;  2NUP B;  2EFI A;  1V29 B;  2F2W A;  1OEB A;  1RAD B;  4XU0 A;  2ECZ A;  3M0R A;  4LE9 A;  2E1H A;  4DQ2 A;  4F7U A;  3QWX X;  1AWW A;  3M0Q A;  2RI5 A;  3MEA A;  1LOJ A;  1WHG A;  4A4K A;  3CME Q;  1K9M R;  3CCE T;  1QP2 A;  2YUP A;  4RG8 A;  2F5T X;  2W10 A;  1YHQ Q;  2XD0 A;  1PHT A;  5FLX E;  4O6J A;  1SPK A;  2QI2 A;  2R58 A;  3MP6 A;  4E7H A;  1Y71 A;  1VQK A;  2HD0 A;  4XTW A;  2KI7 A;  4JUR A;  2DL3 A;  3QJY A;  4HVV A;  3JB9 J;  2K3B A;  4IUP A;  1HJD A;  3QZ9 B;  1QQJ A;  4J6Y A;  4LDX A;  3M0T A;  4OGC A;  1QVF P;  1SRM A;  2LRQ A;  4X1V A;  3V7S A;  2C0I A;  2K5F A;  2Z0W A;  3CD6 T;  2A37 A;  1YI2 Q;  1I8F A;  1WXU A;  4OMF B;  5C0M A;  5LJ3 d;  5I2S A;  1H8K A;  1UHF A;  4KRT A;  3S3O A;  1PKS A;  3OYG A;  4V2S A;  1AZG B;  1ZBX A;  2LQN A;  2RQT A;  1OOT A;  3ZBD A;  1YN8 A;  5HK0 A;  2ED1 A;  1KSW A;  2JMA A;  2FEI A;  1TTH B;  4C92 G;  2FPF A;  1BKB A;  2RQU A;  1Z9Q A;  4NOY A;  4X9C A;  4LD6 A;  2GTJ A;  1F1B B;  2HDA A;  2PNI A;  2LCL A;  3CCS Q;  4ELY C;  4HCC A;  4E7I A;  3JCM f;  3VPJ A;  3JV3 A;  2QTV A;  1CKB A;  4XTZ A;  3M1U A;  3CCU A;  2PUO B;  2XG8 D;  1RAA B;  7AT1 B;  2D0N A;  3GOX A;  5LJ3 h;  3OYA A;  5KCO A;  5GAN 2;  3H0F A;  1UUE A;  3KUF A;  2IOA A;  3CCR A;  3LYI A;  2MWP A;  1RAH B;  2EGC A;  3MP8 A;  1M1K C;  2YDL A;  1KG1 A;  2CP0 A;  2LP5 A;  3EAE A;  4JDS A;  2JT4 A;  1FXX A;  1GXI E;  2FVU A;  2EQK A;  3JCM c;  2DLP A;  5GAM j;  1B34 B;  3CBP A;  3QWY A;  3PBI A;  3LGF A;  1VQ4 T;  4LDV A;  4HZB A;  4ZN1 A;  1U8R A;  3CCQ Q;  1T0J A;  1UEC A;  1YCS B;  3LGL A;  2X51 A;  2DFU A;  1VQ8 A;  1QVP A;  1WIE A;  3SFM A;  2V1Q A;  2FB7 A;  4CT3 A;  2AKK A;  4HFK A;  1IO6 A;  2JW4 A;  4F17 A;  3PIO A;  1D3B A;  4XAX B;  2E64 A;  4A4H A;  1Q82 U;  3M55 A;  2L3P A;  2QK0 A;  3OSS C;  2FRW A;  4GLK A;  2O9V A;  5C6S A;  1KQS P;  2NYS A;  2SEM A;  1ABQ A;  2Y4Y A;  4N0A C;  3NPF A;  2EJG A;  1WHK A;  3HL8 A;  2HQH A;  1B34 A;  3MO8 A;  1KD1 R;  3OYD A;  3I55 A;  1R0C B;  4C5G A;  5L23 A;  2DL8 A;  2W0Z A;  2ATC B;  3OA6 A;  3TRE A;  1M8V A;  3OS5 A;  3I55 Q;  1SEM A;  4LN2 A;  3CBM A;  3JB9 H;  3CCM T;  2K9G A;  3NTI A;  3EGX A;  3VU3 C;  1E7O A;  3EH2 A;  4WCI A;  4E47 A;  3M0P A;  4A4G A;  3MJX A;  4M75 B;  5LJ5 f;  1PRL C;  4C8Q F;  1TS9 A;  2O01 E;  4KGZ B;  1IXD A;  1X69 A;  2OTJ A;  2EYZ A;  1K73 C;  2JNG A;  1GBR A;  3CEY A;  4HCB A;  1X6O A;  2PZ1 A;  1NJI U;  2NWM A;  1IZ6 A;  2RM4 A;  4FM4 B;  1Y96 B;  4M77 D;  3CC4 A;  1NLO C;  2KBT A;  1IHV A;  4D8K A;  3CC2 T;  2AK5 A;  2RQR A;  3JCM d;  4B9W A;  1BBZ A;  2ESW A;  2QQ9 A;  2YHT A;  2CT3 A;  2AZV A;  3V8K A;  4OB2 B;  3JB9 D;  4R56 A;  1KQ2 A;  5CR2 A;  1PCX A;  2LZ6 B;  1H92 A;  1IGQ A;  1VQ6 Q;  4M75 A;  3NTH A;  3X28 B;  1X01 A;  2FZC B;  4II1 A;  4BD3 A;  3REA B;  4FGE A;  1MMD A;  1WQ7 A;  1YIJ Q;  2EQI A;  1H3H A;  1UGQ B;  3N5B B;  4X9D A; 
#chains in the Genus database with same CATH homology
 1RI9 A;  1WA7 A;  2EGE A;  2RPN A;  1YWP A;  3EG1 A;  2EGA A;  5EC7 A;  1ZBJ A;  1NYF A;  4JJD A;  1WX6 A;  2O9S A;  3PBC A;  2DX1 A;  2DVJ A;  2DJQ A;  1AWO A;  4FGI A;  1E6H A;  4OML A;  2IF6 A;  4ORZ A;  2KXD A;  1I1J A;  2KYM A;  2EPD A;  1X6G A;  2YUN A;  1T3S A;  2HBW A;  3EG2 A;  4J9C A;  2IO7 A;  3I35 A;  2EBP A;  1WXT A;  2L0A A;  1W1F A;  3VRZ A;  1KJW A;  2IOB A;  1NM7 A;  1X2K A;  1HSQ A;  1ZUU A;  1NLP C;  1M3C A;  1OPK A;  1U3O A;  5HCK A;  3H41 A;  4E6R A;  1ARK A;  1AVZ C;  4Q4N A;  2RNA A;  3GBQ A;  4AFU C;  1UG1 A;  1JXM A;  2MIO A;  4A63 B;  2K6D A;  2QDL A;  1WI7 A;  2D1X A;  1WXB A;  2LX7 A;  3ULR B;  5IH2 A;  1SSH A;  4AG1 C;  2JM9 A;  2YUQ A;  5FWB A;  1WFW A;  5FWC A;  5I22 A;  1HD3 A;  2EYX A;  3H0I A;  3H0H A;  1GCQ C;  3KFV A;  3M0U A;  2DL4 A;  4CC2 A;  3SEM A;  2CRE A;  4Z89 A;  2K7A A;  1YWO A;  2C0T A;  2IO9 A;  4IIO A;  1ZSG A;  4J9I A;  1K4U S;  2HEQ A;  2SRC A;  4F4M A;  2CH4 A;  2KRN A;  3CQT A;  4GBQ A;  1GRI A;  2K2M A;  2OI3 A;  1OPL A;  1AWX A;  2G6F X;  4FDY A;  4Z88 A;  1E6G A;  3VS6 A;  2O88 A;  1UTI A;  1S1N A;  3IQL A;  1ZUK A;  4EIK A;  4RTT A;  1CKA A;  4QT7 A;  3NHN A;  1LCK A;  1AOJ A;  1JU5 C;  2GNC A;  1VYV A;  1AD5 A;  4D8D A;  4F16 A;  1UE9 A;  4CSH A;  4J9D A;  2J6O A;  4JXB A;  4LNP A;  2DIL A;  1K1Z A;  2O31 A;  2JM8 A;  2MOX A;  3A30 A;  4DEX A;  1ABO A;  4LUD A;  2KNB B;  2PTK A;  2K3A A;  1QLY A;  2VKN A;  1KIK A;  3VS4 A;  1RLP C;  2FPD A;  4EQA A;  4F0W A;  4JZ3 A;  1CSK A;  3NE0 A;  2V1R A;  2AKL A;  4K11 A;  1T0H A;  2RQW A;  1X27 A;  2A28 A;  4ZNX A;  1N5Z A;  2P4R A;  3M0S A;  2YUO A;  1K0S A;  3I5R A;  1BB9 A;  4HZ9 A;  2D8H A;  4CC7 A;  2B86 A;  3REB B;  3I86 A;  1WYX A;  3NMZ C;  2AZS A;  2L2P A;  1W70 A;  1JO8 A;  3RNJ A;  2EYW A;  1AWJ A;  1UFF A;  3A2Z A;  1NG2 A;  1Z9Z A;  3PE0 A;  1I0C A;  1X43 A;  2EKH A;  1NEB A;  1QCF A;  1VYT A;  2I0N A;  4IIM A;  1I07 A;  2ROL A;  1TG0 A;  2VPM A;  2DBM A;  4RTU A;  4CC4 B;  1B3Q A;  5IXB A;  3TVT A;  1M27 C;  2F2W A;  5FW9 A;  1OEB A;  1W6X A;  5IXF A;  2ECZ A;  3M0R A;  4LE9 A;  3THK A;  1T3L A;  3QWX X;  2CT4 A;  1AWW A;  3M0Q A;  2GBQ A;  2C0O A;  2A08 A;  1FMK A;  2KRM A;  4OMP A;  1PWT A;  2VWF A;  2GTO A;  3I5S A;  4EQ8 A;  1GBQ A;  3PVL A;  2DNU A;  4HXJ A;  2DM1 A;  2YUP A;  2W10 A;  4J9B A;  4OMQ A;  1PHT A;  1G83 A;  3U23 A;  1SPK A;  2HCK A;  2J06 A;  1PKT A;  2JMC A;  3GT2 A;  4J9G A;  4RTY A;  5IHN A;  1U5S A;  2DL3 A;  3VS2 A;  3ZL7 C;  4HVV A;  2K3B A;  1HJD A;  2FG0 A;  1RUW A;  2DRM A;  3UA7 A;  2K1G A;  3M0T A;  4J9H A;  1SRM A;  1PNJ A;  2JTE A;  5GJW B;  3R6N A;  4X1V A;  3VS0 A;  2C0I A;  1SHG A;  2A37 A;  1WXU A;  3O98 A;  2DA9 A;  2JXB A;  4OLK A;  1H8K A;  1UHF A;  2O2O A;  4KRT A;  1PKS A;  2F2V A;  3S0Q A;  3C0C A;  1AZG B;  2LQN A;  2RQT A;  2DL7 A;  1MUZ A;  3TSZ A;  1OOT A;  1YN8 A;  3UAT A;  2ED1 A;  4M4Z A;  3A2Y A;  1KSW A;  2RMO A;  2JMA A;  4GLM A;  2FEI A;  3EHR A;  4RTX A;  1KFZ A;  2DE0 X;  1XOV A;  1VA7 A;  2IO8 A;  4Z8A A;  1JQQ A;  1UJ0 A;  2FPF A;  4FGD A;  4LJ1 A;  2JS0 A;  2RQU A;  1Z9Q A;  1M3A A;  1U06 A;  3PVQ A;  1WLP B;  2GTJ A;  4FSS A;  2DL5 A;  2HDA A;  2PNI A;  4OMN A;  2VOB A;  2OAW A;  4RUG A;  2KYB A;  4OMM A;  2DYB A;  1ZLM A;  3LH5 A;  3VPJ A;  2RQV A;  3JV3 A;  1CKB A;  1AEY A;  3M1U A;  1VYU A;  4HPE A;  5IHI A;  3NGP A;  1B07 A;  4OMO A;  1QKW A;  3FJ5 A;  2D0N A;  2L3S A;  4HVW A;  2KGT A;  2KRO A;  1NEG A;  2M0Y A;  3H0F A;  1UUE A;  2IOA A;  3RBB B;  2CSQ A;  2EGC A;  1MV3 A;  1K76 A;  2YSQ A;  2YDL A;  1RLQ C;  2ENM A;  4LUE A;  1UDL A;  4AG2 C;  2LP5 A;  2KT1 A;  2DBK A;  1QKX A;  1TUD A;  2JT4 A;  3O5Z A;  1GL5 A;  2A36 A;  2DLP A;  4JJC A;  3QWY A;  3PBI A;  2J7I A;  4HZB A;  2DRK A;  2MCN A;  4AFZ C;  4EOB A;  2XMF A;  4DEY A;  1QWE A;  1AZE A;  2J6K A;  1T0J A;  1TUC A;  4JJB A;  1UEC A;  1YCS B;  1ZX6 A;  1JEG A;  5I11 A;  4AFQ C;  4FQB A;  1ZUY A;  1WIE A;  2CUB A;  4JZ4 A;  1G2B A;  2V1Q A;  1A0N B;  1NYG A;  3TSW A;  2CSI A;  2KEA A;  1K0X A;  4CT3 A;  2RN8 A;  2LCS A;  1GFD A;  2LMJ A;  2AKK A;  2CUD A;  2JS2 A;  1IO6 A;  3VS7 A;  2JW4 A;  4F17 A;  2CDT A;  2CH4 W;  2VPS A;  1YNZ A;  4F0V A;  3EHQ A;  4RTV A;  4Q4G X;  1YP5 A;  2X3X D;  2L3P A;  4Q4T A;  2M51 A;  2BZ8 A;  4HVU A;  2FRW A;  2EVR A;  2O9V A;  1BU1 A;  2SEM A;  2EW3 A;  4HCK A;  4J9F A;  1ABQ A;  2VVK A;  3I9Q A;  3KW0 A;  1FYN A;  2LJ1 A;  3NPF A;  2KT8 A;  3EG0 A;  1WDX A;  2ROT A;  3EG3 A;  2X3W D;  1Y0M A;  2E5K A;  2LNH B;  4AFS C;  3VS3 A;  2GGR A;  2NUZ A;  4F14 A;  2FPE A;  1X2Q A;  2XIV A;  5L23 A;  2BZY A;  2DL8 A;  2W0Z A;  3A98 A;  2L3Q A;  4CGK A;  1OV3 A;  2YT6 A;  4CC3 A;  1SEM A;  4LN2 A;  3VRY A;  2KR3 A;  2K9G A;  5IHK A;  1E7O A;  4WCI A;  3M0P A;  2LQW A;  2ED0 A;  1GFC A;  1V1C A;  1PRM C;  1SRL A;  4RTZ A;  1PRL C;  1EFN A;  3EGU A;  4R0K A;  1UJY A;  2KRS A;  1X69 A;  2EYZ A;  2K79 A;  1GBR A;  2RF0 A;  2BZX A;  4J9E A;  3UA6 A;  2LRJ A;  1MV0 B;  1M8M A;  3VS1 A;  5GJV B;  4ESR A;  2D8J A;  2PZ1 A;  2LJ0 A;  3VPI A;  1M3B A;  2BTT A;  2FRY A;  1M30 A;  2NWM A;  3SHW A;  2DF6 A;  2LJ3 A;  1GCP A;  2ABL A;  2OJ2 A;  1BK2 A;  2IIM A;  1NLO C;  2KBT A;  1J3T A;  4JPB W;  4D8K A;  1QWF A;  2DMO A;  2AK5 A;  1K9A A;  1GCQ A;  2RQR A;  5ECA A;  1BBZ A;  2ESW A;  4FQA A;  1X6B A;  2H8H A;  2KE9 A;  2CT3 A;  2AZV A;  2J6F A;  4RTW A;  2F2X A;  4Y92 A;  2FO0 A;  2LZ6 B;  2J05 A;  1H92 A;  2KXC A;  3UF4 A;  2EYY A;  1JXO A;  3REA B;  4FGE A;  1SHF A;  2GQI A;  1H3H A;  2EQI A;  2HSP A;  1UGV A;  1UHC A;  1Y57 A;  3VS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...