2FG0A

Crystal structure of a putative gamma-d-glutamyl-l-diamino acid endopeptidase (npun_r0659) from nostoc punctiforme pcc 73102 at 1.79 a resolution
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
222
structure length
222
Chain Sequence
b'KLGEYQCLADLNLFDSPECTRLATQSASGRHLWVTSNHQNLAVEVYLCEDDYPGWLSLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTSQKATHVGLYLADGYYIHSSGKDQGRDGIGIDILSEQGDAVSLSYYQQLRGAGRVFKSYEPQRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COG0791: Cell wall-associated hydrolases (invasion-associate
publication title Structural Basis of Murein Peptide Specificity of a gamma-D-Glutamyl-L-Diamino Acid Endopeptidase.
pubmed doi rcsb
source organism Nostoc punctiforme
molecule tags Hydrolase
total genus 65
structure length 222
sequence length 222
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00877 NLPC_P60 NlpC/P60 family
A PF18348 SH3_16 Bacterial dipeptidyl-peptidase Sh3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2fg0A01
3.90.1720.10 Alpha Beta Alpha-Beta Complex endopeptidase fold (from Nostoc punctiforme) endopeptidase domain like (from Nostoc punctiforme) 2fg0A02
1AZEA 2PZ1A 1BU1A 1UTIA 1GBRA 4CSHA 3EHQA 1CKAA 1RI9A 2C0OA 2A37A 4M4ZA 4OLKA 1E7OA 1ZLMA 3EG1A 2GBQA 2ROLA 3VS4A 3GBQA 2IOAA 2A28A 1NLOC 3PVQA 3VS0A 1KSWA 3PBIA 2AZSA 4JJBA 2RMOA 1HSQA 4GLMA 1JXOA 3QWYA 2HEQA 4Y92A 1EFNA 1OPLA 4K11A 1CKBA 4D8KA 1H92A 1WIEA 1UHCA 2RQVA 1CSKA 4FGEA 1M3CA 1NM7A 2CUBA 1NYGA 1LCKA 2RQTA 2FRYA 1ZSGA 3VS5A 3S0QA 2ESWA 3VRYA 3M0SA 1A0NB 3VRZA 3VS2A 4WCIA 2GGRA 2FPFA 2J05A 4JZ3A 1FYNA 2KNBB 4R0KA 4LN2A 1JEGA 5IHIA 2YUPA 1IO6A 2L3PA 4KRTA 1OEBA 2GQIA 1BK2A 1H8KA 4F4MA 1WDXA 1ZBJA 1PKTA 3NMZC 2DMOA 3U23A 4EOBA 2EBPA 4FQBA 2K3BA 4FSSA 1WFWA 2YUOA 1K0XA 2X3WD 1X6BA 2DL8A 2LP5A 2O88A 3PBCA 2IOBA 5I22A 1M8MA 2KRMA 2KRNA 4RTXA 1VYVA 2VWFA 4F0VA 1MV0B 2VKNA 1I1JA 3EG2A 3A30A 1BB9A 4AFQC 5L23A 3TVTA 2CT4A 2KXDA 2LQNA 3UF4A 3PVLA 1K0SA 1K9AA 1XOVA 4ESRA 2KRSA 1WXUA 1VA7A 2MOXA 1V1CA 1TUDA 2J6FA 3VS3A 1AZGB 2ED0A 2K6DA 4Q4GX 1SPKA 3REBB 1K1ZA 4HVUA 3NGPA 2K7AA 3H0FA 2RPNA 1KIKA 1GRIA 4DEYA 4J9CA 5ECAA 3UA6A 1UGVA 1TG0A 2CT3A 1WYXA 2YDLA 2LZ6B 1U06A 2JS0A 1SHGA 2HBWA 2HSPA 2JMCA 4CC4B 1I07A 2KT1A 1AOJA 4AFZC 1S1NA 1OOTA 1AWOA 4J9BA 2J6KA 3H41A 1AWXA 2KYMA 4CC7A 1UFFA 2DM1A 1YN8A 2CREA 2O2OA 4LUEA 2LJ0A 1GCQC 4Q4TA 3VS6A 3VS1A 4OMPA 2K9GA 4ZNXA 4CT3A 2DRKA 2JW4A 3QWXX 2JS2A 1GL5A 4X1VA 2VPMA 2CSQA 2EYYA 1JQQA 1T3SA 2AKKA 1VYUA 1UE9A 1NYFA 4JJCA 2BTTA 4F17A 3LH5A 1SHFA 3A2ZA 3SEMA 1X6GA 2YUQA 4J9GA 2FO0A 2M0YA 4HXJA 1SRMA 4EQ8A 2EGAA 2ABLA 2FEIA 3RBBB 4ORZA 2KBTA 2CH4W 4OMMA 1FMKA 2M51A 2IO9A 1RLPC 2ECZA 4QT7A 1U5SA 1M30A 1YCSB 3KFVA 3EGUA 1PHTA 2XMFA 5IHKA 1YWPA 3I9QA 3M0QA 4HVVA 4HZ9A 1WLPB 5FWCA 1K76A 2CDTA 5IXFA 2B86A 2PTKA 1U3OA 1W70A 4LJ1A 1PNJA 2EYWA 2DE0X 4J9FA 4AG2C 2GNCA 2X3XD 1NEBA 1X43A 2ENMA 1AEYA 1NEGA 2F2WA 1JO8A 2FPDA 3A2YA 3O98A 1WX6A 2MCNA 3I5RA 4Q4NA 2L3SA 1QKXA 2H8HA 2LJ1A 1E6HA 1B07A 3I5SA 1Z9QA 2YT6A 4AFUC 4J9EA 2RN8A 1ABOA 4RTZA 2KE9A 3PE0A 4JZ4A 2D8JA 2DJQA 2XIVA 2KROA 5IXBA 2QDLA 4RTUA 1T3LA 1WXTA 2NUZA 4AFSC 2IO7A 1SEMA 2HDAA 1Y0MA 1PRMC 1AWWA 2K2MA 2K79A 2GTOA 2JMAA 2GTJA 3RNJA 4GBQA 2D0NA 1UG1A 1MUZA 1UDLA 2EW3A 1T0HA 2DBMA 3M0TA 3ZL7C 3EG0A 2J06A 2RQUA 2LRJA 1B3QA 2L3QA 2DA9A 1KFZA 3FJ5A 3REAB 2VOBA 4JXBA 2LNHB 2OAWA 2O31A 2DILA 1GCQA 4RTWA 1ARKA 2E5KA 1X69A 2KEAA 2CUDA 4Z89A 4AG1C 1ZUUA 2JTEA 5GJVB 1ZUYA 3M1UA 2EYZA 2P4RA 3I86A 1YNZA 3GT2A 3NHNA 3THKA 1X2KA 4LNPA 1E6GA 1AD5A 2LMJA 2D1XA 1SSHA 3H0HA 2DL3A 3I35A 1JU5C 2JM8A 3R6NA 1T0JA 2RF0A 3A98A 5IHNA 2OI3A 4Z88A 2JM9A 2OJ2A 2IO8A 4CGKA 2JT4A 2DVJA 4EQAA 1ZX6A 1UJ0A 1PWTA 3TSZA 3O5ZA 1TUCA 1NG2A 2BZ8A 4A63B 2KT8A 5IH2A 1AVZC 4EIKA 4OMQA 3M0RA 4FGIA 1WA7A 1WI7A 2YSQA 1KJWA 5EC7A 2VPSA 3UATA 2RQRA 2F2XA 2LJ3A 2LCSA 2CSIA 1OPKA 4J9HA 1G83A 1QLYA 2L0AA 2DL5A 4RTTA 2DLPA 4HPEA 2EPDA 1M3BA 2G6FX 4LE9A 2DRMA 4J9IA 4HZBA 2JXBA 4HVWA 3SHWA 3M0PA 1MV3A 2DYBA 2PNIA 2RNAA 1UECA 2DBKA 3TSWA 4FGDA 2KGTA 2F2VA 1NLPC 2ED1A 4J9DA 1J3TA 4RTYA 1Y57A 2IF6A 1M27C 4RTVA 4IIMA 1GBQA 2VVKA 2AK5A 2A36A 2I0NA 2KYBA 3VPIA 2C0TA 1X2QA 1QCFA 2K1GA 5GJWB 4IIOA 2FPEA 2AZVA 3UA7A 1RLQC 3JV3A 2CH4A 2W10A 4FDYA 2V1RA 1UUEA 2DL7A 1HD3A 1HJDA 1H3HA 3H0IA 2EYXA 4D8DA 3NPFA 1UJYA 2J6OA 4OMNA 2FG0A 1M3AA 2EGEA 2EVRA 1GCPA 4HCKA 1YP5A 2HCKA 3ULRB 2AKLA 3IQLA 2EQIA 1W6XA 1WXBA 4CC2A 2A08A 1I0CA 5HCKA 2LQWA 1ZUKA 4F16A 2ROTA 2V1QA 3M0UA 1SRLA 2J7IA 3CQTA 4DEXA 2LX7A 2DF6A 4FQAA 1JXMA 1X27A 2DNUA 2EKHA 1GFDA 3KW0A 1QKWA 4OMLA 1OV3A 4F14A 3VS7A 4JPBW 4OMOA 2BZYA 1RUWA 1G2BA 3EHRA 1UHFA 2DX1A 2O9VA 2NWMA 1W1FA 2BZXA 2KR3A 3C0CA 3NE0A 1PKSA 1QWEA 3VPJA 1BBZA 1Z9ZA 1N5ZA 4JJDA 1AWJA 2KXCA 1K4US 2SEMA 1VYTA 4Z8AA 5FW9A 2K3AA 2FRWA 2MIOA 2L2PA 2EGCA 2RQWA 1PRLC 1GFCA 2DL4A 1YWOA 2O9SA 2W0ZA 4LUDA 2IIMA 4CC3A 2YUNA 5I11A 1QWFA 4F0WA 5FWBA 3EG3A 2SRCA 2C0IA 2D8HA 1ABQA 4RUGA 4E6RA
chains in the Genus database with same CATH superfamily
2PZ1A 3TREA 4BI3A 1CKAA 1RI9A 1VQOQ 4M78F 4M4ZA 2F5KA 3EG1A 3GBQA 4M75F 3EGXB 2IOAA 2CZ1B 3VS0A 5A0GA 1QP3A 3I55T 2XIDA 1HSQA 3JCMW 1D0ZA 1LVKA 2CKKA 2KK4A 1OPLA 3V7SA 5GAMg 1VQPT 1CKBA 3OYJA 3OYEA 1H92A 2RQVA 1IHWA 2ZPBB 2CUBA 2DEUA 4F7UB 5LJ3f 2A0FB 1NYGA 2FRYA 3VS5A 1PSFA 4LDXA 4M7AB 3VRZA 3META 3E1SA 3VS2A 3I56T 2MWOA 2FPFA 5I21A 2J05A 2VB6A 1V29B 3HHTB 3QDRB 2RO0A 4C5GA 3RDVA 5LJ3e 1OEBA 2MF2A 5GANg 4M7DE 4BB7A 1WDXA 1WJSA 5HKCA 4QW2A 2K3XA 2JUFA 3U23A 4C8QB 2OX7A 3ZFJA 2K3BA 4FSSA 1YJWT 4E7SA 1X6BA 2DFUA 2LP5A 3PBCA 1PC0A 2K5LA 4RG8A 3G4SQ 2RK1A 5I22A 3L42A 4HA8A 3OYFA 1YITQ 2QQBA 1VYVA 2AT1B 4FT4A 2GQVA 1R8OB 2EQMA 1WGSA 5GAOq 1I1JA 1UB4A 3EG2A 4HCBA 2L89A 3TVTA 5C6SA 3EH1A 2CT4A 2E3IA 4KUIA 3CC2A 5LJ5f 2LQNA 1WZOA 2P0PA 4D6WA 3CCUQ 1FX7A 1XOVA 1NZ9A 3HTRA 3MEVA 2KRSA 5GMKe 1VA7A 3BDLA 1VQLT 3EG9B 1YJNQ 1SG5A 3CCSQ 2EQJA 3VS3A 2RHZA 3OYBA 3M4GA 4FIBA 5D6WA 1K1ZA 5LJ5e 2FZKB 3NGPA 1HK9A 1KQSA 2RPNA 2BIVA 4DEYA 3G6EA 4TVRA 1K8AU 2EQUA 3UA6A 2ZGWA 1UGVA 2CT3A 4M7DB 2YDLA 2LZ6B 4E7HA 4LXCA 1U06A 4IUTA 4RMOA 3OYAA 3HRTA 2JMCA 4XU3A 1AOJA 4AFZC 1S1NA 4J9BA 4LDYA 2J6KA 3H41A 2A3LA 2LT1A 1QVFA 2LCCA 1Y96B 4PL6A 2OTLT 1BYMA 3VS1A 4ZN3A 5IN1A 3QXEB 3CC4T 2CSQA 3E19A 2QASA 3G71A 1NYFA 3RUXA 2BTTA 3SEMA 1X6GA 3OQ5A 3CCLQ 2YUQA 4J9GA 2M0YA 4HXJA 5CK9A 3RMSA 4J6YA 2EAYA 3BY7A 3MCAB 2ABLA 2FEIA 2KBTA 4PFPA 3EFSA 1HXDA 1M30A 3X28B 2E6ZA 3PGGA 3I9QA 1S72A 4O5VA 3CMAQ 2CP7A 5IXFA 1BIAA 2B86A 2PTKA 4J9FA 2DE0X 5GAOm 1UGQB 4M77D 3RERA 5CVIA 3C95A 5AT1B 4BUGA 4J32A 1AEYA 3G4ST 2F2WA 1NPPA 1WX6A 2H8HA 3C12A 1Q7YR 1ABOA 2D8JA 3CCMQ 5IXBA 4N4IA 2QEXQ 8ATCB 1RAFB 5GAMf 4AFSC 3FC3A 1SEMA 1VQ7A 4FYXB 4N0AC 2K79A 2GTJA 1YJNT 3FDRA 2D0NA 2XU8A 2EW3A 1T0HA 1WHLA 4A4GA 1VOMA 1I5OB 5GAMe 3DLLA 2LQ8A 2RJDA 2J06A 2RQUA 2DA9A 1YI2T 3REAB 3BE3A 2VUBA 2OAWA 4KULA 4XU1A 2E5KA 2HQXA 4JURA 1ZUUA 2JTEA 1RACB 2QA4A 1VQ9A 2EYZA 2JOYA 1ZA2B 2P4RA 4IUVA 4V2SA 1YNZA 7AT1B 2DETA 4B9XA 2LRQA 3SFMA 3THKA 2C06A 4LNPA 3CPWP 2LMJA 2D1XA 3H0HA 4XTWA 1ZQ1A 2DL3A 4ZGEB 1JU5C 4Q5WA 2RF0A 3A98A 3BFMA 1K73U 3GIBA 2JT4A 1ZX6A 3ZBDA 1PWTA 4ME7A 1TUGB 1NE8A 2DKGA 3URGA 4OMQA 3M0RA 1WA7A 1KJWA 4XTZA 3FEOA 5KYXB 1EX4A 4PFZA 2KSSA 3HP9A 5KH6A 4C0GA 3RR6A 3C4SA 2P84A 2DLPA 4KGXB 2FYKA 2H3EB 1M3BA 4HPEA 3CEYA 2G6FX 1TS9A 2DRMA 1M8VA 3DB3A 1IREB 3VKIA 2RNAA 3H9NA 3HL8A 2EWNA 1QQJA 3KBGA 4X9CA 4FGDA 3TSWA 2KGTA 3CCJQ 3CXCP 4Y91A 1Y57A 2AK5A 3VPIA 2RH2A 2QQ9A 4EMKC 2E70A 3CCVA 1QCFA 5GJWB 4IIOA 2AZVA 3A8OB 1BI2A 1G3WA 2XICA 2V1RA 2DL7A 4PLIA 4M78D 3CPWS 3VUZA 1B34A 4JLIA 2EYXA 3OYGA 4M75D 3SB2A 4OMNA 5GANd 5IT9E 1GCPA 2AKLA 1W6XA 1I5LA 5KYWA 1VUBA 3AT1B 1I0CA 1M90C 2LQWA 1ZUKA 2DO3A 1VQMQ 2V1QA 2RI3A 2O01E 1MNDA 4A4KA 3CQTA 4DA4A 4PJNA 3CMEA 2DF6A 1JXMA 2RM4A 2M1HA 1G8XA 1WHGA 3OA6A 5FU6B 2RHIA 1OV3A 5FROA 3V7CA 2BZYA 3INZA 1M90U 1KQSP 1UHFA 2DX1A 2NWMA 1W1FA 4PJOC 2PU9B 1LJOA 3C0CA 5CKEA 1PKSA 4EMHA 2VC8A 2YWWA 3VJPA 4JJDA 1YIJT 1O9SA 2X35A 2MIOA 2PUOB 5GMKh 2CZ7B 1PRLC 3OMGA 1YJ9Q 1UGRB 1ZSZA 2E10A 4LUDA 1QVFP 2XG8D 5LJ5h 5CCAA 2HBPA 4KGZB 3CXCS 4OB0B 4A53A 2ZPEB 1ABQA 4FT2A 4PFOA 4E6RA 1AZEA 4ZGJB 1BU1A 1YFNA 2YLBA 4KBMB 2A37A 1OU9A 1E7OA 4OLKA 1ZBXA 2ROLA 1VQ8Q 1WQWA 2COZA 4AT1B 1KSWA 4C92A 1OU8A 3JB9H 1JXOA 3QWYA 2HEQA 4L59A 1TTHB 2HL5C 4CRIA 3TCJA 3OYKA 1M1KC 3I55Q 4K11A 2EYQA 2DIGA 2X4XA 1WIEA 1UHCA 3OYDA 4FGEA 1M3CA 2HKNA 1LCKA 2RQTA 2L3RA 1VQPQ 1ZSGA 3VRYA 3V7RA 1A0NB 2LX9A 4WCIA 2AIRB 3UWNA 5FLXE 2KNBB 4BDYA 3I56Q 1VQ4A 1KQ1A 4WTOB 2OTJQ 4KRTA 3ME9A 2GQIA 3JCMQ 1TXQA 2M0OA 1KQSS 3HSBA 3NTHA 2E12A 2DMOA 2E64A 5LJ3j 4E7IA 1G3SA 3FJPA 1OULA 1KC8U 4FQBA 2K57A 2LNVA 2BUDA 4RG2A 2X3WD 2EIFA 5C0MA 1UGPB 2IOBA 1XJWB 2DD5A 1YJWQ 4JRIA 3JCMd 1WQ7A 4JS5A 1QVFS 5HY6A 3GP8A 2QAZA 1MNEA 3CC7T 2VKNA 1JBMA 3A30A 4PJOF 5I2SA 1YHQA 2KXDA 3UF4A 4M7AG 3PVLA 4UC4A 1Q86C 1K9AA 3PMIA 3CD6A 5GMKl 4ESRA 3CCQA 4O6JA 4B6MA 2FL7A 2MOXA 1TUDA 2EJGA 1AZGB 4R56A 1K9MC 4HFLA 3P8DA 3REBB 4HVUA 4WF2A 4VUBA 1Q86U 1KIKA 1GRIA 2VXFA 4MDWA 1QCNA 4C8QG 5CKFA 4OB1B 3CPWA 3NFCA 5GAMh 4OP0A 5LJ5j 4R55A 2JS0A 4M7AC 2JVVA 2QQAA 2RI5A 2E3HA 2O4XA 4C8QE 1I07A 2KT1A 3CCRT 1TOVA 2R58A 4JJNK 1QP2A 1AWXA 2HL3A 1VQ8T 1YN8A 4LUEA 1Q82U 2LJ0A 1GCQC 3ZEHA 4DOWA 2OTLQ 1VQOA 2JW4A 3QZ9B 4C8QC 3N5BB 3P8BB 2RHUA 1T3SA 5GAN2 5GAN3 1M1GA 3CC4Q 1KD1R 1RAHB 1BI0A 1MHNA 4J7FA 1B34B 5J26A 1VQ5A 3GNFB 3UDCA 2XHCA 4EQ8A 2EGAA 4L6V5 4PK4A 3WVEB 3MEUA 4ORZA 4OMMA 4M7DG 1RADB 5HK3A 2OTJT 1JRIA 5KYWB 1RLPC 2VGNA 4QT7A 3MJXA 1U5SA 1YCSB 2CP2A 3EGUA 3KFVA 3SWNA 2PVOB 4C92E 1JJ2P 1WLPB 3CXCA 5GMKm 1PNJA 2EYWA 5A0LA 1X43A 2X9HA 1Q95G 2KY9A 3TU4K 1RI0A 1M9SA 5KYXA 1VIEA 2HKQB 1M4ZA 3A2YA 2FPDA 3CCEA 4M7DC 1FMVA 3M53A 1WHHA 3QHSA 3I5SA 4QKUA 2YT6A 2G3RA 3PE0A 3QBYA 2QDLA 2Z0WA 2IG0A 4RTUA 1WHMA 4XTUA 1ZSZB 2HDAA 1Y0MA 4HT8A 2ZPGB 1AWWA 1IXDA 1R77A 2K2MA 1V76A 2GTOA 1D1BA 2FZCB 3RNJA 1VQ6A 2XDPA 1K8AC 2QYZA 1MUZA 2QGGA 3CCUA 5DLQE 4F7UF 3ZL7C 5GAOl 3EG0A 3PFSA 2K3YA 4M7AF 1B3QA 3CCSA 4QQGA 4JXBA 1OZ3A 2O31A 2DILA 4C0DB 1AHJB 4C92B 1YI2Q 2CUDA 4Z89A 4N4GA 4AG1C 1ZUYA 1H3ZA 2LQKA 3HKSA 2BE7D 1AT1B 1N8RR 3GT2A 4M77A 3NHNA 2CZ0B 3G6EQ 4C8QF 2IPOB 1C1AA 3OW2P 4HCCA 4EPCA 1MMNA 1JJ2S 4J30A 1LPLA 3R6NA 1UEBA 2K2VA 4ATOA 1OX8A 1WJQA 2JM9A 3LH0A 4J8OA 3EH2A 4EQAA 1SKUB 3M55A 4LD9K 1FMWA 3O5ZA 1BI3A 4JLGA 2KT8A 5IH2A 3A5ZB 3R6OA 4FGIA 4C5EA 2VPSA 2DIQA 5D7UA 2F2XA 1I4K1 2LCSA 3CCLA 5LJ3d 1OPKA 4J9HA 1O75A 1M2VA 1QLYA 1VQ5T 2DL5A 1IHVA 4LE9A 2QQRA 4HZBA 2MI6A 2FVUA 1YCYA 4HVWA 3SHWA 3M0PA 1MV3A 2DYBA 1KHCA 4PKCC 3DLMA 1UECA 5M9OA 4M7DF 2QI2A 3CMAA 2DBKA 3M57A 4C0ZA 3JCMg 1NLPC 4J9DA 1DJ7B 1NJIR 1J3TA 4RTYA 3X26B 2IF6A 3EFOA 4RTVA 4ZGDB 2MMPA 4IIMA 2A36A 2XDDA 4NL2A 3RMQA 1OYXA 4J6XA 4JRKA 2FPEA 4DBRA 3CCET 2CH4A 1BCMA 1RAAB 1JB0E 2F69A 2CS7A 5FU7B 2YRDA 2JNGA 2K5FA 1KHIA 3NPFA 3OW2S 2O4XB 3LWHA 4HCKA 2FHDA 4RCBA 3ULRB 3IQLA 2EQIA 3CC2T 3VYGA 4PNOA 3GLXA 2A08A 5CIUA 4XTXA 3M0UA 4DEXA 3OS0A 4FQAA 2A7YA 5GANf 4KH1B 1SSFA 4F14A 3VS7A 4OMOA 1BCOA 2IVWA 3C94A 2DVEA 3G6ET 1K73C 2KR3A 1QWEA 2E5QA 2DTHA 5GANe 1AWJA 3RKYA 1G3TA 2K3AA 4GY5A 1YIJQ 1GFCA 2DL4A 1YWOA 2O9SA 1RAIB 1TU0B 3VUBA 1X75C 3SWNB 1D0YA 1PD0A 4F0WA 3GF5A 4PJMA 1OZ2A 4M78A 3EAEA 2YHTA 1M90R 3E9FA 2C0IA 4M75A 1PD1A 3KUFA 1PSEA 4ZTJA 1UTIA 4FM4B 4M77E 4P5NA 4CSHA 3QYHB 3JB9I 2MAMA 3G71T 2DJZA 1ZLMA 4PJOD 2GBQA 4LDVA 3X25B 3M56A 2NUTA 2A28A 1NLOC 3PVQA 2RHXA 4FU6A 2AZSA 5GAN6 4GLMA 1VIFA 3HRUA 4IURA 1Q7YC 2QK0A 4D8KA 1OX9A 3P8HA 2D0QB 1EIFA 1Q81C 3M58A 3EBQA 1VQKA 4MDXA 3M0SA 3F70A 2MWPA 2B8AA 3GOXA 1S72T 2M9UA 1JJ2A 1WHKA 3JB9G 1FYNA 2PVGB 4LN2A 3S3MA 1Q7YU 4E7KA 5FU6C 1IO6A 2L3PA 2DYIA 3QO3A 1BK2A 1H8KA 1Q81U 3S3OA 4F4MA 1ZBJA 4QVDA 3NMZC 3J81E 3H8ZA 4J83A 3OYIA 2JZ2A 1KG1A 4EOBA 3JCMX 5D6XA 3HPWA 4DQ2A 2YUOA 4M77B 1K0XA 1X6OA 1M1KR 2DL8A 2O88A 3MKDA 1VQ7T 4HCZA 3NTKA 2KRNA 3V8KA 2R5AA 2VWFA 2KAFA 2XDBA 4F0VA 3V8LA 1MV0B 3M9QA 2HSEB 3FIFA 1M1FA 4AFQC 1VQMA 4ELZC 4BE1A 2QXFA 3CC7Q 5CAIA 5KCOA 3S6WA 1K0SA 1BKBA 4A4FA 3JCMf 3L2RA 1OI1A 2HMAA 1WXUA 1V1CA 2J6FA 2ED0A 4FYVB 2K6DA 2WP7A 2X51A 1SPKA 2QA4T 1VQ9T 3FB9A 4Q4GX 2K7AA 2EFIA 1M2VB 3H0FA 1HYOA 2ATCB 3JCMe 4OMFB 2JJ9A 1VQNA 1TG0A 3OYLA 2D6FA 5A2QE 2COYA 3OYMA 3J80E 5IAYA 2HBWA 5KE3A 3OW2A 3CBOA 4XTYA 5LJ3g 1YJ9A 1C0MA 4KH0B 3ASKA 1D3BB 4CC4B 2HQEA 2E6NA 3ER0A 5GAOp 1IRXA 1AWOA 2HZYA 1N9RA 4JRQA 3CCRQ 2DM1A 2V26A 2CREA 1MMDA 3EFOB 2K9GA 4CT3A 3QZ5B 3WXMB 2DRKA 3LWIA 5CQXA 3QWXX 2JS2A 2RB6A 4M78G 2VPMA 2HQHA 2DPPB 3E2UA 2EYYA 4M75G 2D9TA 4XU0A 1VYUA 1UE9A 4BE2A 1K9MR 4JJCA 3LX7A 5KE2A 4F17A 3WVDB 1SHFA 2L8DA 3E9GA 4M78E 5A0DA 4M7AD 2FO0A 1SRMA 4M75E 4NOYA 2RJFA 1VQPA 1XNIA 1FMKA 2H3JA 2IO9A 5CKDA 4RCCA 1VQKT 2ECZA 4MMKA 4EMGA 3L2WA 1KC8C 3OY9A 1KQ2A 1W4SA 4YTLA 1ZA1B 2VGMA 3A8LB 3JCMc 1U1SA 2CDTA 2VXEA 2JTFA 1C6VX 1MGQA 3JB9F 1W70A 4LJ1A 1F1BB 3CCVT 4AG2C 3OS2A 1W2BS 4XU2A 2ENMA 3PIPA 1NEGA 2V8IA 3MPUB 2QQSA 2X4WA 3O98A 3I5RA 4DBQA 3G7ZA 3CPFA 1QKXA 2LJ1A 1Z9QA 1XQHA 4AFUC 4J6WA 4JZ4A 2DTIA 4PLLA 2KROA 3DB4A 1YJWA 2NUZA 2IO7A 4LD6A 3LGFA 5CKBA 4C5IA 3PIOA 3OYCA 3JRZA 2VASA 4E7JA 4M78B 1QW1A 2DEQA 1UG1A 4M75B 2YXYA 1QMCA 3CMET 1UDLA 2DERA 2DBMA 4GLKA 2WACA 3M0TA 4E47A 2LRJA 2WSCE 1YHQQ 3FJ5A 3VU3C 5LL6S 5GMKj 2VOBA 2NUTB 4M7DD 5CR2A 4RTWA 1ARKA 2EJFA 1VQLA 4L5GA 1X69A 5GJVB 2OAUA 2RD1A 1Q82C 3MP1A 4Y28E 1G3YA 3X24B 1AD5A 1E6GA 1ACMB 2DK3A 2FZGB 4BE0A 2COWA 2RJCA 3I35A 2JM8A 3OSVA 5IHNA 2QTXA 2GFAA 2OJ2A 2IO8A 1K8AR 3OS5A 3MP8A 5GANh 1UJ0A 2F5TX 2OTLA 2DZCA 1NG2A 2BZ8A 4A63B 1AVZC 2DTOA 3JCMV 1WI7A 2RI2A 1XTDA 2YSQA 2KI7A 3CC4A 3OYHA 2CSIA 4HKEA 4C92G 2FB7A 2CP0A 2E41A 1ZSZC 2L0AA 4RTTA 1G5VA 2M02A 2EPDA 3MEAA 4OGCA 1RAEB 4QQ6A 2P4TA 1VQ5Q 1FXXA 2JXBA 2Y4YA 2PNIA 4BY6B 1Y71A 1VQ4T 3A8HB 5KYYA 1D0XA 3LW5E 4N0AA 2V8JA 2F2VA 2ED1A 3RKXA 3EGDA 1M27C 4C0DC 2VV5A 1IGUA 4C92C 2VVKA 2I0NA 1R0CB 2KYBA 2X4JA 1X2QA 3JCMJ 2BE9B 3OBYA 4ANJA 3OMCA 3KXTA 1RLQC 3JV3A 4E2FB 3G4SA 2W10A 3RIRA 4FDYA 4MZTA 5FRMA 1UUEA 1YITA 5CO7A 1HD3A 3M4YA 3MHXA 1X01A 3H0IA 4KGVB 3CCEQ 4D8DA 1M3AA 2EGEA 2EVRA 3BW1A 1YP5A 3L2UA 1D1CA 3H6ZA 5GAN7 1YHQT 4XK8E 5HCKA 2ROTA 2DXTA 1TSFA 3CD6T 3CC2Q 3CCQT 2P0KA 4FW1A 1YJNA 1MMGA 2LX7A 3HFOA 3SDZA 2R5MA 1VQ6Q 1M2OA 5GAMj 2RHYA 2EKHA 1GFDA 4HFKA 1OQKA 4IUQA 1W2BA 2I2LA 4JPBW 3GPLA 1YI2A 1RUWA 1G2BA 4IUUA 2KMTA 2JN0A 2BZXA 1N5ZA 1K4US 2KXCA 3PNWC 1KD1C 1I8FA 2KVQG 2SEMA 2LCLA 1VYTA 4RKUE 5FW9A 2L2PA 2EGCA 5KYUA 2W0ZA 2XK0A 5GANj 3LGLA 4FL6A 2IIMA 2QG9B 5I11A 3JAME 4N4HA 2ZPHB 2LC4A 1KD1U 5KYNA 1VQOT 1GXIE 3VV0A 3JCMh 4KT0E 3AHUA 3QKJA 2LVMA 1GBRA 3EHQA 2C0OA 4DOVA 5AYFA 3VS4A 5GAOn 5FU7C 2MK5A 3G71Q 1MMAA 3PBIA 1YBYA 2RMOA 2X4YA 4JJBA 1K73R 1LNXA 2CP3A 2LTOA 1EFNA 1TH7A 4Y92A 4EMKA 1UGSB 2NLUA 3S3NA 2ZPIB 2DXUA 4BD3A 2M16A 2HAXA 2DXCA 1CSKA 3GNGA 1NM7A 4C92F 1D3BA 3MP6A 4MMLA 3S0QA 2ESWA 2DXBA 1N6AA 3QDFA 4DBHA 1WPYA 2GGRA 2VYTA 4NL3A 4JZ3A 4R0KA 1JEGA 2E4HA 2LT4A 5IHIA 1S72Q 1TWBA 3BDUA 2YUPA 3JCMP 1N9SA 4FW2A 4EDUA 4OB2B 4C0FA 4CI0C 1PKTA 4BI4A 4BACA 1R0BG 3CCMA 1D09B 2CZ6B 3FLGA 5GAOr 2EBPA 2QEXA 5DM7R 3QUIA 1WFWA 1YITT 5LJ5d 2P0QA 4ZN1A 4PJOA 1M8MA 3SWNC 2KRMA 1N8RC 4E7LA 4RTXA 1VQ6T 1SF9A 1VQ7Q 1Q81R 4JRPA 4II1A 3UT1A 2XKOC 4HT9A 4C5HA 3CCUT 1BB9A 5L23A 1IB8A 3T9NA 5I2MA 2Y4XA 5HK0A 2F1LA 5GAN8 3CCST 1N8RU 1PM3A 2GFUA 5L8RE 2QDYB 1B7TA 3X20B 3A8MB 1QVGP 2YRVA 3JB9D 3HRSA 2QA4Q 1VQ9Q 3PMTA 4J9CA 4PJLA 5ECAA 4B9WA 4OF1A 1WYXA 2CGHA 5DLOA 1SHGA 1YIJA 1M5Q1 4M77G 3A1PA 2HSPA 4Z02A 2EQKA 4A54A 1FWZA 5KYYB 1OOTA 2AHJB 2KYMA 1LOJA 3D7SB 4CC7A 4DBFA 5FRNA 1UFFA 2O2OA 3RKWA 4JUVA 2PVDB 2YRCA 3EGDB 4Q4TA 3VS6A 4OMPA 4ZNXA 2ZCFB 2CP6A 1NJIC 1GL5A 2QTVA 4X1VA 4FSXA 2MYSA 2QGFB 3PT9A 2L5QA 1JQQA 3CCLT 4A4EA 2AKKA 4MZMA 2DD4A 4M77C 3QYGB 5D6YA 4E7ZA 3LH5A 5GAN4 4A4HA 3A2ZA 1EZZB 3JSCA 3HFNA 3FRNA 1U1TA 1NJIU 3L2VA 2ZAEA 3OB9A 4JDSA 3RBBB 2YLCA 2CH4W 2NUPA 5J39A 3O8VA 2M51A 2MPXC 3CMAT 3CCJA 1PHTA 2XMFA 5IHKA 1YWPA 2K5IA 3J7AF 1VQKQ 3M0QA 4HVVA 4HZ9A 5FWCA 1K76A 3M5AA 5GAN5 8AT1B 1P92A 3JB9J 1U3OA 4PJJA 2GNCA 2X3XD 1NEBA 3EFRA 1QVGS 5GAMd 1WJRA 1WNLA 3CCVQ 1JO8A 3JCMb 3EGXA 2MCNA 4Q4NA 3CCMT 2L3SA 3QJ6A 2QEXT 1E6HA 1B07A 4OVAA 4J9EA 2RN8A 4RTZA 2KE9A 1RL2A 2DJQA 2XIVA 1IZ6A 5KYUB 1T3LA 1WXTA 1Y7XA 2V8KA 2E65A 4F7UA 6AT1B 3OS1A 3LYIA 1PG5B 1PRMC 3QPHA 5CQYA 5LJ3h 3QG1A 1NBEB 4M7AA 1D1AA 3G1JA 2JMAA 3SD4A 2EKOA 3QIIA 4PJOG 4GBQA 1KC8R 3CC7A 4BDZA 5J3BA 3V8JA 3CMEQ 1W2BP 2L3QA 1KFZA 1PCXA 3PTAA 4PJOE 2LNHB 3QJYA 1BIBA 4HFFA 3QSUA 1GCQA 2KEAA 5DY9A 2NYSA 4QQDA 4EMKB 4C8QA 2ZZDA 3LLRA 3M1UA 1QVPA 3I86A 2HD0A 2GF7A 1X2KA 2Y90A 3OYYA 2RJEA 2BKDN 1SSHA 1VQNQ 2XI9A 3Q1JA 5KCHA 3UPUA 4IUPA 4NS5A 1T0JA 4M77F 4QVCA 1Q86R 2OI3A 4Z88A 3CCRA 4JS4A 4CGKA 2DVJA 2KQWA 2DAQA 3TSZA 2GCXA 1VQ8A 1TUCA 1RAGB 4XQ3A 4EIKA 3EG9A 2EJ9A 4OB3B 3I55A 5EC7A 3UATA 3VYHB 2RQRA 2WSFE 2LJ3A 2KDSA 3MO8A 1I81A 1G83A 5CKHA 4J5YA 2CYZB 1Q82R 5GMKi 1QCOA 4PJOB 4XTVA 4M7DA 3CBMA 2RK2A 1KK7A 4M78C 4J9IA 4M75C 3I56A 5LJ5g 4C8QD 2OTJA 2ZPFB 3CCJT 4FYYB 4LDUA 1Y96A 1Y07A 3TEEA 1M1KU 1VQ4Q 4MZPA 1GBQA 2XD0A 3OBWA 2C0TA 2JTMA 3NTIA 4FYWB 2K1GA 3UA7A 1U8RA 4BI8B 1NPRA 1HJDA 2E1HA 3RESA 1H3HA 3M59A 2WSEE 1N27A 1UJYA 2J6OA 4QVZA 2FG0A 2CP5A 5EG2A 1VQMT 2HCKA 1WXBA 3MEWA 4CC2A 4F16A 4ZTFA 3DKMA 1H641 4C92D 1SRLA 2J7IA 4F7UG 4KUDK 4F04B 3L2QA 3CD6Q 3L2ZA 4ELYC 1X27A 2PUKB 3CCQQ 2R57A 2DNUA 3TQ7P 3KW0A 4X34A 1QKWA 4X9DA 4OMLA 1QVGA 4F7UE 4AMCA 3A8GB 2K4YA 3OSSC 3EHRA 2O9VA 4OGEA 2HNIA 4M7AE 1IGQA 3CBPA 4FCYA 1VQNT 3NE0A 3VPJA 4XAXB 1BBZA 1Z9ZA 1VQLQ 1BI1A 4Z8AA 1YJ9T 3OYNA 4J7IA 2FRWA 3M54A 2NUPB 2RQWA 4BY6C 2DZ9A 2RA2A 1ZHIA 4IKFA 1WHJA 1RABB 2YUNA 4CC3A 3L1AA 1QWFA 2PQWA 1K9MU 5FWBA 3EG3A 2LDMA 2SRCA 4LDWA 9ATCB 2D8HA 4RUGA
chains in the Genus database with same CATH topology
1AZEA 2PZ1A 1BU1A 1UTIA 1GBRA 4CSHA 3EHQA 1CKAA 1RI9A 2C0OA 2A37A 4M4ZA 4OLKA 1E7OA 1ZLMA 3EG1A 2GBQA 2ROLA 3VS4A 3GBQA 2IOAA 2A28A 1NLOC 3PVQA 3VS0A 1KSWA 3PBIA 2AZSA 4JJBA 2RMOA 1HSQA 4GLMA 1JXOA 3QWYA 2HEQA 4Y92A 1EFNA 1OPLA 4K11A 1CKBA 4D8KA 1H92A 1WIEA 1UHCA 2RQVA 1CSKA 4FGEA 1M3CA 1NM7A 2CUBA 1NYGA 1LCKA 2RQTA 2FRYA 1ZSGA 3VS5A 3S0QA 2ESWA 3VRYA 3M0SA 1A0NB 3VRZA 3VS2A 4WCIA 2GGRA 2FPFA 2J05A 4JZ3A 1FYNA 2KNBB 4R0KA 4LN2A 1JEGA 5IHIA 2YUPA 1IO6A 2L3PA 4KRTA 1OEBA 2GQIA 1BK2A 1H8KA 4F4MA 1WDXA 1ZBJA 1PKTA 3NMZC 2DMOA 3U23A 4EOBA 2EBPA 4FQBA 2K3BA 4FSSA 1WFWA 2YUOA 1K0XA 2X3WD 1X6BA 2DL8A 2LP5A 2O88A 3PBCA 2IOBA 5I22A 1M8MA 2KRMA 2KRNA 4RTXA 1VYVA 2VWFA 4F0VA 1MV0B 2VKNA 1I1JA 3EG2A 3A30A 1BB9A 4AFQC 5L23A 3TVTA 2CT4A 2KXDA 2LQNA 3UF4A 3PVLA 1K0SA 1K9AA 1XOVA 4ESRA 2KRSA 1WXUA 1VA7A 2MOXA 1V1CA 1TUDA 2J6FA 3VS3A 1AZGB 2ED0A 2K6DA 4Q4GX 1SPKA 3REBB 1K1ZA 4HVUA 3NGPA 2K7AA 3H0FA 2RPNA 1KIKA 1GRIA 4DEYA 4J9CA 5ECAA 3UA6A 1UGVA 1TG0A 2CT3A 1WYXA 2YDLA 2LZ6B 1U06A 2JS0A 1SHGA 2HBWA 2HSPA 2JMCA 4CC4B 1I07A 2KT1A 1AOJA 4AFZC 1S1NA 1OOTA 1AWOA 4J9BA 2J6KA 3H41A 1AWXA 2KYMA 4CC7A 1UFFA 2DM1A 1YN8A 2CREA 2O2OA 4LUEA 2LJ0A 1GCQC 4Q4TA 3VS6A 3VS1A 4OMPA 2K9GA 4ZNXA 4CT3A 2DRKA 2JW4A 3QWXX 2JS2A 1GL5A 4X1VA 2VPMA 2CSQA 2EYYA 1JQQA 1T3SA 2AKKA 1VYUA 1UE9A 1NYFA 4JJCA 2BTTA 4F17A 3LH5A 1SHFA 3A2ZA 3SEMA 1X6GA 2YUQA 4J9GA 2FO0A 2M0YA 4HXJA 1SRMA 4EQ8A 2EGAA 2ABLA 2FEIA 3RBBB 4ORZA 2KBTA 2CH4W 4OMMA 1FMKA 2M51A 2IO9A 1RLPC 2ECZA 4QT7A 1U5SA 1M30A 1YCSB 3KFVA 3EGUA 1PHTA 2XMFA 5IHKA 1YWPA 3I9QA 3M0QA 4HVVA 4HZ9A 1WLPB 5FWCA 1K76A 2CDTA 5IXFA 2B86A 2PTKA 1U3OA 1W70A 4LJ1A 1PNJA 2EYWA 2DE0X 4J9FA 4AG2C 2GNCA 2X3XD 1NEBA 1X43A 2ENMA 1AEYA 1NEGA 2F2WA 1JO8A 2FPDA 3A2YA 3O98A 1WX6A 2MCNA 3I5RA 4Q4NA 2L3SA 1QKXA 2H8HA 2LJ1A 1E6HA 1B07A 3I5SA 1Z9QA 2YT6A 4AFUC 4J9EA 2RN8A 1ABOA 4RTZA 2KE9A 3PE0A 4JZ4A 2D8JA 2DJQA 2XIVA 2KROA 5IXBA 2QDLA 4RTUA 1T3LA 1WXTA 2NUZA 4AFSC 2IO7A 1SEMA 2HDAA 1Y0MA 1PRMC 1AWWA 2K2MA 2K79A 2GTOA 2JMAA 2GTJA 3RNJA 4GBQA 2D0NA 1UG1A 1MUZA 1UDLA 2EW3A 1T0HA 2DBMA 3M0TA 3ZL7C 3EG0A 2J06A 2RQUA 2LRJA 1B3QA 2L3QA 2DA9A 1KFZA 3FJ5A 3REAB 2VOBA 4JXBA 2LNHB 2OAWA 2O31A 2DILA 1GCQA 4RTWA 1ARKA 2E5KA 1X69A 2KEAA 2CUDA 4Z89A 4AG1C 1ZUUA 2JTEA 5GJVB 1ZUYA 3M1UA 2EYZA 2P4RA 3I86A 1YNZA 3GT2A 3NHNA 3THKA 1X2KA 4LNPA 1E6GA 1AD5A 2LMJA 2D1XA 1SSHA 3H0HA 2DL3A 3I35A 1JU5C 2JM8A 3R6NA 1T0JA 2RF0A 3A98A 5IHNA 2OI3A 4Z88A 2JM9A 2OJ2A 2IO8A 4CGKA 2JT4A 2DVJA 4EQAA 1ZX6A 1UJ0A 1PWTA 3TSZA 3O5ZA 1TUCA 1NG2A 2BZ8A 4A63B 2KT8A 5IH2A 1AVZC 4EIKA 4OMQA 3M0RA 4FGIA 1WA7A 1WI7A 2YSQA 1KJWA 5EC7A 2VPSA 3UATA 2RQRA 2F2XA 2LJ3A 2LCSA 2CSIA 1OPKA 4J9HA 1G83A 1QLYA 2L0AA 2DL5A 4RTTA 2DLPA 4HPEA 2EPDA 1M3BA 2G6FX 4LE9A 2DRMA 4J9IA 4HZBA 2JXBA 4HVWA 3SHWA 3M0PA 1MV3A 2DYBA 2PNIA 2RNAA 1UECA 2DBKA 3TSWA 4FGDA 2KGTA 2F2VA 1NLPC 2ED1A 4J9DA 1J3TA 4RTYA 1Y57A 2IF6A 1M27C 4RTVA 4IIMA 1GBQA 2VVKA 2AK5A 2A36A 2I0NA 2KYBA 3VPIA 2C0TA 1X2QA 1QCFA 2K1GA 5GJWB 4IIOA 2FPEA 2AZVA 3UA7A 1RLQC 3JV3A 2CH4A 2W10A 4FDYA 2V1RA 1UUEA 2DL7A 1HD3A 1HJDA 1H3HA 3H0IA 2EYXA 4D8DA 3NPFA 1UJYA 2J6OA 4OMNA 2FG0A 1M3AA 2EGEA 2EVRA 1GCPA 4HCKA 1YP5A 2HCKA 3ULRB 2AKLA 3IQLA 2EQIA 1W6XA 1WXBA 4CC2A 2A08A 1I0CA 5HCKA 2LQWA 1ZUKA 4F16A 2ROTA 2V1QA 3M0UA 1SRLA 2J7IA 3CQTA 4DEXA 2LX7A 2DF6A 4FQAA 1JXMA 1X27A 2DNUA 2EKHA 1GFDA 3KW0A 1QKWA 4OMLA 1OV3A 4F14A 3VS7A 4JPBW 4OMOA 2BZYA 1RUWA 1G2BA 3EHRA 1UHFA 2DX1A 2O9VA 2NWMA 1W1FA 2BZXA 2KR3A 3C0CA 3NE0A 1PKSA 1QWEA 3VPJA 1BBZA 1Z9ZA 1N5ZA 4JJDA 1AWJA 2KXCA 1K4US 2SEMA 1VYTA 4Z8AA 5FW9A 2K3AA 2FRWA 2MIOA 2L2PA 2EGCA 2RQWA 1PRLC 1GFCA 2DL4A 1YWOA 2O9SA 2W0ZA 4LUDA 2IIMA 4CC3A 2YUNA 5I11A 1QWFA 4F0WA 5FWBA 3EG3A 2SRCA 2C0IA 2D8HA 1ABQA 4RUGA 4E6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AZE A;  2PZ1 A;  1BU1 A;  1UTI A;  1GBR A;  4CSH A;  3EHQ A;  1CKA A;  1RI9 A;  2C0O A;  2A37 A;  4M4Z A;  4OLK A;  1E7O A;  1ZLM A;  3EG1 A;  2GBQ A;  2ROL A;  3VS4 A;  3GBQ A;  2IOA A;  2A28 A;  1NLO C;  3PVQ A;  3VS0 A;  1KSW A;  3PBI A;  2AZS A;  4JJB A;  2RMO A;  1HSQ A;  4GLM A;  1JXO A;  3QWY A;  2HEQ A;  4Y92 A;  1EFN A;  1OPL A;  4K11 A;  1CKB A;  4D8K A;  1H92 A;  1WIE A;  1UHC A;  2RQV A;  1CSK A;  4FGE A;  1M3C A;  1NM7 A;  2CUB A;  1NYG A;  1LCK A;  2RQT A;  2FRY A;  1ZSG A;  3VS5 A;  3S0Q A;  2ESW A;  3VRY A;  3M0S A;  1A0N B;  3VRZ A;  3VS2 A;  4WCI A;  2GGR A;  2FPF A;  2J05 A;  4JZ3 A;  1FYN A;  2KNB B;  4R0K A;  4LN2 A;  1JEG A;  5IHI A;  2YUP A;  1IO6 A;  2L3P A;  4KRT A;  1OEB A;  2GQI A;  1BK2 A;  1H8K A;  4F4M A;  1WDX A;  1ZBJ A;  1PKT A;  3NMZ C;  2DMO A;  3U23 A;  4EOB A;  2EBP A;  4FQB A;  2K3B A;  4FSS A;  1WFW A;  2YUO A;  1K0X A;  2X3W D;  1X6B A;  2DL8 A;  2LP5 A;  2O88 A;  3PBC A;  2IOB A;  5I22 A;  1M8M A;  2KRM A;  2KRN A;  4RTX A;  1VYV A;  2VWF A;  4F0V A;  1MV0 B;  2VKN A;  1I1J A;  3EG2 A;  3A30 A;  1BB9 A;  4AFQ C;  5L23 A;  3TVT A;  2CT4 A;  2KXD A;  2LQN A;  3UF4 A;  3PVL A;  1K0S A;  1K9A A;  1XOV A;  4ESR A;  2KRS A;  1WXU A;  1VA7 A;  2MOX A;  1V1C A;  1TUD A;  2J6F A;  3VS3 A;  1AZG B;  2ED0 A;  2K6D A;  4Q4G X;  1SPK A;  3REB B;  1K1Z A;  4HVU A;  3NGP A;  2K7A A;  3H0F A;  2RPN A;  1KIK A;  1GRI A;  4DEY A;  4J9C A;  5ECA A;  3UA6 A;  1UGV A;  1TG0 A;  2CT3 A;  1WYX A;  2YDL A;  2LZ6 B;  1U06 A;  2JS0 A;  1SHG A;  2HBW A;  2HSP A;  2JMC A;  4CC4 B;  1I07 A;  2KT1 A;  1AOJ A;  4AFZ C;  1S1N A;  1OOT A;  1AWO A;  4J9B A;  2J6K A;  3H41 A;  1AWX A;  2KYM A;  4CC7 A;  1UFF A;  2DM1 A;  1YN8 A;  2CRE A;  2O2O A;  4LUE A;  2LJ0 A;  1GCQ C;  4Q4T A;  3VS6 A;  3VS1 A;  4OMP A;  2K9G A;  4ZNX A;  4CT3 A;  2DRK A;  2JW4 A;  3QWX X;  2JS2 A;  1GL5 A;  4X1V A;  2VPM A;  2CSQ A;  2EYY A;  1JQQ A;  1T3S A;  2AKK A;  1VYU A;  1UE9 A;  1NYF A;  4JJC A;  2BTT A;  4F17 A;  3LH5 A;  1SHF A;  3A2Z A;  3SEM A;  1X6G A;  2YUQ A;  4J9G A;  2FO0 A;  2M0Y A;  4HXJ A;  1SRM A;  4EQ8 A;  2EGA A;  2ABL A;  2FEI A;  3RBB B;  4ORZ A;  2KBT A;  2CH4 W;  4OMM A;  1FMK A;  2M51 A;  2IO9 A;  1RLP C;  2ECZ A;  4QT7 A;  1U5S A;  1M30 A;  1YCS B;  3KFV A;  3EGU A;  1PHT A;  2XMF A;  5IHK A;  1YWP A;  3I9Q A;  3M0Q A;  4HVV A;  4HZ9 A;  1WLP B;  5FWC A;  1K76 A;  2CDT A;  5IXF A;  2B86 A;  2PTK A;  1U3O A;  1W70 A;  4LJ1 A;  1PNJ A;  2EYW A;  2DE0 X;  4J9F A;  4AG2 C;  2GNC A;  2X3X D;  1NEB A;  1X43 A;  2ENM A;  1AEY A;  1NEG A;  2F2W A;  1JO8 A;  2FPD A;  3A2Y A;  3O98 A;  1WX6 A;  2MCN A;  3I5R A;  4Q4N A;  2L3S A;  1QKX A;  2H8H A;  2LJ1 A;  1E6H A;  1B07 A;  3I5S A;  1Z9Q A;  2YT6 A;  4AFU C;  4J9E A;  2RN8 A;  1ABO A;  4RTZ A;  2KE9 A;  3PE0 A;  4JZ4 A;  2D8J A;  2DJQ A;  2XIV A;  2KRO A;  5IXB A;  2QDL A;  4RTU A;  1T3L A;  1WXT A;  2NUZ A;  4AFS C;  2IO7 A;  1SEM A;  2HDA A;  1Y0M A;  1PRM C;  1AWW A;  2K2M A;  2K79 A;  2GTO A;  2JMA A;  2GTJ A;  3RNJ A;  4GBQ A;  2D0N A;  1UG1 A;  1MUZ A;  1UDL A;  2EW3 A;  1T0H A;  2DBM A;  3M0T A;  3ZL7 C;  3EG0 A;  2J06 A;  2RQU A;  2LRJ A;  1B3Q A;  2L3Q A;  2DA9 A;  1KFZ A;  3FJ5 A;  3REA B;  2VOB A;  4JXB A;  2LNH B;  2OAW A;  2O31 A;  2DIL A;  1GCQ A;  4RTW A;  1ARK A;  2E5K A;  1X69 A;  2KEA A;  2CUD A;  4Z89 A;  4AG1 C;  1ZUU A;  2JTE A;  5GJV B;  1ZUY A;  3M1U A;  2EYZ A;  2P4R A;  3I86 A;  1YNZ A;  3GT2 A;  3NHN A;  3THK A;  1X2K A;  4LNP A;  1E6G A;  1AD5 A;  2LMJ A;  2D1X A;  1SSH A;  3H0H A;  2DL3 A;  3I35 A;  1JU5 C;  2JM8 A;  3R6N A;  1T0J A;  2RF0 A;  3A98 A;  5IHN A;  2OI3 A;  4Z88 A;  2JM9 A;  2OJ2 A;  2IO8 A;  4CGK A;  2JT4 A;  2DVJ A;  4EQA A;  1ZX6 A;  1UJ0 A;  1PWT A;  3TSZ A;  3O5Z A;  1TUC A;  1NG2 A;  2BZ8 A;  4A63 B;  2KT8 A;  5IH2 A;  1AVZ C;  4EIK A;  4OMQ A;  3M0R A;  4FGI A;  1WA7 A;  1WI7 A;  2YSQ A;  1KJW A;  5EC7 A;  2VPS A;  3UAT A;  2RQR A;  2F2X A;  2LJ3 A;  2LCS A;  2CSI A;  1OPK A;  4J9H A;  1G83 A;  1QLY A;  2L0A A;  2DL5 A;  4RTT A;  2DLP A;  4HPE A;  2EPD A;  1M3B A;  2G6F X;  4LE9 A;  2DRM A;  4J9I A;  4HZB A;  2JXB A;  4HVW A;  3SHW A;  3M0P A;  1MV3 A;  2DYB A;  2PNI A;  2RNA A;  1UEC A;  2DBK A;  3TSW A;  4FGD A;  2KGT A;  2F2V A;  1NLP C;  2ED1 A;  4J9D A;  1J3T A;  4RTY A;  1Y57 A;  2IF6 A;  1M27 C;  4RTV A;  4IIM A;  1GBQ A;  2VVK A;  2AK5 A;  2A36 A;  2I0N A;  2KYB A;  3VPI A;  2C0T A;  1X2Q A;  1QCF A;  2K1G A;  5GJW B;  4IIO A;  2FPE A;  2AZV A;  3UA7 A;  1RLQ C;  3JV3 A;  2CH4 A;  2W10 A;  4FDY A;  2V1R A;  1UUE A;  2DL7 A;  1HD3 A;  1HJD A;  1H3H A;  3H0I A;  2EYX A;  4D8D A;  3NPF A;  1UJY A;  2J6O A;  4OMN A;  2FG0 A;  1M3A A;  2EGE A;  2EVR A;  1GCP A;  4HCK A;  1YP5 A;  2HCK A;  3ULR B;  2AKL A;  3IQL A;  2EQI A;  1W6X A;  1WXB A;  4CC2 A;  2A08 A;  1I0C A;  5HCK A;  2LQW A;  1ZUK A;  4F16 A;  2ROT A;  2V1Q A;  3M0U A;  1SRL A;  2J7I A;  3CQT A;  4DEX A;  2LX7 A;  2DF6 A;  4FQA A;  1JXM A;  1X27 A;  2DNU A;  2EKH A;  1GFD A;  3KW0 A;  1QKW A;  4OML A;  1OV3 A;  4F14 A;  3VS7 A;  4JPB W;  4OMO A;  2BZY A;  1RUW A;  1G2B A;  3EHR A;  1UHF A;  2DX1 A;  2O9V A;  2NWM A;  1W1F A;  2BZX A;  2KR3 A;  3C0C A;  3NE0 A;  1PKS A;  1QWE A;  3VPJ A;  1BBZ A;  1Z9Z A;  1N5Z A;  4JJD A;  1AWJ A;  2KXC A;  1K4U S;  2SEM A;  1VYT A;  4Z8A A;  5FW9 A;  2K3A A;  2FRW A;  2MIO A;  2L2P A;  2EGC A;  2RQW A;  1PRL C;  1GFC A;  2DL4 A;  1YWO A;  2O9S A;  2W0Z A;  4LUD A;  2IIM A;  4CC3 A;  2YUN A;  5I11 A;  1QWF A;  4F0W A;  5FWB A;  3EG3 A;  2SRC A;  2C0I A;  2D8H A;  1ABQ A;  4RUG A;  4E6R A; 
#chains in the Genus database with same CATH topology
 2PZ1 A;  3TRE A;  4BI3 A;  1CKA A;  1RI9 A;  1VQO Q;  4M78 F;  4M4Z A;  2F5K A;  3EG1 A;  3GBQ A;  4M75 F;  3EGX B;  2IOA A;  2CZ1 B;  3VS0 A;  5A0G A;  1QP3 A;  3I55 T;  2XID A;  1HSQ A;  3JCM W;  1D0Z A;  1LVK A;  2CKK A;  2KK4 A;  1OPL A;  3V7S A;  5GAM g;  1VQP T;  1CKB A;  3OYJ A;  3OYE A;  1H92 A;  2RQV A;  1IHW A;  2ZPB B;  2CUB A;  2DEU A;  4F7U B;  5LJ3 f;  2A0F B;  1NYG A;  2FRY A;  3VS5 A;  1PSF A;  4LDX A;  4M7A B;  3VRZ A;  3MET A;  3E1S A;  3VS2 A;  3I56 T;  2MWO A;  2FPF A;  5I21 A;  2J05 A;  2VB6 A;  1V29 B;  3HHT B;  3QDR B;  2RO0 A;  4C5G A;  3RDV A;  5LJ3 e;  1OEB A;  2MF2 A;  5GAN g;  4M7D E;  4BB7 A;  1WDX A;  1WJS A;  5HKC A;  4QW2 A;  2K3X A;  2JUF A;  3U23 A;  4C8Q B;  2OX7 A;  3ZFJ A;  2K3B A;  4FSS A;  1YJW T;  4E7S A;  1X6B A;  2DFU A;  2LP5 A;  3PBC A;  1PC0 A;  2K5L A;  4RG8 A;  3G4S Q;  2RK1 A;  5I22 A;  3L42 A;  4HA8 A;  3OYF A;  1YIT Q;  2QQB A;  1VYV A;  2AT1 B;  4FT4 A;  2GQV A;  1R8O B;  2EQM A;  1WGS A;  5GAO q;  1I1J A;  1UB4 A;  3EG2 A;  4HCB A;  2L89 A;  3TVT A;  5C6S A;  3EH1 A;  2CT4 A;  2E3I A;  4KUI A;  3CC2 A;  5LJ5 f;  2LQN A;  1WZO A;  2P0P A;  4D6W A;  3CCU Q;  1FX7 A;  1XOV A;  1NZ9 A;  3HTR A;  3MEV A;  2KRS A;  5GMK e;  1VA7 A;  3BDL A;  1VQL T;  3EG9 B;  1YJN Q;  1SG5 A;  3CCS Q;  2EQJ A;  3VS3 A;  2RHZ A;  3OYB A;  3M4G A;  4FIB A;  5D6W A;  1K1Z A;  5LJ5 e;  2FZK B;  3NGP A;  1HK9 A;  1KQS A;  2RPN A;  2BIV A;  4DEY A;  3G6E A;  4TVR A;  1K8A U;  2EQU A;  3UA6 A;  2ZGW A;  1UGV A;  2CT3 A;  4M7D B;  2YDL A;  2LZ6 B;  4E7H A;  4LXC A;  1U06 A;  4IUT A;  4RMO A;  3OYA A;  3HRT A;  2JMC A;  4XU3 A;  1AOJ A;  4AFZ C;  1S1N A;  4J9B A;  4LDY A;  2J6K A;  3H41 A;  2A3L A;  2LT1 A;  1QVF A;  2LCC A;  1Y96 B;  4PL6 A;  2OTL T;  1BYM A;  3VS1 A;  4ZN3 A;  5IN1 A;  3QXE B;  3CC4 T;  2CSQ A;  3E19 A;  2QAS A;  3G71 A;  1NYF A;  3RUX A;  2BTT A;  3SEM A;  1X6G A;  3OQ5 A;  3CCL Q;  2YUQ A;  4J9G A;  2M0Y A;  4HXJ A;  5CK9 A;  3RMS A;  4J6Y A;  2EAY A;  3BY7 A;  3MCA B;  2ABL A;  2FEI A;  2KBT A;  4PFP A;  3EFS A;  1HXD A;  1M30 A;  3X28 B;  2E6Z A;  3PGG A;  3I9Q A;  1S72 A;  4O5V A;  3CMA Q;  2CP7 A;  5IXF A;  1BIA A;  2B86 A;  2PTK A;  4J9F A;  2DE0 X;  5GAO m;  1UGQ B;  4M77 D;  3RER A;  5CVI A;  3C95 A;  5AT1 B;  4BUG A;  4J32 A;  1AEY A;  3G4S T;  2F2W A;  1NPP A;  1WX6 A;  2H8H A;  3C12 A;  1Q7Y R;  1ABO A;  2D8J A;  3CCM Q;  5IXB A;  4N4I A;  2QEX Q;  8ATC B;  1RAF B;  5GAM f;  4AFS C;  3FC3 A;  1SEM A;  1VQ7 A;  4FYX B;  4N0A C;  2K79 A;  2GTJ A;  1YJN T;  3FDR A;  2D0N A;  2XU8 A;  2EW3 A;  1T0H A;  1WHL A;  4A4G A;  1VOM A;  1I5O B;  5GAM e;  3DLL A;  2LQ8 A;  2RJD A;  2J06 A;  2RQU A;  2DA9 A;  1YI2 T;  3REA B;  3BE3 A;  2VUB A;  2OAW A;  4KUL A;  4XU1 A;  2E5K A;  2HQX A;  4JUR A;  1ZUU A;  2JTE A;  1RAC B;  2QA4 A;  1VQ9 A;  2EYZ A;  2JOY A;  1ZA2 B;  2P4R A;  4IUV A;  4V2S A;  1YNZ A;  7AT1 B;  2DET A;  4B9X A;  2LRQ A;  3SFM A;  3THK A;  2C06 A;  4LNP A;  3CPW P;  2LMJ A;  2D1X A;  3H0H A;  4XTW A;  1ZQ1 A;  2DL3 A;  4ZGE B;  1JU5 C;  4Q5W A;  2RF0 A;  3A98 A;  3BFM A;  1K73 U;  3GIB A;  2JT4 A;  1ZX6 A;  3ZBD A;  1PWT A;  4ME7 A;  1TUG B;  1NE8 A;  2DKG A;  3URG A;  4OMQ A;  3M0R A;  1WA7 A;  1KJW A;  4XTZ A;  3FEO A;  5KYX B;  1EX4 A;  4PFZ A;  2KSS A;  3HP9 A;  5KH6 A;  4C0G A;  3RR6 A;  3C4S A;  2P84 A;  2DLP A;  4KGX B;  2FYK A;  2H3E B;  1M3B A;  4HPE A;  3CEY A;  2G6F X;  1TS9 A;  2DRM A;  1M8V A;  3DB3 A;  1IRE B;  3VKI A;  2RNA A;  3H9N A;  3HL8 A;  2EWN A;  1QQJ A;  3KBG A;  4X9C A;  4FGD A;  3TSW A;  2KGT A;  3CCJ Q;  3CXC P;  4Y91 A;  1Y57 A;  2AK5 A;  3VPI A;  2RH2 A;  2QQ9 A;  4EMK C;  2E70 A;  3CCV A;  1QCF A;  5GJW B;  4IIO A;  2AZV A;  3A8O B;  1BI2 A;  1G3W A;  2XIC A;  2V1R A;  2DL7 A;  4PLI A;  4M78 D;  3CPW S;  3VUZ A;  1B34 A;  4JLI A;  2EYX A;  3OYG A;  4M75 D;  3SB2 A;  4OMN A;  5GAN d;  5IT9 E;  1GCP A;  2AKL A;  1W6X A;  1I5L A;  5KYW A;  1VUB A;  3AT1 B;  1I0C A;  1M90 C;  2LQW A;  1ZUK A;  2DO3 A;  1VQM Q;  2V1Q A;  2RI3 A;  2O01 E;  1MND A;  4A4K A;  3CQT A;  4DA4 A;  4PJN A;  3CME A;  2DF6 A;  1JXM A;  2RM4 A;  2M1H A;  1G8X A;  1WHG A;  3OA6 A;  5FU6 B;  2RHI A;  1OV3 A;  5FRO A;  3V7C A;  2BZY A;  3INZ A;  1M90 U;  1KQS P;  1UHF A;  2DX1 A;  2NWM A;  1W1F A;  4PJO C;  2PU9 B;  1LJO A;  3C0C A;  5CKE A;  1PKS A;  4EMH A;  2VC8 A;  2YWW A;  3VJP A;  4JJD A;  1YIJ T;  1O9S A;  2X35 A;  2MIO A;  2PUO B;  5GMK h;  2CZ7 B;  1PRL C;  3OMG A;  1YJ9 Q;  1UGR B;  1ZSZ A;  2E10 A;  4LUD A;  1QVF P;  2XG8 D;  5LJ5 h;  5CCA A;  2HBP A;  4KGZ B;  3CXC S;  4OB0 B;  4A53 A;  2ZPE B;  1ABQ A;  4FT2 A;  4PFO A;  4E6R A;  1AZE A;  4ZGJ B;  1BU1 A;  1YFN A;  2YLB A;  4KBM B;  2A37 A;  1OU9 A;  1E7O A;  4OLK A;  1ZBX A;  2ROL A;  1VQ8 Q;  1WQW A;  2COZ A;  4AT1 B;  1KSW A;  4C92 A;  1OU8 A;  3JB9 H;  1JXO A;  3QWY A;  2HEQ A;  4L59 A;  1TTH B;  2HL5 C;  4CRI A;  3TCJ A;  3OYK A;  1M1K C;  3I55 Q;  4K11 A;  2EYQ A;  2DIG A;  2X4X A;  1WIE A;  1UHC A;  3OYD A;  4FGE A;  1M3C A;  2HKN A;  1LCK A;  2RQT A;  2L3R A;  1VQP Q;  1ZSG A;  3VRY A;  3V7R A;  1A0N B;  2LX9 A;  4WCI A;  2AIR B;  3UWN A;  5FLX E;  2KNB B;  4BDY A;  3I56 Q;  1VQ4 A;  1KQ1 A;  4WTO B;  2OTJ Q;  4KRT A;  3ME9 A;  2GQI A;  3JCM Q;  1TXQ A;  2M0O A;  1KQS S;  3HSB A;  3NTH A;  2E12 A;  2DMO A;  2E64 A;  5LJ3 j;  4E7I A;  1G3S A;  3FJP A;  1OUL A;  1KC8 U;  4FQB A;  2K57 A;  2LNV A;  2BUD A;  4RG2 A;  2X3W D;  2EIF A;  5C0M A;  1UGP B;  2IOB A;  1XJW B;  2DD5 A;  1YJW Q;  4JRI A;  3JCM d;  1WQ7 A;  4JS5 A;  1QVF S;  5HY6 A;  3GP8 A;  2QAZ A;  1MNE A;  3CC7 T;  2VKN A;  1JBM A;  3A30 A;  4PJO F;  5I2S A;  1YHQ A;  2KXD A;  3UF4 A;  4M7A G;  3PVL A;  4UC4 A;  1Q86 C;  1K9A A;  3PMI A;  3CD6 A;  5GMK l;  4ESR A;  3CCQ A;  4O6J A;  4B6M A;  2FL7 A;  2MOX A;  1TUD A;  2EJG A;  1AZG B;  4R56 A;  1K9M C;  4HFL A;  3P8D A;  3REB B;  4HVU A;  4WF2 A;  4VUB A;  1Q86 U;  1KIK A;  1GRI A;  2VXF A;  4MDW A;  1QCN A;  4C8Q G;  5CKF A;  4OB1 B;  3CPW A;  3NFC A;  5GAM h;  4OP0 A;  5LJ5 j;  4R55 A;  2JS0 A;  4M7A C;  2JVV A;  2QQA A;  2RI5 A;  2E3H A;  2O4X A;  4C8Q E;  1I07 A;  2KT1 A;  3CCR T;  1TOV A;  2R58 A;  4JJN K;  1QP2 A;  1AWX A;  2HL3 A;  1VQ8 T;  1YN8 A;  4LUE A;  1Q82 U;  2LJ0 A;  1GCQ C;  3ZEH A;  4DOW A;  2OTL Q;  1VQO A;  2JW4 A;  3QZ9 B;  4C8Q C;  3N5B B;  3P8B B;  2RHU A;  1T3S A;  5GAN 2;  5GAN 3;  1M1G A;  3CC4 Q;  1KD1 R;  1RAH B;  1BI0 A;  1MHN A;  4J7F A;  1B34 B;  5J26 A;  1VQ5 A;  3GNF B;  3UDC A;  2XHC A;  4EQ8 A;  2EGA A;  4L6V 5;  4PK4 A;  3WVE B;  3MEU A;  4ORZ A;  4OMM A;  4M7D G;  1RAD B;  5HK3 A;  2OTJ T;  1JRI A;  5KYW B;  1RLP C;  2VGN A;  4QT7 A;  3MJX A;  1U5S A;  1YCS B;  2CP2 A;  3EGU A;  3KFV A;  3SWN A;  2PVO B;  4C92 E;  1JJ2 P;  1WLP B;  3CXC A;  5GMK m;  1PNJ A;  2EYW A;  5A0L A;  1X43 A;  2X9H A;  1Q95 G;  2KY9 A;  3TU4 K;  1RI0 A;  1M9S A;  5KYX A;  1VIE A;  2HKQ B;  1M4Z A;  3A2Y A;  2FPD A;  3CCE A;  4M7D C;  1FMV A;  3M53 A;  1WHH A;  3QHS A;  3I5S A;  4QKU A;  2YT6 A;  2G3R A;  3PE0 A;  3QBY A;  2QDL A;  2Z0W A;  2IG0 A;  4RTU A;  1WHM A;  4XTU A;  1ZSZ B;  2HDA A;  1Y0M A;  4HT8 A;  2ZPG B;  1AWW A;  1IXD A;  1R77 A;  2K2M A;  1V76 A;  2GTO A;  1D1B A;  2FZC B;  3RNJ A;  1VQ6 A;  2XDP A;  1K8A C;  2QYZ A;  1MUZ A;  2QGG A;  3CCU A;  5DLQ E;  4F7U F;  3ZL7 C;  5GAO l;  3EG0 A;  3PFS A;  2K3Y A;  4M7A F;  1B3Q A;  3CCS A;  4QQG A;  4JXB A;  1OZ3 A;  2O31 A;  2DIL A;  4C0D B;  1AHJ B;  4C92 B;  1YI2 Q;  2CUD A;  4Z89 A;  4N4G A;  4AG1 C;  1ZUY A;  1H3Z A;  2LQK A;  3HKS A;  2BE7 D;  1AT1 B;  1N8R R;  3GT2 A;  4M77 A;  3NHN A;  2CZ0 B;  3G6E Q;  4C8Q F;  2IPO B;  1C1A A;  3OW2 P;  4HCC A;  4EPC A;  1MMN A;  1JJ2 S;  4J30 A;  1LPL A;  3R6N A;  1UEB A;  2K2V A;  4ATO A;  1OX8 A;  1WJQ A;  2JM9 A;  3LH0 A;  4J8O A;  3EH2 A;  4EQA A;  1SKU B;  3M55 A;  4LD9 K;  1FMW A;  3O5Z A;  1BI3 A;  4JLG A;  2KT8 A;  5IH2 A;  3A5Z B;  3R6O A;  4FGI A;  4C5E A;  2VPS A;  2DIQ A;  5D7U A;  2F2X A;  1I4K 1;  2LCS A;  3CCL A;  5LJ3 d;  1OPK A;  4J9H A;  1O75 A;  1M2V A;  1QLY A;  1VQ5 T;  2DL5 A;  1IHV A;  4LE9 A;  2QQR A;  4HZB A;  2MI6 A;  2FVU A;  1YCY A;  4HVW A;  3SHW A;  3M0P A;  1MV3 A;  2DYB A;  1KHC A;  4PKC C;  3DLM A;  1UEC A;  5M9O A;  4M7D F;  2QI2 A;  3CMA A;  2DBK A;  3M57 A;  4C0Z A;  3JCM g;  1NLP C;  4J9D A;  1DJ7 B;  1NJI R;  1J3T A;  4RTY A;  3X26 B;  2IF6 A;  3EFO A;  4RTV A;  4ZGD B;  2MMP A;  4IIM A;  2A36 A;  2XDD A;  4NL2 A;  3RMQ A;  1OYX A;  4J6X A;  4JRK A;  2FPE A;  4DBR A;  3CCE T;  2CH4 A;  1BCM A;  1RAA B;  1JB0 E;  2F69 A;  2CS7 A;  5FU7 B;  2YRD A;  2JNG A;  2K5F A;  1KHI A;  3NPF A;  3OW2 S;  2O4X B;  3LWH A;  4HCK A;  2FHD A;  4RCB A;  3ULR B;  3IQL A;  2EQI A;  3CC2 T;  3VYG A;  4PNO A;  3GLX A;  2A08 A;  5CIU A;  4XTX A;  3M0U A;  4DEX A;  3OS0 A;  4FQA A;  2A7Y A;  5GAN f;  4KH1 B;  1SSF A;  4F14 A;  3VS7 A;  4OMO A;  1BCO A;  2IVW A;  3C94 A;  2DVE A;  3G6E T;  1K73 C;  2KR3 A;  1QWE A;  2E5Q A;  2DTH A;  5GAN e;  1AWJ A;  3RKY A;  1G3T A;  2K3A A;  4GY5 A;  1YIJ Q;  1GFC A;  2DL4 A;  1YWO A;  2O9S A;  1RAI B;  1TU0 B;  3VUB A;  1X75 C;  3SWN B;  1D0Y A;  1PD0 A;  4F0W A;  3GF5 A;  4PJM A;  1OZ2 A;  4M78 A;  3EAE A;  2YHT A;  1M90 R;  3E9F A;  2C0I A;  4M75 A;  1PD1 A;  3KUF A;  1PSE A;  4ZTJ A;  1UTI A;  4FM4 B;  4M77 E;  4P5N A;  4CSH A;  3QYH B;  3JB9 I;  2MAM A;  3G71 T;  2DJZ A;  1ZLM A;  4PJO D;  2GBQ A;  4LDV A;  3X25 B;  3M56 A;  2NUT A;  2A28 A;  1NLO C;  3PVQ A;  2RHX A;  4FU6 A;  2AZS A;  5GAN 6;  4GLM A;  1VIF A;  3HRU A;  4IUR A;  1Q7Y C;  2QK0 A;  4D8K A;  1OX9 A;  3P8H A;  2D0Q B;  1EIF A;  1Q81 C;  3M58 A;  3EBQ A;  1VQK A;  4MDX A;  3M0S A;  3F70 A;  2MWP A;  2B8A A;  3GOX A;  1S72 T;  2M9U A;  1JJ2 A;  1WHK A;  3JB9 G;  1FYN A;  2PVG B;  4LN2 A;  3S3M A;  1Q7Y U;  4E7K A;  5FU6 C;  1IO6 A;  2L3P A;  2DYI A;  3QO3 A;  1BK2 A;  1H8K A;  1Q81 U;  3S3O A;  4F4M A;  1ZBJ A;  4QVD A;  3NMZ C;  3J81 E;  3H8Z A;  4J83 A;  3OYI A;  2JZ2 A;  1KG1 A;  4EOB A;  3JCM X;  5D6X A;  3HPW A;  4DQ2 A;  2YUO A;  4M77 B;  1K0X A;  1X6O A;  1M1K R;  2DL8 A;  2O88 A;  3MKD A;  1VQ7 T;  4HCZ A;  3NTK A;  2KRN A;  3V8K A;  2R5A A;  2VWF A;  2KAF A;  2XDB A;  4F0V A;  3V8L A;  1MV0 B;  3M9Q A;  2HSE B;  3FIF A;  1M1F A;  4AFQ C;  1VQM A;  4ELZ C;  4BE1 A;  2QXF A;  3CC7 Q;  5CAI A;  5KCO A;  3S6W A;  1K0S A;  1BKB A;  4A4F A;  3JCM f;  3L2R A;  1OI1 A;  2HMA A;  1WXU A;  1V1C A;  2J6F A;  2ED0 A;  4FYV B;  2K6D A;  2WP7 A;  2X51 A;  1SPK A;  2QA4 T;  1VQ9 T;  3FB9 A;  4Q4G X;  2K7A A;  2EFI A;  1M2V B;  3H0F A;  1HYO A;  2ATC B;  3JCM e;  4OMF B;  2JJ9 A;  1VQN A;  1TG0 A;  3OYL A;  2D6F A;  5A2Q E;  2COY A;  3OYM A;  3J80 E;  5IAY A;  2HBW A;  5KE3 A;  3OW2 A;  3CBO A;  4XTY A;  5LJ3 g;  1YJ9 A;  1C0M A;  4KH0 B;  3ASK A;  1D3B B;  4CC4 B;  2HQE A;  2E6N A;  3ER0 A;  5GAO p;  1IRX A;  1AWO A;  2HZY A;  1N9R A;  4JRQ A;  3CCR Q;  2DM1 A;  2V26 A;  2CRE A;  1MMD A;  3EFO B;  2K9G A;  4CT3 A;  3QZ5 B;  3WXM B;  2DRK A;  3LWI A;  5CQX A;  3QWX X;  2JS2 A;  2RB6 A;  4M78 G;  2VPM A;  2HQH A;  2DPP B;  3E2U A;  2EYY A;  4M75 G;  2D9T A;  4XU0 A;  1VYU A;  1UE9 A;  4BE2 A;  1K9M R;  4JJC A;  3LX7 A;  5KE2 A;  4F17 A;  3WVD B;  1SHF A;  2L8D A;  3E9G A;  4M78 E;  5A0D A;  4M7A D;  2FO0 A;  1SRM A;  4M75 E;  4NOY A;  2RJF A;  1VQP A;  1XNI A;  1FMK A;  2H3J A;  2IO9 A;  5CKD A;  4RCC A;  1VQK T;  2ECZ A;  4MMK A;  4EMG A;  3L2W A;  1KC8 C;  3OY9 A;  1KQ2 A;  1W4S A;  4YTL A;  1ZA1 B;  2VGM A;  3A8L B;  3JCM c;  1U1S A;  2CDT A;  2VXE A;  2JTF A;  1C6V X;  1MGQ A;  3JB9 F;  1W70 A;  4LJ1 A;  1F1B B;  3CCV T;  4AG2 C;  3OS2 A;  1W2B S;  4XU2 A;  2ENM A;  3PIP A;  1NEG A;  2V8I A;  3MPU B;  2QQS A;  2X4W A;  3O98 A;  3I5R A;  4DBQ A;  3G7Z A;  3CPF A;  1QKX A;  2LJ1 A;  1Z9Q A;  1XQH A;  4AFU C;  4J6W A;  4JZ4 A;  2DTI A;  4PLL A;  2KRO A;  3DB4 A;  1YJW A;  2NUZ A;  2IO7 A;  4LD6 A;  3LGF A;  5CKB A;  4C5I A;  3PIO A;  3OYC A;  3JRZ A;  2VAS A;  4E7J A;  4M78 B;  1QW1 A;  2DEQ A;  1UG1 A;  4M75 B;  2YXY A;  1QMC A;  3CME T;  1UDL A;  2DER A;  2DBM A;  4GLK A;  2WAC A;  3M0T A;  4E47 A;  2LRJ A;  2WSC E;  1YHQ Q;  3FJ5 A;  3VU3 C;  5LL6 S;  5GMK j;  2VOB A;  2NUT B;  4M7D D;  5CR2 A;  4RTW A;  1ARK A;  2EJF A;  1VQL A;  4L5G A;  1X69 A;  5GJV B;  2OAU A;  2RD1 A;  1Q82 C;  3MP1 A;  4Y28 E;  1G3Y A;  3X24 B;  1AD5 A;  1E6G A;  1ACM B;  2DK3 A;  2FZG B;  4BE0 A;  2COW A;  2RJC A;  3I35 A;  2JM8 A;  3OSV A;  5IHN A;  2QTX A;  2GFA A;  2OJ2 A;  2IO8 A;  1K8A R;  3OS5 A;  3MP8 A;  5GAN h;  1UJ0 A;  2F5T X;  2OTL A;  2DZC A;  1NG2 A;  2BZ8 A;  4A63 B;  1AVZ C;  2DTO A;  3JCM V;  1WI7 A;  2RI2 A;  1XTD A;  2YSQ A;  2KI7 A;  3CC4 A;  3OYH A;  2CSI A;  4HKE A;  4C92 G;  2FB7 A;  2CP0 A;  2E41 A;  1ZSZ C;  2L0A A;  4RTT A;  1G5V A;  2M02 A;  2EPD A;  3MEA A;  4OGC A;  1RAE B;  4QQ6 A;  2P4T A;  1VQ5 Q;  1FXX A;  2JXB A;  2Y4Y A;  2PNI A;  4BY6 B;  1Y71 A;  1VQ4 T;  3A8H B;  5KYY A;  1D0X A;  3LW5 E;  4N0A A;  2V8J A;  2F2V A;  2ED1 A;  3RKX A;  3EGD A;  1M27 C;  4C0D C;  2VV5 A;  1IGU A;  4C92 C;  2VVK A;  2I0N A;  1R0C B;  2KYB A;  2X4J A;  1X2Q A;  3JCM J;  2BE9 B;  3OBY A;  4ANJ A;  3OMC A;  3KXT A;  1RLQ C;  3JV3 A;  4E2F B;  3G4S A;  2W10 A;  3RIR A;  4FDY A;  4MZT A;  5FRM A;  1UUE A;  1YIT A;  5CO7 A;  1HD3 A;  3M4Y A;  3MHX A;  1X01 A;  3H0I A;  4KGV B;  3CCE Q;  4D8D A;  1M3A A;  2EGE A;  2EVR A;  3BW1 A;  1YP5 A;  3L2U A;  1D1C A;  3H6Z A;  5GAN 7;  1YHQ T;  4XK8 E;  5HCK A;  2ROT A;  2DXT A;  1TSF A;  3CD6 T;  3CC2 Q;  3CCQ T;  2P0K A;  4FW1 A;  1YJN A;  1MMG A;  2LX7 A;  3HFO A;  3SDZ A;  2R5M A;  1VQ6 Q;  1M2O A;  5GAM j;  2RHY A;  2EKH A;  1GFD A;  4HFK A;  1OQK A;  4IUQ A;  1W2B A;  2I2L A;  4JPB W;  3GPL A;  1YI2 A;  1RUW A;  1G2B A;  4IUU A;  2KMT A;  2JN0 A;  2BZX A;  1N5Z A;  1K4U S;  2KXC A;  3PNW C;  1KD1 C;  1I8F A;  2KVQ G;  2SEM A;  2LCL A;  1VYT A;  4RKU E;  5FW9 A;  2L2P A;  2EGC A;  5KYU A;  2W0Z A;  2XK0 A;  5GAN j;  3LGL A;  4FL6 A;  2IIM A;  2QG9 B;  5I11 A;  3JAM E;  4N4H A;  2ZPH B;  2LC4 A;  1KD1 U;  5KYN A;  1VQO T;  1GXI E;  3VV0 A;  3JCM h;  4KT0 E;  3AHU A;  3QKJ A;  2LVM A;  1GBR A;  3EHQ A;  2C0O A;  4DOV A;  5AYF A;  3VS4 A;  5GAO n;  5FU7 C;  2MK5 A;  3G71 Q;  1MMA A;  3PBI A;  1YBY A;  2RMO A;  2X4Y A;  4JJB A;  1K73 R;  1LNX A;  2CP3 A;  2LTO A;  1EFN A;  1TH7 A;  4Y92 A;  4EMK A;  1UGS B;  2NLU A;  3S3N A;  2ZPI B;  2DXU A;  4BD3 A;  2M16 A;  2HAX A;  2DXC A;  1CSK A;  3GNG A;  1NM7 A;  4C92 F;  1D3B A;  3MP6 A;  4MML A;  3S0Q A;  2ESW A;  2DXB A;  1N6A A;  3QDF A;  4DBH A;  1WPY A;  2GGR A;  2VYT A;  4NL3 A;  4JZ3 A;  4R0K A;  1JEG A;  2E4H A;  2LT4 A;  5IHI A;  1S72 Q;  1TWB A;  3BDU A;  2YUP A;  3JCM P;  1N9S A;  4FW2 A;  4EDU A;  4OB2 B;  4C0F A;  4CI0 C;  1PKT A;  4BI4 A;  4BAC A;  1R0B G;  3CCM A;  1D09 B;  2CZ6 B;  3FLG A;  5GAO r;  2EBP A;  2QEX A;  5DM7 R;  3QUI A;  1WFW A;  1YIT T;  5LJ5 d;  2P0Q A;  4ZN1 A;  4PJO A;  1M8M A;  3SWN C;  2KRM A;  1N8R C;  4E7L A;  4RTX A;  1VQ6 T;  1SF9 A;  1VQ7 Q;  1Q81 R;  4JRP A;  4II1 A;  3UT1 A;  2XKO C;  4HT9 A;  4C5H A;  3CCU T;  1BB9 A;  5L23 A;  1IB8 A;  3T9N A;  5I2M A;  2Y4X A;  5HK0 A;  2F1L A;  5GAN 8;  3CCS T;  1N8R U;  1PM3 A;  2GFU A;  5L8R E;  2QDY B;  1B7T A;  3X20 B;  3A8M B;  1QVG P;  2YRV A;  3JB9 D;  3HRS A;  2QA4 Q;  1VQ9 Q;  3PMT A;  4J9C A;  4PJL A;  5ECA A;  4B9W A;  4OF1 A;  1WYX A;  2CGH A;  5DLO A;  1SHG A;  1YIJ A;  1M5Q 1;  4M77 G;  3A1P A;  2HSP A;  4Z02 A;  2EQK A;  4A54 A;  1FWZ A;  5KYY B;  1OOT A;  2AHJ B;  2KYM A;  1LOJ A;  3D7S B;  4CC7 A;  4DBF A;  5FRN A;  1UFF A;  2O2O A;  3RKW A;  4JUV A;  2PVD B;  2YRC A;  3EGD B;  4Q4T A;  3VS6 A;  4OMP A;  4ZNX A;  2ZCF B;  2CP6 A;  1NJI C;  1GL5 A;  2QTV A;  4X1V A;  4FSX A;  2MYS A;  2QGF B;  3PT9 A;  2L5Q A;  1JQQ A;  3CCL T;  4A4E A;  2AKK A;  4MZM A;  2DD4 A;  4M77 C;  3QYG B;  5D6Y A;  4E7Z A;  3LH5 A;  5GAN 4;  4A4H A;  3A2Z A;  1EZZ B;  3JSC A;  3HFN A;  3FRN A;  1U1T A;  1NJI U;  3L2V A;  2ZAE A;  3OB9 A;  4JDS A;  3RBB B;  2YLC A;  2CH4 W;  2NUP A;  5J39 A;  3O8V A;  2M51 A;  2MPX C;  3CMA T;  3CCJ A;  1PHT A;  2XMF A;  5IHK A;  1YWP A;  2K5I A;  3J7A F;  1VQK Q;  3M0Q A;  4HVV A;  4HZ9 A;  5FWC A;  1K76 A;  3M5A A;  5GAN 5;  8AT1 B;  1P92 A;  3JB9 J;  1U3O A;  4PJJ A;  2GNC A;  2X3X D;  1NEB A;  3EFR A;  1QVG S;  5GAM d;  1WJR A;  1WNL A;  3CCV Q;  1JO8 A;  3JCM b;  3EGX A;  2MCN A;  4Q4N A;  3CCM T;  2L3S A;  3QJ6 A;  2QEX T;  1E6H A;  1B07 A;  4OVA A;  4J9E A;  2RN8 A;  4RTZ A;  2KE9 A;  1RL2 A;  2DJQ A;  2XIV A;  1IZ6 A;  5KYU B;  1T3L A;  1WXT A;  1Y7X A;  2V8K A;  2E65 A;  4F7U A;  6AT1 B;  3OS1 A;  3LYI A;  1PG5 B;  1PRM C;  3QPH A;  5CQY A;  5LJ3 h;  3QG1 A;  1NBE B;  4M7A A;  1D1A A;  3G1J A;  2JMA A;  3SD4 A;  2EKO A;  3QII A;  4PJO G;  4GBQ A;  1KC8 R;  3CC7 A;  4BDZ A;  5J3B A;  3V8J A;  3CME Q;  1W2B P;  2L3Q A;  1KFZ A;  1PCX A;  3PTA A;  4PJO E;  2LNH B;  3QJY A;  1BIB A;  4HFF A;  3QSU A;  1GCQ A;  2KEA A;  5DY9 A;  2NYS A;  4QQD A;  4EMK B;  4C8Q A;  2ZZD A;  3LLR A;  3M1U A;  1QVP A;  3I86 A;  2HD0 A;  2GF7 A;  1X2K A;  2Y90 A;  3OYY A;  2RJE A;  2BKD N;  1SSH A;  1VQN Q;  2XI9 A;  3Q1J A;  5KCH A;  3UPU A;  4IUP A;  4NS5 A;  1T0J A;  4M77 F;  4QVC A;  1Q86 R;  2OI3 A;  4Z88 A;  3CCR A;  4JS4 A;  4CGK A;  2DVJ A;  2KQW A;  2DAQ A;  3TSZ A;  2GCX A;  1VQ8 A;  1TUC A;  1RAG B;  4XQ3 A;  4EIK A;  3EG9 A;  2EJ9 A;  4OB3 B;  3I55 A;  5EC7 A;  3UAT A;  3VYH B;  2RQR A;  2WSF E;  2LJ3 A;  2KDS A;  3MO8 A;  1I81 A;  1G83 A;  5CKH A;  4J5Y A;  2CYZ B;  1Q82 R;  5GMK i;  1QCO A;  4PJO B;  4XTV A;  4M7D A;  3CBM A;  2RK2 A;  1KK7 A;  4M78 C;  4J9I A;  4M75 C;  3I56 A;  5LJ5 g;  4C8Q D;  2OTJ A;  2ZPF B;  3CCJ T;  4FYY B;  4LDU A;  1Y96 A;  1Y07 A;  3TEE A;  1M1K U;  1VQ4 Q;  4MZP A;  1GBQ A;  2XD0 A;  3OBW A;  2C0T A;  2JTM A;  3NTI A;  4FYW B;  2K1G A;  3UA7 A;  1U8R A;  4BI8 B;  1NPR A;  1HJD A;  2E1H A;  3RES A;  1H3H A;  3M59 A;  2WSE E;  1N27 A;  1UJY A;  2J6O A;  4QVZ A;  2FG0 A;  2CP5 A;  5EG2 A;  1VQM T;  2HCK A;  1WXB A;  3MEW A;  4CC2 A;  4F16 A;  4ZTF A;  3DKM A;  1H64 1;  4C92 D;  1SRL A;  2J7I A;  4F7U G;  4KUD K;  4F04 B;  3L2Q A;  3CD6 Q;  3L2Z A;  4ELY C;  1X27 A;  2PUK B;  3CCQ Q;  2R57 A;  2DNU A;  3TQ7 P;  3KW0 A;  4X34 A;  1QKW A;  4X9D A;  4OML A;  1QVG A;  4F7U E;  4AMC A;  3A8G B;  2K4Y A;  3OSS C;  3EHR A;  2O9V A;  4OGE A;  2HNI A;  4M7A E;  1IGQ A;  3CBP A;  4FCY A;  1VQN T;  3NE0 A;  3VPJ A;  4XAX B;  1BBZ A;  1Z9Z A;  1VQL Q;  1BI1 A;  4Z8A A;  1YJ9 T;  3OYN A;  4J7I A;  2FRW A;  3M54 A;  2NUP B;  2RQW A;  4BY6 C;  2DZ9 A;  2RA2 A;  1ZHI A;  4IKF A;  1WHJ A;  1RAB B;  2YUN A;  4CC3 A;  3L1A A;  1QWF A;  2PQW A;  1K9M U;  5FWB A;  3EG3 A;  2LDM A;  2SRC A;  4LDW A;  9ATC B;  2D8H A;  4RUG A; 
#chains in the Genus database with same CATH homology
 1AZE A;  2PZ1 A;  1BU1 A;  1UTI A;  1GBR A;  4CSH A;  3EHQ A;  1CKA A;  1RI9 A;  2C0O A;  2A37 A;  4M4Z A;  4OLK A;  1E7O A;  1ZLM A;  3EG1 A;  2GBQ A;  2ROL A;  3VS4 A;  3GBQ A;  2IOA A;  2A28 A;  1NLO C;  3PVQ A;  3VS0 A;  1KSW A;  3PBI A;  2AZS A;  4JJB A;  2RMO A;  1HSQ A;  4GLM A;  1JXO A;  3QWY A;  2HEQ A;  4Y92 A;  1EFN A;  1OPL A;  4K11 A;  1CKB A;  4D8K A;  1H92 A;  1WIE A;  1UHC A;  2RQV A;  1CSK A;  4FGE A;  1M3C A;  1NM7 A;  2CUB A;  1NYG A;  1LCK A;  2RQT A;  2FRY A;  1ZSG A;  3VS5 A;  3S0Q A;  2ESW A;  3VRY A;  3M0S A;  1A0N B;  3VRZ A;  3VS2 A;  4WCI A;  2GGR A;  2FPF A;  2J05 A;  4JZ3 A;  1FYN A;  2KNB B;  4R0K A;  4LN2 A;  1JEG A;  5IHI A;  2YUP A;  1IO6 A;  2L3P A;  4KRT A;  1OEB A;  2GQI A;  1BK2 A;  1H8K A;  4F4M A;  1WDX A;  1ZBJ A;  1PKT A;  3NMZ C;  2DMO A;  3U23 A;  4EOB A;  2EBP A;  4FQB A;  2K3B A;  4FSS A;  1WFW A;  2YUO A;  1K0X A;  2X3W D;  1X6B A;  2DL8 A;  2LP5 A;  2O88 A;  3PBC A;  2IOB A;  5I22 A;  1M8M A;  2KRM A;  2KRN A;  4RTX A;  1VYV A;  2VWF A;  4F0V A;  1MV0 B;  2VKN A;  1I1J A;  3EG2 A;  3A30 A;  1BB9 A;  4AFQ C;  5L23 A;  3TVT A;  2CT4 A;  2KXD A;  2LQN A;  3UF4 A;  3PVL A;  1K0S A;  1K9A A;  1XOV A;  4ESR A;  2KRS A;  1WXU A;  1VA7 A;  2MOX A;  1V1C A;  1TUD A;  2J6F A;  3VS3 A;  1AZG B;  2ED0 A;  2K6D A;  4Q4G X;  1SPK A;  3REB B;  1K1Z A;  4HVU A;  3NGP A;  2K7A A;  3H0F A;  2RPN A;  1KIK A;  1GRI A;  4DEY A;  4J9C A;  5ECA A;  3UA6 A;  1UGV A;  1TG0 A;  2CT3 A;  1WYX A;  2YDL A;  2LZ6 B;  1U06 A;  2JS0 A;  1SHG A;  2HBW A;  2HSP A;  2JMC A;  4CC4 B;  1I07 A;  2KT1 A;  1AOJ A;  4AFZ C;  1S1N A;  1OOT A;  1AWO A;  4J9B A;  2J6K A;  3H41 A;  1AWX A;  2KYM A;  4CC7 A;  1UFF A;  2DM1 A;  1YN8 A;  2CRE A;  2O2O A;  4LUE A;  2LJ0 A;  1GCQ C;  4Q4T A;  3VS6 A;  3VS1 A;  4OMP A;  2K9G A;  4ZNX A;  4CT3 A;  2DRK A;  2JW4 A;  3QWX X;  2JS2 A;  1GL5 A;  4X1V A;  2VPM A;  2CSQ A;  2EYY A;  1JQQ A;  1T3S A;  2AKK A;  1VYU A;  1UE9 A;  1NYF A;  4JJC A;  2BTT A;  4F17 A;  3LH5 A;  1SHF A;  3A2Z A;  3SEM A;  1X6G A;  2YUQ A;  4J9G A;  2FO0 A;  2M0Y A;  4HXJ A;  1SRM A;  4EQ8 A;  2EGA A;  2ABL A;  2FEI A;  3RBB B;  4ORZ A;  2KBT A;  2CH4 W;  4OMM A;  1FMK A;  2M51 A;  2IO9 A;  1RLP C;  2ECZ A;  4QT7 A;  1U5S A;  1M30 A;  1YCS B;  3KFV A;  3EGU A;  1PHT A;  2XMF A;  5IHK A;  1YWP A;  3I9Q A;  3M0Q A;  4HVV A;  4HZ9 A;  1WLP B;  5FWC A;  1K76 A;  2CDT A;  5IXF A;  2B86 A;  2PTK A;  1U3O A;  1W70 A;  4LJ1 A;  1PNJ A;  2EYW A;  2DE0 X;  4J9F A;  4AG2 C;  2GNC A;  2X3X D;  1NEB A;  1X43 A;  2ENM A;  1AEY A;  1NEG A;  2F2W A;  1JO8 A;  2FPD A;  3A2Y A;  3O98 A;  1WX6 A;  2MCN A;  3I5R A;  4Q4N A;  2L3S A;  1QKX A;  2H8H A;  2LJ1 A;  1E6H A;  1B07 A;  3I5S A;  1Z9Q A;  2YT6 A;  4AFU C;  4J9E A;  2RN8 A;  1ABO A;  4RTZ A;  2KE9 A;  3PE0 A;  4JZ4 A;  2D8J A;  2DJQ A;  2XIV A;  2KRO A;  5IXB A;  2QDL A;  4RTU A;  1T3L A;  1WXT A;  2NUZ A;  4AFS C;  2IO7 A;  1SEM A;  2HDA A;  1Y0M A;  1PRM C;  1AWW A;  2K2M A;  2K79 A;  2GTO A;  2JMA A;  2GTJ A;  3RNJ A;  4GBQ A;  2D0N A;  1UG1 A;  1MUZ A;  1UDL A;  2EW3 A;  1T0H A;  2DBM A;  3M0T A;  3ZL7 C;  3EG0 A;  2J06 A;  2RQU A;  2LRJ A;  1B3Q A;  2L3Q A;  2DA9 A;  1KFZ A;  3FJ5 A;  3REA B;  2VOB A;  4JXB A;  2LNH B;  2OAW A;  2O31 A;  2DIL A;  1GCQ A;  4RTW A;  1ARK A;  2E5K A;  1X69 A;  2KEA A;  2CUD A;  4Z89 A;  4AG1 C;  1ZUU A;  2JTE A;  5GJV B;  1ZUY A;  3M1U A;  2EYZ A;  2P4R A;  3I86 A;  1YNZ A;  3GT2 A;  3NHN A;  3THK A;  1X2K A;  4LNP A;  1E6G A;  1AD5 A;  2LMJ A;  2D1X A;  1SSH A;  3H0H A;  2DL3 A;  3I35 A;  1JU5 C;  2JM8 A;  3R6N A;  1T0J A;  2RF0 A;  3A98 A;  5IHN A;  2OI3 A;  4Z88 A;  2JM9 A;  2OJ2 A;  2IO8 A;  4CGK A;  2JT4 A;  2DVJ A;  4EQA A;  1ZX6 A;  1UJ0 A;  1PWT A;  3TSZ A;  3O5Z A;  1TUC A;  1NG2 A;  2BZ8 A;  4A63 B;  2KT8 A;  5IH2 A;  1AVZ C;  4EIK A;  4OMQ A;  3M0R A;  4FGI A;  1WA7 A;  1WI7 A;  2YSQ A;  1KJW A;  5EC7 A;  2VPS A;  3UAT A;  2RQR A;  2F2X A;  2LJ3 A;  2LCS A;  2CSI A;  1OPK A;  4J9H A;  1G83 A;  1QLY A;  2L0A A;  2DL5 A;  4RTT A;  2DLP A;  4HPE A;  2EPD A;  1M3B A;  2G6F X;  4LE9 A;  2DRM A;  4J9I A;  4HZB A;  2JXB A;  4HVW A;  3SHW A;  3M0P A;  1MV3 A;  2DYB A;  2PNI A;  2RNA A;  1UEC A;  2DBK A;  3TSW A;  4FGD A;  2KGT A;  2F2V A;  1NLP C;  2ED1 A;  4J9D A;  1J3T A;  4RTY A;  1Y57 A;  2IF6 A;  1M27 C;  4RTV A;  4IIM A;  1GBQ A;  2VVK A;  2AK5 A;  2A36 A;  2I0N A;  2KYB A;  3VPI A;  2C0T A;  1X2Q A;  1QCF A;  2K1G A;  5GJW B;  4IIO A;  2FPE A;  2AZV A;  3UA7 A;  1RLQ C;  3JV3 A;  2CH4 A;  2W10 A;  4FDY A;  2V1R A;  1UUE A;  2DL7 A;  1HD3 A;  1HJD A;  1H3H A;  3H0I A;  2EYX A;  4D8D A;  3NPF A;  1UJY A;  2J6O A;  4OMN A;  2FG0 A;  1M3A A;  2EGE A;  2EVR A;  1GCP A;  4HCK A;  1YP5 A;  2HCK A;  3ULR B;  2AKL A;  3IQL A;  2EQI A;  1W6X A;  1WXB A;  4CC2 A;  2A08 A;  1I0C A;  5HCK A;  2LQW A;  1ZUK A;  4F16 A;  2ROT A;  2V1Q A;  3M0U A;  1SRL A;  2J7I A;  3CQT A;  4DEX A;  2LX7 A;  2DF6 A;  4FQA A;  1JXM A;  1X27 A;  2DNU A;  2EKH A;  1GFD A;  3KW0 A;  1QKW A;  4OML A;  1OV3 A;  4F14 A;  3VS7 A;  4JPB W;  4OMO A;  2BZY A;  1RUW A;  1G2B A;  3EHR A;  1UHF A;  2DX1 A;  2O9V A;  2NWM A;  1W1F A;  2BZX A;  2KR3 A;  3C0C A;  3NE0 A;  1PKS A;  1QWE A;  3VPJ A;  1BBZ A;  1Z9Z A;  1N5Z A;  4JJD A;  1AWJ A;  2KXC A;  1K4U S;  2SEM A;  1VYT A;  4Z8A A;  5FW9 A;  2K3A A;  2FRW A;  2MIO A;  2L2P A;  2EGC A;  2RQW A;  1PRL C;  1GFC A;  2DL4 A;  1YWO A;  2O9S A;  2W0Z A;  4LUD A;  2IIM A;  4CC3 A;  2YUN A;  5I11 A;  1QWF A;  4F0W A;  5FWB A;  3EG3 A;  2SRC A;  2C0I A;  2D8H A;  1ABQ A;  4RUG A;  4E6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...