The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
128
|
structure length |
128
|
Chain Sequence |
VSQEEVKKWAESLENLINHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of RGS4 bound to AlF4--activated G(i alpha1): stabilization of the transition state for GTP hydrolysis.
pubmed doi rcsb |
molecule tags |
Complex (signal transduction/regulator)
|
source organism |
Rattus norvegicus
|
molecule keywords |
GUANINE NUCLEOTIDE-BINDING PROTEIN G(I)
|
total genus |
50
|
structure length |
128
|
sequence length |
128
|
chains with identical sequence |
H
|
ec nomenclature | |
pdb deposition date | 1997-03-25 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
E | PF00615 | RGS | Regulator of G protein signaling domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 2 | Regulator of G-protein Signalling 4, domain 2 | ||
Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 1 | Regulator of G-protein Signalling 4; domain 1 |
#chains in the Genus database with same CATH superfamily 3C7L A; 1FQK B; 2D9J A; 2EBZ A; 3C7K B; 2GTP C; 5HE1 A; 3V5W A; 2DLV A; 1DK8 A; 2AF0 A; 2IK8 B; 2BT2 A; 2OWI A; 5HE3 A; 1EZT A; 2JM5 A; 1OMW A; 2BV1 A; 1AGR E; 2IHD A; 2ODE B; 2BCJ A; 5HE0 A; 4TND A; 2CRP A; 3KRX A; 3KRW A; 1FQI A; 2V4Z B; 1EMU A; 5DO9 B; 3NYN A; 4TNB A; 3PSC A; 3PVW A; 3PVU A; 4EKD B; 2JNU A; 1CMZ A; 3CIK A; 2OJ4 A; 4MK0 A; 5HE2 A; 4PNK A; 1FQJ B; 3UZT A; 2IHB B; 1EZY A; 3NYO A; #chains in the Genus database with same CATH topology 3C7L A; 1FQK B; 2D9J A; 2EBZ A; 3C7K B; 2GTP C; 5HE1 A; 3V5W A; 2DLV A; 1DK8 A; 2AF0 A; 2IK8 B; 2BT2 A; 2OWI A; 5HE3 A; 1EZT A; 2JM5 A; 1OMW A; 2BV1 A; 5REQ B; 1AGR E; 2IHD A; 2ODE B; 2BCJ A; 5HE0 A; 4TND A; 2CRP A; 3KRX A; 3KRW A; 1FQI A; 2V4Z B; 1EMU A; 5DO9 B; 3NYN A; 4TNB A; 3I5Q A; 3PSC A; 4HTE A; 3PVW A; 3PVU A; 4EKD B; 2JNU A; 1CMZ A; 3CIK A; 2OJ4 A; 4MK0 A; 5HE2 A; 4PNK A; 1FQJ B; 3UZT A; 2IHB B; 3QYF A; 1EZY A; 3NYO A; #chains in the Genus database with same CATH homology 3C7L A; 1FQK B; 2D9J A; 2EBZ A; 3C7K B; 2GTP C; 5HE1 A; 3V5W A; 2DLV A; 1DK8 A; 2AF0 A; 2IK8 B; 2BT2 A; 2OWI A; 5HE3 A; 1EZT A; 2JM5 A; 1OMW A; 2BV1 A; 5REQ B; 1AGR E; 2IHD A; 2ODE B; 2BCJ A; 5HE0 A; 4TND A; 2CRP A; 3KRX A; 3KRW A; 1FQI A; 2V4Z B; 1EMU A; 5DO9 B; 3NYN A; 4TNB A; 3PSC A; 3PVW A; 3PVU A; 4EKD B; 2JNU A; 1CMZ A; 3CIK A; 2OJ4 A; 4MK0 A; 5HE2 A; 4PNK A; 1FQJ B; 3UZT A; 2IHB B; 3QYF A; 1EZY A; 3NYO A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...