4HTEA

Crystal structure of the c-terminal domain of nicking enzyme from staphylococcus aureus
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
340
Chain Sequence
KLNAFSYMNKSDSTTLKNMAKDLKIYVTPINMYKENERLYDLKQKTSLITDDEDRLNKIEDIEDRQKKLESINEVFEKQAGIFFDKNYPDQSLNYSDDEKIFITRTILNDRDVLPANNELEDIVKEKRIKEAQISLNTVLGNRDISLESIAAASNFFADKLSNILEKNNLSFDDVLENKHEGMEDSLKIDYYTNKLEVFRNAENILEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQQLIDFKTYHGTENTIEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLSEYDFDYSDNNDLKHLYQESNEVGDEISKDNIEEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Nicking enzyme
total genus 117
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.30 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 4hteA03
1.20.58.1730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hteA01
1.20.58.1740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hteA02
4HTEA
chains in the Genus database with same CATH superfamily
4UV8B 1YKEB 2YU2A 2CBIA 2LOPA 2XAGB 4UR9A 4YSXA 2IC9A 3DP7A 4PJJA 3P8CD 4U33A 1LRZA 3NZQA 4HN9A 5F3JA 4TNDA 4AKIA 3IBPA 2JQ9A 2J4GA 2VK9A 2WDRA 4PK4A 1L0VA 4UF0A 3RYCE 4ZZBA 5L3FB 5AQOB 4EXTA 1EMUA 4CI2B 1T72A 4A98A 1XMOT 5L47A 1MMGA 5DQWA 1BR4A 3VHLA 3K3NA 1I94T 3N2KE 2LOSA 5AQMB 4O4IE 2Q9QA 3QC9A 2FJDA 3Q9DA 4GYRA 3N9NA 4KMCA 5HAXA 3R84B 3V5SA 3ZEFB 2DL1A 2V7KA 4PJMA 3HKBE 4KI0F 3TLUA 4CZZB 1NEKA 5L3EB 2LSIA 4WBNE 3AVRA 1G8XA 2YDSA 5CGMA 4QWNB 1WFDA 4UVCB 2V7LA 3KBUA 1WYBA 4WBOA 2LKHA 4X64T 1J5WA 3RIFA 3PUQA 3GWHA 4ZS3A 2Q9QD 3AAAB 4BJMA 5JTGA 1HNXT 1IBLT 1VCSA 2W2UA 5KXJA 2WU5A 4ILAA 2IW5B 4DR1T 2BS2A 3V5UA 1SE7A 2CLYC 2WZIA 3AE1A 3HKEE 4JEUB 2ACZA 3FHNA 2WWUA 3AE2A 5JR9A 4A97A 1UGOA 2BG9B 3HA4A 3EDUA 5AQIB 4AKLA 3J7Yq 4Z8XA 2X9YA 2R6GF 5AQPB 2LRLA 3N9QA 4DO0A 5LG4A 3F31A 1HCIA 2DWGA 1WCRA 5L3DB 3OTOT 4ILCA 2NP9A 2CXLA 2CHOA 3AXJA 2V7MA 3N2OA 4HFCA 3FZMB 1HF8A 3A7MA 3ZT6A 3RRWA 4ZS2A 2X0LB 3LBXB 3BK9A 4TWHA 3JAEA 4UVBB 1OEDA 5KMGP 2VKDA 4I43B 4B3MT 3ZYMA 4OYKA 3FBLA 4X1KE 2W0GA 1HX1B 1AJ3A 4Q25A 3OKQA 1IAPA 3I9WA 3MKDA 2OLTA 4U74A 3P4SA 4CN6A 4WYVA 1HG2A 1ZV4X 5LA6E 1UK5A 2LEHA 3AA6B 4NXNT 2MAWA 4TV9E 3RC8A 2G0UA 2XQ4A 2NTYA 3AA7B 1KEYA 3H3MA 4LFAT 3KV4A 5HCJA 4IREA 4AKRB 3CQCB 5C3JA 3IA3A 3ANWA 5LJNA 2IUBA 4ISSA 2HPLA 3TLVA 2XM2A 4PK5A 2LHRA 3ESLA 3UU5A 4CXXA 5HEJA 2D5UA 4HKAA 2GTPC 5AQQB 4EGWA 1OEDB 2XAJB 2K24A 3ETUA 5HEHA 3ABVA 2X9HA 5HXCA 4DR6T 4J2CA 2WSSV 3LK42 5J0ZA 2RPAA 2VQET 3O1HA 2QA7A 2E5VA 4YT0A 2N2NA 2WDQA 2XUEA 5JDGA 4LF6T 1UCUA 3FXEB 4N78D 4PW8A 3W15B 5C2TA 5HXEA 2B76A 5HE2A 2CWYA 5J2TE 3VKGA 5LMNT 1B7TA 2VQFT 5IYZE 3FZFB 4B3RT 5F8PA 4BAYB 3RX6A 2E2AA 4QH4A 5L3CB 2HHHT 1LVFA 2LM9A 3RGLA 4A56A 4DBQA 4ZI2C 5AFUL 4AXPA 4ADZA 4AQGA 4P0AA 4L9IA 4LF9T 2H88A 1YD8G 2K3WA 4MFRA 4MLKA 1OMWA 2LKGA 1LVKA 4XZCA 2VVSA 2WM9A 4DR4T 3TLTA 2BKPA 4KHZF 2PBIA 5CA0E 4K0KT 4DV1T 5LCYA 2W00A 5JDQA 1KK7A 1KNPA 1W9RA 2MOZA 2I59A 3ONJA 3QK6A 4IE0A 2IDOB 4TWFA 2WWVA 4U31A 2X66A 2UUBT 4X66T 4DV6T 1YW0A 3ZSTA 2E9XB 4LF8T 4CQIA 2XQAA 4G63A 3CX7B 5JDNA 1HR0T 2CEAA 2XQ7A 3UFEA 2Z6EA 3RLFF 3C4WA 3AB3B 3KVAA 1E1HB 2VKJA 4HGAA 4I0UA 5LOVE 3RC3A 4EB6E 2IHDA 3ZLIA 3WAJA 3M3ZB 3P7IA 2CE7A 2ZM6T 1O3XA 2N1GA 4H9OC 5E0OA 2X51A 1E2AA 3CPZA 3RI5A 4ZI2D 1KF6A 2KSRA 2P9BA 4AKHA 3PJAJ 2YOEA 2B1EA 4ISTA 4DV5T 3ZYLA 2E5LT 3OYXA 1W0AA 2X9XA 3FXDB 2IHR1 2XQ9A 2J62A 3NZPA 4IE4A 4JUYA 4JI5T 2KMFA 3RPUA 2RP4A 3RQWA 3C64A 4UVAB 3LBXA 5ABHA 5AQNB 3UZTA 3I9YA 4WW0A 4XBFB 3AXJB 3CVRA 2BV1A 2LLYA 5HE3A 5J1GA 2E9XC 2H89A 3E22E 3AE6A 2X0YA 3K8PC 4U72A 3P4WA 2CCQA 2PG8A 3NYOA 4GKJT 4YJ3E 3AEAA 4HTEA 3ONLC 2Y8DA 2NW9A 3AE8A 3FBZA 3OBVE 4X65T 4ZXLA 4YHJA 4LFCT 3CKDA 3KV5A 3N9LA 5CFBA 2K9AA 4MHCA 3ZMSB 4JI6T 5FXWA 4P1NA 5LBMA 3EI0A 1GQEA 4OYJA 5LB7B 3VR8A 5AQLB 4KHPT 2L3LA 1HG5A 5KX5E 1YQ3A 3VR9A 5ETWA 1OXZA 1CHUA 3J9X1 2XAQB 2KINB 4TZ4C 3RH3A 5HYAA 2CPTA 1IBKT 5CB4E 4F6RC 2A72A 4AIUA 2F4VT 5DABA 1YXRA 2XPKA 5LXTE 2NWBA 3N5LA 4QH5A 2NTXA 2MYSA 3AEBA 3HI2A 4H9NC 5FXZA 4ZZCA 1FMWA 5AQUB 2JRKA 4CN1A 3BQKA 3T8OA 2ZM2A 3EAMA 5L3BB 5FXVA 3KV9A 2JM5A 2RA1A 4WZXA 4DV3T 2FJAA 2CHNA 4AI6A 2C0SA 2MBGA 3JAFA 5CA1E 1N33T 2VVNA 2CLYB 3JADA 2XQ3A 2ACXA 3A8YC 4HE8A 2WS3A 4HFIA 4TNWA 2E9XD 2DLRA 3PE0A 2UXXB 4TUYE 1ZKEA 4ERRA 3AE3A 3OYZA 2IMLA 4DR7T 5AQGB 3KRWA 4ASKA 2H7VC 4YJ2E 1T98A 3G06A 4LF7T 2QGSA 2W62A 2VASA 3NBXX 3GN5A 1N34T 4JLEA 4EAHA 2KNDA 4DNDA 1HTJF 4KP3C 2DWKA 4IDNA 4O4JE 1HS7A 2IIUA 1YKHB 2FJEA 5DQVA 2YU1A 3ZJ2A 4O4LE 4NPPA 3ZMUB 2V26A 4YY3T 2LJLA 3K3OA 2LE8A 4FJOA 3Q5EA 4YTNA 4UF0B 3OVUA 5LHGB 5AQKB 2PJQA 3JCFA 1NAFA 2BZBA 2KWIB 2L8KA 3F2EA 3HKDE 4IL9A 5FMNA 2V6XA 1N36T 4QXBB 5HEUA 4ANJA 5BMVE 4IGUA 4AKGA 4B3TT 2W61A 3UFGA 4P0BA 5AQSB 3RYHE 5IWAT 4IDPA 3UULA 2WU2A 5GONE 3O1JA 3M65A 5FNVE 2UXBT 3X1DA 5DO9B 1D0XA 3CIRA 1D0ZA 3E0ZA 2XAHB 3KV6A 5F5WA 4X5TA 2YINA 1CMZA 2KXPB 4TN7B 3HKCE 4UELA 3U78A 5FXXA 3DTOA 4DV4T 3T1HT 1FJGT 2ODUA 3UU4A 4H63H 2JQHA 5FP3A 3KDSE 4YTMA 2LSGA 1EZYA 5HEOA 2I0MA 1MIYA 1S94A 3ZT7A 4ZI7E 2LM2A 4U7YA 1XNQT 1BR0A 2V4ZB 3AECA 2WB5A 2YEVC 1D1BA 1NENA 2A9UA 4HFVA 5ABFA 3CK6A 1UX4A 4IL4A 2CXDA 5JRCB 1D0YA 2EHOD 4XAXB 3Q5DA 4GOUA 4IE6A 4QH1A 4AQYT 5AQTB 1N32T 3NVOA 1WYCA 2D0TA 3HR0A 4G2AA 1AGRE 1WR6A 1OEDC 2JMKA 2XSAA 4GK0E 1OWAA 3PUAA 3PDYA 2JIWA 4MALA 3C4XA 3ZMZB 5ADXL 4MBQA 4TNVA 4O2AE 4JI3T 5JQGE 1T8BA 3AE5A 4PJLA 4B6XA 5ABEA 4HFHA 4NIQA 5LMUT 4DV2T 2C5KT 2V6YA 2WP9A 4I55E 2ODVA 3DJBA 2LSYA 2XAFB 3WI3A 3AE4A 3LK3B 2V7JA 3LG7A 3ZCJA 5LG3A 3SOLA 1R8IA 1E7PA 1EZTA 5A1LA 2V8SV 3RKGA 3C7LA 2NOXA 2BT2A 3EUHA 2CM0A 1VOMA 2WZHA 1SA0E 3KINB 4X20E 3R6NA 3AAEB 3RIUA 2BG9E 5AQJB 4QX7B 4BJNA 3ZCIA 4HFEA 4KUMB 5FY1A 3PVUA 2H3RA 2DNXA 3RYIE 2IC6A 1W0BA 3TLWA 4UV9B 4LFBT 4EIWA 3AA1B 4YFSA 1UURA 3UU6A 2HPJA 2Y48B 2YN6A 4CXYA 2UXDT 3PVWA 1S35A 2BDEA 2EHOC 3K3QC 5EK3A 5AQFB 2VKOA 3RHWA 3O1IA 3C98B 2DI4A 3CMLA 2UXNB 4Z91A 4CI3B 2XZEA 4QXHB 4IE7A 1ZEEA 5FKYA 5L4HA 2Y6XA 2BCJA 3KVBA 3OJAA 5JDFA 1MIVA 4EZHA 1MNEA 4ILUA 5JREA 2Q9QB 1WR0A 3GN5B 3PURA 4UXNB 3HL6A 4Z90A 4CXWA 1HNZT 4AQFA 4C91A 1KNRA 3AEGA 4ZOLE 3FZHB 4A5XA 3NYNA 4B3ST 2X9WA 4EEBA 5LJMA 4OX9T 3KRXA 2LHNA 3FZLB 3QB5A 2UXCT 2YDRA 1ZP0A 2XHEB 3GA8A 3UUBA 1QSDA 5JH7E 5L2LA 4KX6A 4HWDA 4DMWA 4YHHT 1IJ5A 4GK5E 3QUJA 4FI5A 5BR8T 3CX8B 1FQJB 4PJNA 5AQHB 2J47A 4UEMA 3N9MA 4LMKA 4JI2T 2JNUA 2UUCT 2L9QA 3NKZA 5JDHA 4DR5T 2BBHA 2EHOB 1CUNA 1HX8A 1OEDE 2AE9A 2BG9C 2C5IT 3PTRB 3ZN0B 3VU7H 5ABFB 2CWOA 5JDMA 2QYWA 1JNRA 2OV9A 2KWHA 3FB2A 2WMOA 2JQQA 3N9OA 3UU8A 2XTLA 2ODEB 5HCMA 5JVDE 2AF0A 2NR4A 2LT3A 2PTFA 2Q9QC 4LMLA 5ABGA 2VWAA 2NW8A 2IHBB 1MNDA 4EKDB 2BVLA 4HWHA 4IDZA 3RIAA 1WLXA 3JC6C 5JR9C 3EHZA 4YSYA 2XASB 4IHJE 4O2BE 4O4HE 2W67A 2HH7A 3C4ZA 4LF4T 5EZYE 1D1AA 3ZC1A 2CXFA 5C8YE 4U7IA 3BQLA 4ZEYA 2D9JA 3UT5E 3CQGB 4M1PA 3PJAA 3UUMA 3I5QA 2JJ9A 2VB6A 1IBMT 4JYAT 2M6IA 3AEEA 4GIWA 2EHOA 2EBZA 3KFWX 3NWIA 5AQVB 5HWXA 3TLSA 4DV0T 1SUMB 1DK8A 4PFPA 3VRAA 4JI0T 3AA0B 3B5MA 2QVAA 2D2SA 5FVLA 4OFZA 4DUYT 4EV6A 5LYJE 5FL1A 1BR2A 2FUPA 4JI8T 5LGTB 3C7KB 4HWCA 2H7OA 2V5DA 2UUAT 3P50A 4I50E 2BS4A 2X0HA 4YLHA 4AQFC 4DIDB 4L5GA 4EOZB 3VKHA 3V5WA 3U3IA 3PU3A 4WNKA 1FEWA 2J1DG 2QRXA 2V7IA 2CRBA 1X79A 3ETVA 3P4QA 1FQIA 5LBQB 4PFOA 2IK8B 3ZN1B 3SWHA 2CBJA 4TNBA 2LRKA 4LMJA 5JDLA 4H9PC 5LGUB 3O9XA 3A5XA 3D0TA 4C90A 4E7ZA 3ZMVB 2CA5A 3I0QA 2BKNA 2GK9A 3PSCA 2XM1A 2ZLYA 2C5JA 1FMVA 1T7SA 3KBTA 3PV0F 4IT4A 2PFVA 2K48A 3SFEA 5HXHA 4IIJE 3NRXA 4PK6A 2SPCA 4NXMT 4V1Av 3AE9A 1XWMA 2M67A 3C50A 3P4PA 4IDQA 3L8RA 3T1YT 5FY0A 4JI1T 4ZI3C 4HWFA 4H9QC 3UU3A 3E08A 3I0OA 1UX5A 2VURA 3MXZA 1KNZA 1FQKB 1Y64B 5H6QB 4PNKA 4JBWF 3UQ7A 2CMRA 2WQYA 3RKOA 4PAGA 1JNZA 1H7CA 2XQ5A 2XQ6A 2V1DB 3CQXC 4L0RA 4JI7T 3JC6D 4QXCB 3TKLB 3ONXA 3AEDA 1YQ4A 4ILBA 2OJ4A 3SRZA 3PUGA 4H63V 1MMAA 2BG9A 3Q2MA 2VKHA 5IUXA 4BA9A 1U4QA 2VL0A 3I1AA 2UU9T 2AXDS 3B57A 1M7KA 3ZYKA 5HEGA 4UIGA 3QOFA 3MZKB 2M6BA 2WBLA 4HFDA 5KDMC 3IF8B 1SHZC 2HN2A 2A2FX 3L3PA 2W66A 4PNIA 3RYFE 4DV7T 2IAKA 5LGNB 3UUNA 4DR3T 1W09A 3PUSA 5L3GB 3PU8A 3PUYF 3LJCA 1XMQT 4YSZA 1XNRT 1US7B 2A3DA 4CI1B 1X9BA 1LKXA 3AAIA 1UUSA 3CX6B 4QKNA 3UTKA 5JRCA 1Z8UA 3N9PA 4IE5A 2WDVA 3H3AA 2OA5A 5H6RB 1HNWT 5HE0A 3MA9A 3SS1A 3ZC0A 3NRYA 2DHRA 3O4XE 3MACA 1IZNB 1FIOA 5LHIB 4DBRA 5HXRA 4AISA 1XDPA 5LP6E 2V6YB 3IHRA 2VL8A 4TWDA 2ZM8A 3LSVA 2KLQA 2WY2A 3L39A 4I4TE 5FYMA 3ZKRA 4EEDA 5JR9B 2W63A 3ANWB 3EDVA 4DVDA 2K5BB 4GKKT 3EVYA 2WAUA 1XZYA 1V9DA 2XSBA 1HFAA 2MTQA 4U2ZA 3UQ4A 4X1YE 5EK4A 4COFA 1J5ET 1EZ3A 4K0UA 3RF1A 2OWIA 2X68A 3ZJ1A 4NUVA 2FBWA 3Q5XA 3ZPOA 4EYUA 2D0UA 2FJBA 1NWMX 3LK2B 4F8HA 2LSJA 5J2UE 2KZ7B 1QUUA 1Z0PA 3OPCA 3AVSA 5HE1A 3LDQB 1U5PA 4H9RC 4KBMB 4DMVA 5CJ5A 2KT9A 3PUZF 1ZOYA 3LFMA 3CIKA 4U3CA 1XDOA 3S4UA 4OHFA 2BBJA 2WCAA 4YXDA 3C51A 5L4EA 1VCTA 4DR2T 2LSKA 5EK2A 1DU2A 1Y01A 5FVKA 1D1CA 2V5CA 2XQYA 2XJ7A 5HWYA 3ZMTB 5TAOA 5IHYA 2HN1A 2NW7A 4X1IE 1G73A 3RRCA 3GMIA 2MPKA 4EYYR 4GYSA 4HFBA 2XY8B 3N2GE 4MK0A 1M62A 3Q5WA 4TX5A 2DLVA 1MIWA 2BVMA 2ES0A 3BQIA 3CWZB 3VRBA 4U2YA 3ZT5A 4E7SA 2XQ8A 3IEEA 2JMHA 4IDOA 1I6ZA 3EABA 1WRDA 2W4XA 5LHHB 4HWIB 4DUZT 2BS3A 3PUWF 4P09A 2DCFA 1VRBA 1ZHCA 3P4RA 2YK0A 3QB5K 2D9DA 3FZKB 4JEHB 3SFDA 4ZI3D 2ZM0A 3PUXF 4JI4T 1BR1A 4JV5T 2E9XA 1KFYA 2N9DA 2JQKA 3AEFA 4HEAA 3H37A 5FY7A 3WAKA 2X67A 2CRPA 2YKSA 3B13A 3MJXA 3K1SA 2YDQA 4TV8E 1IJ6A 4ZHQE 2BKOA 3AE7A 4LF5T 5FL0A 4NUUA 5M4YA 2E8IA 3QNUA 3UUXB 3L09A 4CN4A 4YTPA 5HXSA 1MMDA 1MMNA 5LNKA 5DJQC 2I6HA 2ZMAA 3MK7C 5AQRB 3ZSSA 4OK0A 4QX8B 4EZ4A 2JPFA 4X62T 3RQUA 2WMNA 3F57A 4QHOA 1J1JA 1QLBA 4O8SA 3RIUC 3PUVF 4H9SE
chains in the Genus database with same CATH topology
4UV8B 1YKEB 2YU2A 2LOPA 2XAGB 2IC9A 3DP7A 4PJJA 3P8CD 5F3JA 1LRZA 3NZQA 4HN9A 4AKIA 3IBPA 4PK4A 3RYCE 2VK9A 5L3FB 4UF0A 4EXTA 4CI2B 1MMGA 5DQWA 1BR4A 3VHLA 3K3NA 3N2KE 2LOSA 4O4IE 2Q9QA 3QC9A 4GYRA 3Q9DA 3R84B 3N9NA 4KMCA 5HAXA 3V5SA 3ZEFB 2V7KA 4PJMA 3HKBE 4CZZB 2LSIA 4WBNE 3AVRA 1G8XA 4QWNB 4UVCB 2V7LA 3KBUA 1WYBA 4WBOA 3PUQA 3GWHA 4ZS3A 2Q9QD 3AAAB 4BJMA 2IW5B 3V5UA 2CLYC 3HKEE 4JEUB 5JR9A 3FHNA 2WWUA 3HA4A 4AKLA 3EDUA 3J7Yq 4Z8XA 2X9YA 3N9QA 4DO0A 5LG4A 3F31A 1HCIA 2DWGA 5L3DB 2NP9A 2CXLA 3N2OA 2V7MA 5J2UE 1HF8A 3RRWA 4ZS2A 2X0LB 3LBXB 3BK9A 4UVBB 5KMGP 2VKDA 4I43B 3ZYMA 4OYKA 3FBLA 4X1KE 2W0GA 1AJ3A 3OKQA 1IAPA 3I9WA 3MKDA 4U74A 1HG2A 1ZV4X 5LA6E 3AA6B 2LEHA 4TV9E 3RC8A 2G0UA 2NTYA 3AA7B 3KV4A 4AKRB 3CQCB 5LJNA 3ANWA 4ISSA 2HPLA 4PK5A 2LHRA 3ESLA 4CXXA 2D5UA 4HKAA 2XAJB 3ETUA 2K24A 2X9HA 5HXCA 4J2CA 2WSSV 3LK42 3O1HA 2QA7A 2N2NA 2XUEA 5JDGA 1UCUA 3FXEB 4N78D 4PW8A 3W15B 5HXEA 2CWYA 5J2TE 3VKGA 1B7TA 5IYZE 5F8PA 4BAYB 3RX6A 5L3CB 1LVFA 2LM9A 4A56A 5AFUL 4DBQA 4ZI2C 4AXPA 4ADZA 4AQGA 4P0AA 4L9IA 1YD8G 4MLKA 4MFRA 4XZCA 1LVKA 2WM9A 2PBIA 5CA0E 5LCYA 2W00A 5JDQA 1KK7A 2MOZA 2I59A 3QK6A 4IE0A 2X66A 1YW0A 2E9XB 4CQIA 4G63A 3CX7B 5JDNA 2CEAA 3UFEA 2Z6EA 3C4WA 3AB3B 3KVAA 1E1HB 2VKJA 4HGAA 5LOVE 3RC3A 4EB6E 3WAJA 3ZLIA 3P7IA 2CE7A 1O3XA 2N1GA 4H9OC 5E0OA 2X51A 3CPZA 4ZI2D 2P9BA 4AKHA 4ISTA 2B1EA 3ZYLA 3OYXA 2X9XA 3FXDB 3NZPA 4IE4A 4JUYA 2KMFA 3RPUA 2RP4A 3C64A 4UVAB 3LBXA 3I9YA 4WW0A 4XBFB 3CVRA 5L3EB 5J1GA 2E9XC 3E22E 3K8PC 4U72A 2CCQA 2PG8A 4YJ3E 4HTEA 2Y8DA 2NW9A 3FBZA 3OBVE 4YHJA 3CKDA 3KV5A 3N9LA 2K9AA 4MHCA 3ZMSB 5FXWA 5LBMA 4OYJA 2L3LA 1HG5A 5KX5E 5ETWA 1OXZA 3J9X1 2XAQB 2KINB 4TZ4C 3RH3A 5HYAA 5CB4E 4F6RC 2A72A 5DABA 5LXTE 2NWBA 3N5LA 2NTXA 2MYSA 3HI2A 4H9NC 5FXZA 1FMWA 2JRKA 3BQKA 3T8OA 2ZM2A 5L3BB 5FXVA 3KV9A 2RA1A 4AI6A 2C0SA 2MBGA 5CA1E 2CLYB 2ACXA 4HE8A 2E9XD 2DLRA 3PE0A 2UXXB 4TUYE 1ZKEA 4ERRA 3OYZA 4ASKA 2H7VC 4YJ2E 1T98A 2QGSA 2W62A 2VASA 3NBXX 3GN5A 4JLEA 4EAHA 2KNDA 4DNDA 1HTJF 4KP3C 2DWKA 4O4JE 1HS7A 3ZMUB 1YKHB 5DQVA 3ZJ2A 2YU1A 4O4LE 2V26A 2LJLA 3K3OA 2LE8A 4FJOA 4UF0B 5LHGB 2PJQA 1NAFA 2BZBA 2KWIB 2L8KA 3F2EA 3HKDE 5FMNA 4QXBB 4ANJA 5BMVE 4IGUA 4AKGA 2W61A 4P0BA 3RYHE 3UULA 5GONE 3O1JA 3M65A 5FNVE 3E0ZA 1D0XA 1D0ZA 3KV6A 2XAHB 3U78A 2YINA 2KXPB 4TN7B 4UELA 3HKCE 5FXXA 3DTOA 2ODUA 4H63H 5FP3A 3KDSE 2LSGA 4ZI7E 1MIYA 1S94A 1BR0A 2YEVC 1D1BA 5JRCB 4HFVA 1UX4A 2CXDA 1D0YA 2EHOD 4XAXB 4IE6A 4GOUA 1WYCA 2D0TA 3HR0A 4G2AA 1WR6A 4GK0E 2JMKA 1OWAA 3PUAA 3PDYA 4MALA 3C4XA 3ZMZB 5ADXL 4MBQA 4O2AE 5JQGE 4PJLA 4B6XA 2C5KT 4I55E 2ODVA 3DJBA 2LSYA 2XAFB 3WI3A 3LK3B 2V7JA 3LG7A 3ZCJA 3SOLA 5A1LA 2NOXA 3EUHA 2CM0A 1VOMA 1SA0E 3KINB 4X20E 3R6NA 3AAEB 4QX7B 4BJNA 3ZCIA 4KUMB 5FY1A 2H3RA 2DNXA 3RYIE 2IC6A 4UV9B 4EIWA 3AA1B 4YFSA 2HPJA 2Y48B 4CXYA 1S35A 2BDEA 2EHOC 3K3QC 5EK3A 2VKOA 3O1IA 3C98B 2DI4A 3CMLA 2UXNB 4CI3B 4QXHB 4IE7A 1ZEEA 2Y6XA 3KVBA 3OJAA 5JDFA 1MIVA 4EZHA 1MNEA 4ILUA 2Q9QB 3PURA 3GN5B 4UXNB 3HL6A 4CXWA 4AQFA 4C91A 4ZOLE 2X9WA 5LJMA 2LHNA 5L2LA 2XHEB 3GA8A 1QSDA 5JH7E 4DMWA 1IJ5A 4GK5E 3QUJA 4FI5A 3CX8B 4PJNA 4UEMA 3N9MA 2L9QA 5JDHA 2EHOB 1CUNA 1HX8A 2C5IT 3PTRB 3ZN0B 5JDMA 3VU7H 2CWOA 2KWHA 3FB2A 2WMOA 2JQQA 3N9OA 2XTLA 5JVDE 2Q9QC 2LT3A 2VWAA 2NW8A 1MNDA 2BVLA 5JREA 4IDZA 5JR9C 1WLXA 3JC6C 2XASB 4O2BE 4O4HE 2HH7A 3C4ZA 5EZYE 1D1AA 3ZC1A 2CXFA 5C8YE 3BQLA 3UT5E 3CQGB 4M1PA 3UUMA 3I5QA 2JJ9A 2VB6A 4GIWA 2EHOA 3KFWX 5HWXA 4PFPA 3AA0B 2D2SA 4OFZA 5LYJE 1BR2A 5LGTB 2H7OA 4I50E 4YLHA 4AQFC 3VKHA 4L5GA 4EOZB 3U3IA 3PU3A 4WNKA 1FEWA 2J1DG 2V7IA 5LBQB 1X79A 3ETVA 4PFOA 3ZN1B 3SWHA 3O9XA 5JDLA 5LGUB 4H9PC 3A5XA 3D0TA 4C90A 4E7ZA 3ZMVB 2CA5A 3I0QA 2GK9A 2ZLYA 2C5JA 1FMVA 3KBTA 5HXHA 2PFVA 2K48A 4IIJE 3NRXA 4PK6A 2SPCA 4V1Av 2M67A 3C50A 5FY0A 4ZI3C 4H9QC 3E08A 3I0OA 1UX5A 3MXZA 1KNZA 1Y64B 5H6QB 2CMRA 3RKOA 4PAGA 1H7CA 2V1DB 3CQXC 4L0RA 3JC6D 4QXCB 3TKLB 3ONXA 3SRZA 3PUGA 4H63V 1MMAA 3Q2MA 2VKHA 4BA9A 1U4QA 3I1AA 3B57A 3ZYKA 4UIGA 3MZKB 2WBLA 5KDMC 3IF8B 1SHZC 2A2FX 3L3PA 3RYFE 4PNIA 2IAKA 5LGNB 3UUNA 3PUSA 5L3GB 3PU8A 3LJCA 1US7B 2A3DA 4CI1B 1LKXA 3AAIA 3CX6B 4QKNA 3UTKA 5JRCA 3N9PA 4IE5A 3H3AA 2OA5A 5H6RB 3MA9A 3SS1A 3ZC0A 3NRYA 2DHRA 3O4XE 3MACA 1IZNB 1FIOA 5LHIB 4DBRA 5HXRA 5LP6E 3IHRA 2VL8A 2ZM8A 2KLQA 5FYMA 4I4TE 5JR9B 2W63A 3ANWB 3EDVA 4DVDA 2K5BB 3EVYA 2WAUA 1V9DA 1HFAA 2MTQA 4X1YE 5EK4A 1EZ3A 4K0UA 2X68A 3ZJ1A 4NUVA 3Q5XA 3ZPOA 4EYUA 2D0UA 1NWMX 3LK2B 2LSJA 2KZ7B 1QUUA 1Z0PA 3AVSA 4H9RC 4KBMB 1U5PA 4DMVA 2KT9A 3LFMA 3S4UA 4OHFA 3C51A 2LSKA 5EK2A 1D1CA 5HWYA 2XQYA 3ZMTB 5TAOA 5IHYA 4X1IE 2NW7A 1G73A 3RRCA 3GMIA 4EYYR 4GYSA 3N2GE 3Q5WA 4TX5A 2ES0A 1MIWA 2BVMA 3BQIA 3CWZB 4E7SA 3IEEA 2JMHA 1WRDA 5LHHB 4P09A 2DCFA 1VRBA 1ZHCA 4JEHB 2YK0A 4ZI3D 2ZM0A 1BR1A 2E9XA 2N9DA 4HEAA 3H37A 5FY7A 3WAKA 2X67A 3B13A 3MJXA 4TV8E 4ZHQE 1IJ6A 4NUUA 5M4YA 2E8IA 3UUXB 3L09A 5HXSA 1MMDA 1MMNA 5LNKA 5DJQC 2ZMAA 3MK7C 4OK0A 4QX8B 4EZ4A 2JPFA 2WMNA 3F57A 4QHOA 4IHJE 4O8SA 4H9SE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTE A; 
#chains in the Genus database with same CATH topology
 4UV8 B;  1YKE B;  2YU2 A;  2CBI A;  2LOP A;  2XAG B;  4UR9 A;  4YSX A;  2IC9 A;  3DP7 A;  4PJJ A;  3P8C D;  4U33 A;  1LRZ A;  3NZQ A;  4HN9 A;  5F3J A;  4TND A;  4AKI A;  3IBP A;  2JQ9 A;  2J4G A;  2VK9 A;  2WDR A;  4PK4 A;  1L0V A;  4UF0 A;  3RYC E;  4ZZB A;  5L3F B;  5AQO B;  4EXT A;  1EMU A;  4CI2 B;  1T72 A;  4A98 A;  1XMO T;  5L47 A;  1MMG A;  5DQW A;  1BR4 A;  3VHL A;  3K3N A;  1I94 T;  3N2K E;  2LOS A;  5AQM B;  4O4I E;  2Q9Q A;  3QC9 A;  2FJD A;  3Q9D A;  4GYR A;  3N9N A;  4KMC A;  5HAX A;  3R84 B;  3V5S A;  3ZEF B;  2DL1 A;  2V7K A;  4PJM A;  3HKB E;  4KI0 F;  3TLU A;  4CZZ B;  1NEK A;  5L3E B;  2LSI A;  4WBN E;  3AVR A;  1G8X A;  2YDS A;  5CGM A;  4QWN B;  1WFD A;  4UVC B;  2V7L A;  3KBU A;  1WYB A;  4WBO A;  2LKH A;  4X64 T;  1J5W A;  3RIF A;  3PUQ A;  3GWH A;  4ZS3 A;  2Q9Q D;  3AAA B;  4BJM A;  5JTG A;  1HNX T;  1IBL T;  1VCS A;  2W2U A;  5KXJ A;  2WU5 A;  4ILA A;  2IW5 B;  4DR1 T;  2BS2 A;  3V5U A;  1SE7 A;  2CLY C;  2WZI A;  3AE1 A;  3HKE E;  4JEU B;  2ACZ A;  3FHN A;  2WWU A;  3AE2 A;  5JR9 A;  4A97 A;  1UGO A;  2BG9 B;  3HA4 A;  3EDU A;  5AQI B;  4AKL A;  3J7Y q;  4Z8X A;  2X9Y A;  2R6G F;  5AQP B;  2LRL A;  3N9Q A;  4DO0 A;  5LG4 A;  3F31 A;  1HCI A;  2DWG A;  1WCR A;  5L3D B;  3OTO T;  4ILC A;  2NP9 A;  2CXL A;  2CHO A;  3AXJ A;  2V7M A;  3N2O A;  4HFC A;  3FZM B;  1HF8 A;  3A7M A;  3ZT6 A;  3RRW A;  4ZS2 A;  2X0L B;  3LBX B;  3BK9 A;  4TWH A;  3JAE A;  4UVB B;  1OED A;  5KMG P;  2VKD A;  4I43 B;  4B3M T;  3ZYM A;  4OYK A;  3FBL A;  4X1K E;  2W0G A;  1HX1 B;  1AJ3 A;  4Q25 A;  3OKQ A;  1IAP A;  3I9W A;  3MKD A;  2OLT A;  4U74 A;  3P4S A;  4CN6 A;  4WYV A;  1HG2 A;  1ZV4 X;  5LA6 E;  1UK5 A;  2LEH A;  3AA6 B;  4NXN T;  2MAW A;  4TV9 E;  3RC8 A;  2G0U A;  2XQ4 A;  2NTY A;  3AA7 B;  1KEY A;  3H3M A;  4LFA T;  3KV4 A;  5HCJ A;  4IRE A;  4AKR B;  3CQC B;  5C3J A;  3IA3 A;  3ANW A;  5LJN A;  2IUB A;  4ISS A;  2HPL A;  3TLV A;  2XM2 A;  4PK5 A;  2LHR A;  3ESL A;  3UU5 A;  4CXX A;  5HEJ A;  2D5U A;  4HKA A;  2GTP C;  5AQQ B;  4EGW A;  1OED B;  2XAJ B;  2K24 A;  3ETU A;  5HEH A;  3ABV A;  2X9H A;  5HXC A;  4DR6 T;  4J2C A;  2WSS V;  3LK4 2;  5J0Z A;  2RPA A;  2VQE T;  3O1H A;  2QA7 A;  2E5V A;  4YT0 A;  2N2N A;  2WDQ A;  2XUE A;  5JDG A;  4LF6 T;  1UCU A;  3FXE B;  4N78 D;  4PW8 A;  3W15 B;  5C2T A;  5HXE A;  2B76 A;  5HE2 A;  2CWY A;  5J2T E;  3VKG A;  5LMN T;  1B7T A;  2VQF T;  5IYZ E;  3FZF B;  4B3R T;  5F8P A;  4BAY B;  3RX6 A;  2E2A A;  4QH4 A;  5L3C B;  2HHH T;  1LVF A;  2LM9 A;  3RGL A;  4A56 A;  4DBQ A;  4ZI2 C;  5AFU L;  4AXP A;  4ADZ A;  4AQG A;  4P0A A;  4L9I A;  4LF9 T;  2H88 A;  1YD8 G;  2K3W A;  4MFR A;  4MLK A;  1OMW A;  2LKG A;  1LVK A;  4XZC A;  2VVS A;  2WM9 A;  4DR4 T;  3TLT A;  2BKP A;  4KHZ F;  2PBI A;  5CA0 E;  4K0K T;  4DV1 T;  5LCY A;  2W00 A;  5JDQ A;  1KK7 A;  1KNP A;  1W9R A;  2MOZ A;  2I59 A;  3ONJ A;  3QK6 A;  4IE0 A;  2IDO B;  4TWF A;  2WWV A;  4U31 A;  2X66 A;  2UUB T;  4X66 T;  4DV6 T;  1YW0 A;  3ZST A;  2E9X B;  4LF8 T;  4CQI A;  2XQA A;  4G63 A;  3CX7 B;  5JDN A;  1HR0 T;  2CEA A;  2XQ7 A;  3UFE A;  2Z6E A;  3RLF F;  3C4W A;  3AB3 B;  3KVA A;  1E1H B;  2VKJ A;  4HGA A;  4I0U A;  5LOV E;  3RC3 A;  4EB6 E;  2IHD A;  3ZLI A;  3WAJ A;  3M3Z B;  3P7I A;  2CE7 A;  2ZM6 T;  1O3X A;  2N1G A;  4H9O C;  5E0O A;  2X51 A;  1E2A A;  3CPZ A;  3RI5 A;  4ZI2 D;  1KF6 A;  2KSR A;  2P9B A;  4AKH A;  3PJA J;  2YOE A;  2B1E A;  4IST A;  4DV5 T;  3ZYL A;  2E5L T;  3OYX A;  1W0A A;  2X9X A;  3FXD B;  2IHR 1;  2XQ9 A;  2J62 A;  3NZP A;  4IE4 A;  4JUY A;  4JI5 T;  2KMF A;  3RPU A;  2RP4 A;  3RQW A;  3C64 A;  4UVA B;  3LBX A;  5ABH A;  5AQN B;  3UZT A;  3I9Y A;  4WW0 A;  4XBF B;  3AXJ B;  3CVR A;  2BV1 A;  2LLY A;  5HE3 A;  5J1G A;  2E9X C;  2H89 A;  3E22 E;  3AE6 A;  2X0Y A;  3K8P C;  4U72 A;  3P4W A;  2CCQ A;  2PG8 A;  3NYO A;  4GKJ T;  4YJ3 E;  3AEA A;  4HTE A;  3ONL C;  2Y8D A;  2NW9 A;  3AE8 A;  3FBZ A;  3OBV E;  4X65 T;  4ZXL A;  4YHJ A;  4LFC T;  3CKD A;  3KV5 A;  3N9L A;  5CFB A;  2K9A A;  4MHC A;  3ZMS B;  4JI6 T;  5FXW A;  4P1N A;  5LBM A;  3EI0 A;  1GQE A;  4OYJ A;  5LB7 B;  3VR8 A;  5AQL B;  4KHP T;  2L3L A;  1HG5 A;  5KX5 E;  1YQ3 A;  3VR9 A;  5ETW A;  1OXZ A;  1CHU A;  3J9X 1;  2XAQ B;  2KIN B;  4TZ4 C;  3RH3 A;  5HYA A;  2CPT A;  1IBK T;  5CB4 E;  4F6R C;  2A72 A;  4AIU A;  2F4V T;  5DAB A;  1YXR A;  2XPK A;  5LXT E;  2NWB A;  3N5L A;  4QH5 A;  2NTX A;  2MYS A;  3AEB A;  3HI2 A;  4H9N C;  5FXZ A;  4ZZC A;  1FMW A;  5AQU B;  2JRK A;  4CN1 A;  3BQK A;  3T8O A;  2ZM2 A;  3EAM A;  5L3B B;  5FXV A;  3KV9 A;  2JM5 A;  2RA1 A;  4WZX A;  4DV3 T;  2FJA A;  2CHN A;  4AI6 A;  2C0S A;  2MBG A;  3JAF A;  5CA1 E;  1N33 T;  2VVN A;  2CLY B;  3JAD A;  2XQ3 A;  2ACX A;  3A8Y C;  4HE8 A;  2WS3 A;  4HFI A;  4TNW A;  2E9X D;  2DLR A;  3PE0 A;  2UXX B;  4TUY E;  1ZKE A;  4ERR A;  3AE3 A;  3OYZ A;  2IML A;  4DR7 T;  5AQG B;  3KRW A;  4ASK A;  2H7V C;  4YJ2 E;  1T98 A;  3G06 A;  4LF7 T;  2QGS A;  2W62 A;  2VAS A;  3NBX X;  3GN5 A;  1N34 T;  4JLE A;  4EAH A;  2KND A;  4DND A;  1HTJ F;  4KP3 C;  2DWK A;  4IDN A;  4O4J E;  1HS7 A;  2IIU A;  1YKH B;  2FJE A;  5DQV A;  2YU1 A;  3ZJ2 A;  4O4L E;  4NPP A;  3ZMU B;  2V26 A;  4YY3 T;  2LJL A;  3K3O A;  2LE8 A;  4FJO A;  3Q5E A;  4YTN A;  4UF0 B;  3OVU A;  5LHG B;  5AQK B;  2PJQ A;  3JCF A;  1NAF A;  2BZB A;  2KWI B;  2L8K A;  3F2E A;  3HKD E;  4IL9 A;  5FMN A;  2V6X A;  1N36 T;  4QXB B;  5HEU A;  4ANJ A;  5BMV E;  4IGU A;  4AKG A;  4B3T T;  2W61 A;  3UFG A;  4P0B A;  5AQS B;  3RYH E;  5IWA T;  4IDP A;  3UUL A;  2WU2 A;  5GON E;  3O1J A;  3M65 A;  5FNV E;  2UXB T;  3X1D A;  5DO9 B;  1D0X A;  3CIR A;  1D0Z A;  3E0Z A;  2XAH B;  3KV6 A;  5F5W A;  4X5T A;  2YIN A;  1CMZ A;  2KXP B;  4TN7 B;  3HKC E;  4UEL A;  3U78 A;  5FXX A;  3DTO A;  4DV4 T;  3T1H T;  1FJG T;  2ODU A;  3UU4 A;  4H63 H;  2JQH A;  5FP3 A;  3KDS E;  4YTM A;  2LSG A;  1EZY A;  5HEO A;  2I0M A;  1MIY A;  1S94 A;  3ZT7 A;  4ZI7 E;  2LM2 A;  4U7Y A;  1XNQ T;  1BR0 A;  2V4Z B;  3AEC A;  2WB5 A;  2YEV C;  1D1B A;  1NEN A;  2A9U A;  4HFV A;  5ABF A;  3CK6 A;  1UX4 A;  4IL4 A;  2CXD A;  5JRC B;  1D0Y A;  2EHO D;  4XAX B;  3Q5D A;  4GOU A;  4IE6 A;  4QH1 A;  4AQY T;  5AQT B;  1N32 T;  3NVO A;  1WYC A;  2D0T A;  3HR0 A;  4G2A A;  1AGR E;  1WR6 A;  1OED C;  2JMK A;  2XSA A;  4GK0 E;  1OWA A;  3PUA A;  3PDY A;  2JIW A;  4MAL A;  3C4X A;  3ZMZ B;  5ADX L;  4MBQ A;  4TNV A;  4O2A E;  4JI3 T;  5JQG E;  1T8B A;  3AE5 A;  4PJL A;  4B6X A;  5ABE A;  4HFH A;  4NIQ A;  5LMU T;  4DV2 T;  2C5K T;  2V6Y A;  2WP9 A;  4I55 E;  2ODV A;  3DJB A;  2LSY A;  2XAF B;  3WI3 A;  3AE4 A;  3LK3 B;  2V7J A;  3LG7 A;  3ZCJ A;  5LG3 A;  3SOL A;  1R8I A;  1E7P A;  1EZT A;  5A1L A;  2V8S V;  3RKG A;  3C7L A;  2NOX A;  2BT2 A;  3EUH A;  2CM0 A;  1VOM A;  2WZH A;  1SA0 E;  3KIN B;  4X20 E;  3R6N A;  3AAE B;  3RIU A;  2BG9 E;  5AQJ B;  4QX7 B;  4BJN A;  3ZCI A;  4HFE A;  4KUM B;  5FY1 A;  3PVU A;  2H3R A;  2DNX A;  3RYI E;  2IC6 A;  1W0B A;  3TLW A;  4UV9 B;  4LFB T;  4EIW A;  3AA1 B;  4YFS A;  1UUR A;  3UU6 A;  2HPJ A;  2Y48 B;  2YN6 A;  4CXY A;  2UXD T;  3PVW A;  1S35 A;  2BDE A;  2EHO C;  3K3Q C;  5EK3 A;  5AQF B;  2VKO A;  3RHW A;  3O1I A;  3C98 B;  2DI4 A;  3CML A;  2UXN B;  4Z91 A;  4CI3 B;  2XZE A;  4QXH B;  4IE7 A;  1ZEE A;  5FKY A;  5L4H A;  2Y6X A;  2BCJ A;  3KVB A;  3OJA A;  5JDF A;  1MIV A;  4EZH A;  1MNE A;  4ILU A;  5JRE A;  2Q9Q B;  1WR0 A;  3GN5 B;  3PUR A;  4UXN B;  3HL6 A;  4Z90 A;  4CXW A;  1HNZ T;  4AQF A;  4C91 A;  1KNR A;  3AEG A;  4ZOL E;  3FZH B;  4A5X A;  3NYN A;  4B3S T;  2X9W A;  4EEB A;  5LJM A;  4OX9 T;  3KRX A;  2LHN A;  3FZL B;  3QB5 A;  2UXC T;  2YDR A;  1ZP0 A;  2XHE B;  3GA8 A;  3UUB A;  1QSD A;  5JH7 E;  5L2L A;  4KX6 A;  4HWD A;  4DMW A;  4YHH T;  1IJ5 A;  4GK5 E;  3QUJ A;  4FI5 A;  5BR8 T;  3CX8 B;  1FQJ B;  4PJN A;  5AQH B;  2J47 A;  4UEM A;  3N9M A;  4LMK A;  4JI2 T;  2JNU A;  2UUC T;  2L9Q A;  3NKZ A;  5JDH A;  4DR5 T;  2BBH A;  2EHO B;  1CUN A;  1HX8 A;  1OED E;  2AE9 A;  2BG9 C;  2C5I T;  3PTR B;  3ZN0 B;  3VU7 H;  5ABF B;  2CWO A;  5JDM A;  2QYW A;  1JNR A;  2OV9 A;  2KWH A;  3FB2 A;  2WMO A;  2JQQ A;  3N9O A;  3UU8 A;  2XTL A;  2ODE B;  5HCM A;  5JVD E;  2AF0 A;  2NR4 A;  2LT3 A;  2PTF A;  2Q9Q C;  4LML A;  5ABG A;  2VWA A;  2NW8 A;  2IHB B;  1MND A;  4EKD B;  2BVL A;  4HWH A;  4IDZ A;  3RIA A;  1WLX A;  3JC6 C;  5JR9 C;  3EHZ A;  4YSY A;  2XAS B;  4IHJ E;  4O2B E;  4O4H E;  2W67 A;  2HH7 A;  3C4Z A;  4LF4 T;  5EZY E;  1D1A A;  3ZC1 A;  2CXF A;  5C8Y E;  4U7I A;  3BQL A;  4ZEY A;  2D9J A;  3UT5 E;  3CQG B;  4M1P A;  3PJA A;  3UUM A;  3I5Q A;  2JJ9 A;  2VB6 A;  1IBM T;  4JYA T;  2M6I A;  3AEE A;  4GIW A;  2EHO A;  2EBZ A;  3KFW X;  3NWI A;  5AQV B;  5HWX A;  3TLS A;  4DV0 T;  1SUM B;  1DK8 A;  4PFP A;  3VRA A;  4JI0 T;  3AA0 B;  3B5M A;  2QVA A;  2D2S A;  5FVL A;  4OFZ A;  4DUY T;  4EV6 A;  5LYJ E;  5FL1 A;  1BR2 A;  2FUP A;  4JI8 T;  5LGT B;  3C7K B;  4HWC A;  2H7O A;  2V5D A;  2UUA T;  3P50 A;  4I50 E;  2BS4 A;  2X0H A;  4YLH A;  4AQF C;  4DID B;  4L5G A;  4EOZ B;  3VKH A;  3V5W A;  3U3I A;  3PU3 A;  4WNK A;  1FEW A;  2J1D G;  2QRX A;  2V7I A;  2CRB A;  1X79 A;  3ETV A;  3P4Q A;  1FQI A;  5LBQ B;  4PFO A;  2IK8 B;  3ZN1 B;  3SWH A;  2CBJ A;  4TNB A;  2LRK A;  4LMJ A;  5JDL A;  4H9P C;  5LGU B;  3O9X A;  3A5X A;  3D0T A;  4C90 A;  4E7Z A;  3ZMV B;  2CA5 A;  3I0Q A;  2BKN A;  2GK9 A;  3PSC A;  2XM1 A;  2ZLY A;  2C5J A;  1FMV A;  1T7S A;  3KBT A;  3PV0 F;  4IT4 A;  2PFV A;  2K48 A;  3SFE A;  5HXH A;  4IIJ E;  3NRX A;  4PK6 A;  2SPC A;  4NXM T;  4V1A v;  3AE9 A;  1XWM A;  2M67 A;  3C50 A;  3P4P A;  4IDQ A;  3L8R A;  3T1Y T;  5FY0 A;  4JI1 T;  4ZI3 C;  4HWF A;  4H9Q C;  3UU3 A;  3E08 A;  3I0O A;  1UX5 A;  2VUR A;  3MXZ A;  1KNZ A;  1FQK B;  1Y64 B;  5H6Q B;  4PNK A;  4JBW F;  3UQ7 A;  2CMR A;  2WQY A;  3RKO A;  4PAG A;  1JNZ A;  1H7C A;  2XQ5 A;  2XQ6 A;  2V1D B;  3CQX C;  4L0R A;  4JI7 T;  3JC6 D;  4QXC B;  3TKL B;  3ONX A;  3AED A;  1YQ4 A;  4ILB A;  2OJ4 A;  3SRZ A;  3PUG A;  4H63 V;  1MMA A;  2BG9 A;  3Q2M A;  2VKH A;  5IUX A;  4BA9 A;  1U4Q A;  2VL0 A;  3I1A A;  2UU9 T;  2AXD S;  3B57 A;  1M7K A;  3ZYK A;  5HEG A;  4UIG A;  3QOF A;  3MZK B;  2M6B A;  2WBL A;  4HFD A;  5KDM C;  3IF8 B;  1SHZ C;  2HN2 A;  2A2F X;  3L3P A;  2W66 A;  4PNI A;  3RYF E;  4DV7 T;  2IAK A;  5LGN B;  3UUN A;  4DR3 T;  1W09 A;  3PUS A;  5L3G B;  3PU8 A;  3PUY F;  3LJC A;  1XMQ T;  4YSZ A;  1XNR T;  1US7 B;  2A3D A;  4CI1 B;  1X9B A;  1LKX A;  3AAI A;  1UUS A;  3CX6 B;  4QKN A;  3UTK A;  5JRC A;  1Z8U A;  3N9P A;  4IE5 A;  2WDV A;  3H3A A;  2OA5 A;  5H6R B;  1HNW T;  5HE0 A;  3MA9 A;  3SS1 A;  3ZC0 A;  3NRY A;  2DHR A;  3O4X E;  3MAC A;  1IZN B;  1FIO A;  5LHI B;  4DBR A;  5HXR A;  4AIS A;  1XDP A;  5LP6 E;  2V6Y B;  3IHR A;  2VL8 A;  4TWD A;  2ZM8 A;  3LSV A;  2KLQ A;  2WY2 A;  3L39 A;  4I4T E;  5FYM A;  3ZKR A;  4EED A;  5JR9 B;  2W63 A;  3ANW B;  3EDV A;  4DVD A;  2K5B B;  4GKK T;  3EVY A;  2WAU A;  1XZY A;  1V9D A;  2XSB A;  1HFA A;  2MTQ A;  4U2Z A;  3UQ4 A;  4X1Y E;  5EK4 A;  4COF A;  1J5E T;  1EZ3 A;  4K0U A;  3RF1 A;  2OWI A;  2X68 A;  3ZJ1 A;  4NUV A;  2FBW A;  3Q5X A;  3ZPO A;  4EYU A;  2D0U A;  2FJB A;  1NWM X;  3LK2 B;  4F8H A;  2LSJ A;  5J2U E;  2KZ7 B;  1QUU A;  1Z0P A;  3OPC A;  3AVS A;  5HE1 A;  3LDQ B;  1U5P A;  4H9R C;  4KBM B;  4DMV A;  5CJ5 A;  2KT9 A;  3PUZ F;  1ZOY A;  3LFM A;  3CIK A;  4U3C A;  1XDO A;  3S4U A;  4OHF A;  2BBJ A;  2WCA A;  4YXD A;  3C51 A;  5L4E A;  1VCT A;  4DR2 T;  2LSK A;  5EK2 A;  1DU2 A;  1Y01 A;  5FVK A;  1D1C A;  2V5C A;  2XQY A;  2XJ7 A;  5HWY A;  3ZMT B;  5TAO A;  5IHY A;  2HN1 A;  2NW7 A;  4X1I E;  1G73 A;  3RRC A;  3GMI A;  2MPK A;  4EYY R;  4GYS A;  4HFB A;  2XY8 B;  3N2G E;  4MK0 A;  1M62 A;  3Q5W A;  4TX5 A;  2DLV A;  1MIW A;  2BVM A;  2ES0 A;  3BQI A;  3CWZ B;  3VRB A;  4U2Y A;  3ZT5 A;  4E7S A;  2XQ8 A;  3IEE A;  2JMH A;  4IDO A;  1I6Z A;  3EAB A;  1WRD A;  2W4X A;  5LHH B;  4HWI B;  4DUZ T;  2BS3 A;  3PUW F;  4P09 A;  2DCF A;  1VRB A;  1ZHC A;  3P4R A;  2YK0 A;  3QB5 K;  2D9D A;  3FZK B;  4JEH B;  3SFD A;  4ZI3 D;  2ZM0 A;  3PUX F;  4JI4 T;  1BR1 A;  4JV5 T;  2E9X A;  1KFY A;  2N9D A;  2JQK A;  3AEF A;  4HEA A;  3H37 A;  5FY7 A;  3WAK A;  2X67 A;  2CRP A;  2YKS A;  3B13 A;  3MJX A;  3K1S A;  2YDQ A;  4TV8 E;  1IJ6 A;  4ZHQ E;  2BKO A;  3AE7 A;  4LF5 T;  5FL0 A;  4NUU A;  5M4Y A;  2E8I A;  3QNU A;  3UUX B;  3L09 A;  4CN4 A;  4YTP A;  5HXS A;  1MMD A;  1MMN A;  5LNK A;  5DJQ C;  2I6H A;  2ZMA A;  3MK7 C;  5AQR B;  3ZSS A;  4OK0 A;  4QX8 B;  4EZ4 A;  2JPF A;  4X62 T;  3RQU A;  2WMN A;  3F57 A;  4QHO A;  1J1J A;  1QLB A;  4O8S A;  3RIU C;  3PUV F;  4H9S E; 
#chains in the Genus database with same CATH homology
 4UV8 B;  1YKE B;  2YU2 A;  2LOP A;  2XAG B;  2IC9 A;  3DP7 A;  4PJJ A;  3P8C D;  5F3J A;  1LRZ A;  3NZQ A;  4HN9 A;  4AKI A;  3IBP A;  4PK4 A;  3RYC E;  2VK9 A;  5L3F B;  4UF0 A;  4EXT A;  4CI2 B;  1MMG A;  5DQW A;  1BR4 A;  3VHL A;  3K3N A;  3N2K E;  2LOS A;  4O4I E;  2Q9Q A;  3QC9 A;  4GYR A;  3Q9D A;  3R84 B;  3N9N A;  4KMC A;  5HAX A;  3V5S A;  3ZEF B;  2V7K A;  4PJM A;  3HKB E;  4CZZ B;  2LSI A;  4WBN E;  3AVR A;  1G8X A;  4QWN B;  4UVC B;  2V7L A;  3KBU A;  1WYB A;  4WBO A;  3PUQ A;  3GWH A;  4ZS3 A;  2Q9Q D;  3AAA B;  4BJM A;  2IW5 B;  3V5U A;  2CLY C;  3HKE E;  4JEU B;  5JR9 A;  3FHN A;  2WWU A;  3HA4 A;  4AKL A;  3EDU A;  3J7Y q;  4Z8X A;  2X9Y A;  3N9Q A;  4DO0 A;  5LG4 A;  3F31 A;  1HCI A;  2DWG A;  5L3D B;  2NP9 A;  2CXL A;  3N2O A;  2V7M A;  5J2U E;  1HF8 A;  3RRW A;  4ZS2 A;  2X0L B;  3LBX B;  3BK9 A;  4UVB B;  5KMG P;  2VKD A;  4I43 B;  3ZYM A;  4OYK A;  3FBL A;  4X1K E;  2W0G A;  1AJ3 A;  3OKQ A;  1IAP A;  3I9W A;  3MKD A;  4U74 A;  1HG2 A;  1ZV4 X;  5LA6 E;  3AA6 B;  2LEH A;  4TV9 E;  3RC8 A;  2G0U A;  2NTY A;  3AA7 B;  3KV4 A;  4AKR B;  3CQC B;  5LJN A;  3ANW A;  4ISS A;  2HPL A;  4PK5 A;  2LHR A;  3ESL A;  4CXX A;  2D5U A;  4HKA A;  2XAJ B;  3ETU A;  2K24 A;  2X9H A;  5HXC A;  4J2C A;  2WSS V;  3LK4 2;  3O1H A;  2QA7 A;  2N2N A;  2XUE A;  5JDG A;  1UCU A;  3FXE B;  4N78 D;  4PW8 A;  3W15 B;  5HXE A;  2CWY A;  5J2T E;  3VKG A;  1B7T A;  5IYZ E;  5F8P A;  4BAY B;  3RX6 A;  5L3C B;  1LVF A;  2LM9 A;  4A56 A;  5AFU L;  4DBQ A;  4ZI2 C;  4AXP A;  4ADZ A;  4AQG A;  4P0A A;  4L9I A;  1YD8 G;  4MLK A;  4MFR A;  4XZC A;  1LVK A;  2WM9 A;  2PBI A;  5CA0 E;  5LCY A;  2W00 A;  5JDQ A;  1KK7 A;  2MOZ A;  2I59 A;  3QK6 A;  4IE0 A;  2X66 A;  1YW0 A;  2E9X B;  4CQI A;  4G63 A;  3CX7 B;  5JDN A;  2CEA A;  3UFE A;  2Z6E A;  3C4W A;  3AB3 B;  3KVA A;  1E1H B;  2VKJ A;  4HGA A;  5LOV E;  3RC3 A;  4EB6 E;  3WAJ A;  3ZLI A;  3P7I A;  2CE7 A;  1O3X A;  2N1G A;  4H9O C;  5E0O A;  2X51 A;  3CPZ A;  4ZI2 D;  2P9B A;  4AKH A;  4IST A;  2B1E A;  3ZYL A;  3OYX A;  2X9X A;  3FXD B;  3NZP A;  4IE4 A;  4JUY A;  2KMF A;  3RPU A;  2RP4 A;  3C64 A;  4UVA B;  3LBX A;  3I9Y A;  4WW0 A;  4XBF B;  3CVR A;  5L3E B;  5J1G A;  2E9X C;  3E22 E;  3K8P C;  4U72 A;  2CCQ A;  2PG8 A;  4YJ3 E;  4HTE A;  2Y8D A;  2NW9 A;  3FBZ A;  3OBV E;  4YHJ A;  3CKD A;  3KV5 A;  3N9L A;  2K9A A;  4MHC A;  3ZMS B;  5FXW A;  5LBM A;  4OYJ A;  2L3L A;  1HG5 A;  5KX5 E;  5ETW A;  1OXZ A;  3J9X 1;  2XAQ B;  2KIN B;  4TZ4 C;  3RH3 A;  5HYA A;  5CB4 E;  4F6R C;  2A72 A;  5DAB A;  5LXT E;  2NWB A;  3N5L A;  2NTX A;  2MYS A;  3HI2 A;  4H9N C;  5FXZ A;  1FMW A;  2JRK A;  3BQK A;  3T8O A;  2ZM2 A;  5L3B B;  5FXV A;  3KV9 A;  2RA1 A;  4AI6 A;  2C0S A;  2MBG A;  5CA1 E;  2CLY B;  2ACX A;  4HE8 A;  2E9X D;  2DLR A;  3PE0 A;  2UXX B;  4TUY E;  1ZKE A;  4ERR A;  3OYZ A;  4ASK A;  2H7V C;  4YJ2 E;  1T98 A;  2QGS A;  2W62 A;  2VAS A;  3NBX X;  3GN5 A;  4JLE A;  4EAH A;  2KND A;  4DND A;  1HTJ F;  4KP3 C;  2DWK A;  4O4J E;  1HS7 A;  3ZMU B;  1YKH B;  5DQV A;  3ZJ2 A;  2YU1 A;  4O4L E;  2V26 A;  2LJL A;  3K3O A;  2LE8 A;  4FJO A;  4UF0 B;  5LHG B;  2PJQ A;  1NAF A;  2BZB A;  2KWI B;  2L8K A;  3F2E A;  3HKD E;  5FMN A;  4QXB B;  4ANJ A;  5BMV E;  4IGU A;  4AKG A;  2W61 A;  4P0B A;  3RYH E;  3UUL A;  5GON E;  3O1J A;  3M65 A;  5FNV E;  3E0Z A;  1D0X A;  1D0Z A;  3KV6 A;  2XAH B;  3U78 A;  2YIN A;  2KXP B;  4TN7 B;  4UEL A;  3HKC E;  5FXX A;  3DTO A;  2ODU A;  4H63 H;  5FP3 A;  3KDS E;  2LSG A;  4ZI7 E;  1MIY A;  1S94 A;  1BR0 A;  2YEV C;  1D1B A;  5JRC B;  4HFV A;  1UX4 A;  2CXD A;  1D0Y A;  2EHO D;  4XAX B;  4IE6 A;  4GOU A;  1WYC A;  2D0T A;  3HR0 A;  4G2A A;  1WR6 A;  4GK0 E;  2JMK A;  1OWA A;  3PUA A;  3PDY A;  4MAL A;  3C4X A;  3ZMZ B;  5ADX L;  4MBQ A;  4O2A E;  5JQG E;  4PJL A;  4B6X A;  2C5K T;  4I55 E;  2ODV A;  3DJB A;  2LSY A;  2XAF B;  3WI3 A;  3LK3 B;  2V7J A;  3LG7 A;  3ZCJ A;  3SOL A;  5A1L A;  2NOX A;  3EUH A;  2CM0 A;  1VOM A;  1SA0 E;  3KIN B;  4X20 E;  3R6N A;  3AAE B;  4QX7 B;  4BJN A;  3ZCI A;  4KUM B;  5FY1 A;  2H3R A;  2DNX A;  3RYI E;  2IC6 A;  4UV9 B;  4EIW A;  3AA1 B;  4YFS A;  2HPJ A;  2Y48 B;  4CXY A;  1S35 A;  2BDE A;  2EHO C;  3K3Q C;  5EK3 A;  2VKO A;  3O1I A;  3C98 B;  2DI4 A;  3CML A;  2UXN B;  4CI3 B;  4QXH B;  4IE7 A;  1ZEE A;  2Y6X A;  3KVB A;  3OJA A;  5JDF A;  1MIV A;  4EZH A;  1MNE A;  4ILU A;  2Q9Q B;  3PUR A;  3GN5 B;  4UXN B;  3HL6 A;  4CXW A;  4AQF A;  4C91 A;  4ZOL E;  2X9W A;  5LJM A;  2LHN A;  5L2L A;  2XHE B;  3GA8 A;  1QSD A;  5JH7 E;  4DMW A;  1IJ5 A;  4GK5 E;  3QUJ A;  4FI5 A;  3CX8 B;  4PJN A;  4UEM A;  3N9M A;  2L9Q A;  5JDH A;  2EHO B;  1CUN A;  1HX8 A;  2C5I T;  3PTR B;  3ZN0 B;  5JDM A;  3VU7 H;  2CWO A;  2KWH A;  3FB2 A;  2WMO A;  2JQQ A;  3N9O A;  2XTL A;  5JVD E;  2Q9Q C;  2LT3 A;  2VWA A;  2NW8 A;  1MND A;  2BVL A;  5JRE A;  4IDZ A;  5JR9 C;  1WLX A;  3JC6 C;  2XAS B;  4O2B E;  4O4H E;  2HH7 A;  3C4Z A;  5EZY E;  1D1A A;  3ZC1 A;  2CXF A;  5C8Y E;  3BQL A;  3UT5 E;  3CQG B;  4M1P A;  3UUM A;  3I5Q A;  2JJ9 A;  2VB6 A;  4GIW A;  2EHO A;  3KFW X;  5HWX A;  4PFP A;  3AA0 B;  2D2S A;  4OFZ A;  5LYJ E;  1BR2 A;  5LGT B;  2H7O A;  4I50 E;  4YLH A;  4AQF C;  3VKH A;  4L5G A;  4EOZ B;  3U3I A;  3PU3 A;  4WNK A;  1FEW A;  2J1D G;  2V7I A;  5LBQ B;  1X79 A;  3ETV A;  4PFO A;  3ZN1 B;  3SWH A;  3O9X A;  5JDL A;  5LGU B;  4H9P C;  3A5X A;  3D0T A;  4C90 A;  4E7Z A;  3ZMV B;  2CA5 A;  3I0Q A;  2GK9 A;  2ZLY A;  2C5J A;  1FMV A;  3KBT A;  5HXH A;  2PFV A;  2K48 A;  4IIJ E;  3NRX A;  4PK6 A;  2SPC A;  4V1A v;  2M67 A;  3C50 A;  5FY0 A;  4ZI3 C;  4H9Q C;  3E08 A;  3I0O A;  1UX5 A;  3MXZ A;  1KNZ A;  1Y64 B;  5H6Q B;  2CMR A;  3RKO A;  4PAG A;  1H7C A;  2V1D B;  3CQX C;  4L0R A;  3JC6 D;  4QXC B;  3TKL B;  3ONX A;  3SRZ A;  3PUG A;  4H63 V;  1MMA A;  3Q2M A;  2VKH A;  4BA9 A;  1U4Q A;  3I1A A;  3B57 A;  3ZYK A;  4UIG A;  3MZK B;  2WBL A;  5KDM C;  3IF8 B;  1SHZ C;  2A2F X;  3L3P A;  3RYF E;  4PNI A;  2IAK A;  5LGN B;  3UUN A;  3PUS A;  5L3G B;  3PU8 A;  3LJC A;  1US7 B;  2A3D A;  4CI1 B;  1LKX A;  3AAI A;  3CX6 B;  4QKN A;  3UTK A;  5JRC A;  3N9P A;  4IE5 A;  3H3A A;  2OA5 A;  5H6R B;  3MA9 A;  3SS1 A;  3ZC0 A;  3NRY A;  2DHR A;  3O4X E;  3MAC A;  1IZN B;  1FIO A;  5LHI B;  4DBR A;  5HXR A;  5LP6 E;  3IHR A;  2VL8 A;  2ZM8 A;  2KLQ A;  5FYM A;  4I4T E;  5JR9 B;  2W63 A;  3ANW B;  3EDV A;  4DVD A;  2K5B B;  3EVY A;  2WAU A;  1V9D A;  1HFA A;  2MTQ A;  4X1Y E;  5EK4 A;  1EZ3 A;  4K0U A;  2X68 A;  3ZJ1 A;  4NUV A;  3Q5X A;  3ZPO A;  4EYU A;  2D0U A;  1NWM X;  3LK2 B;  2LSJ A;  2KZ7 B;  1QUU A;  1Z0P A;  3AVS A;  4H9R C;  4KBM B;  1U5P A;  4DMV A;  2KT9 A;  3LFM A;  3S4U A;  4OHF A;  3C51 A;  2LSK A;  5EK2 A;  1D1C A;  5HWY A;  2XQY A;  3ZMT B;  5TAO A;  5IHY A;  4X1I E;  2NW7 A;  1G73 A;  3RRC A;  3GMI A;  4EYY R;  4GYS A;  3N2G E;  3Q5W A;  4TX5 A;  2ES0 A;  1MIW A;  2BVM A;  3BQI A;  3CWZ B;  4E7S A;  3IEE A;  2JMH A;  1WRD A;  5LHH B;  4P09 A;  2DCF A;  1VRB A;  1ZHC A;  4JEH B;  2YK0 A;  4ZI3 D;  2ZM0 A;  1BR1 A;  2E9X A;  2N9D A;  4HEA A;  3H37 A;  5FY7 A;  3WAK A;  2X67 A;  3B13 A;  3MJX A;  4TV8 E;  4ZHQ E;  1IJ6 A;  4NUU A;  5M4Y A;  2E8I A;  3UUX B;  3L09 A;  5HXS A;  1MMD A;  1MMN A;  5LNK A;  5DJQ C;  2ZMA A;  3MK7 C;  4OK0 A;  4QX8 B;  4EZ4 A;  2JPF A;  2WMN A;  3F57 A;  4QHO A;  4IHJ E;  4O8S A;  4H9S E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...