4HTEA

Crystal structure of the c-terminal domain of nicking enzyme from staphylococcus aureus
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
340
structure length
340
Chain Sequence
KLNAFSYMNKSDSTTLKNMAKDLKIYVTPINMYKENERLYDLKQKTSLITDDEDRLNKIEDIEDRQKKLESINEVFEKQAGIFFDKNYPDQSLNYSDDEKIFITRTILNDRDVLPANNELEDIVKEKRIKEAQISLNTVLGNRDISLESIAAASNFFADKLSNILEKNNLSFDDVLENKHEGMEDSLKIDYYTNKLEVFRNAENILEDYYDVQIKELFTDDEDYKAFNEVTDIKEKQQLIDFKTYHGTENTIEMLETGNFIPKYSDEDRKYITEQVKLLQEKEFKPNKNQHDKFVFGAIQKKLLSEYDFDYSDNNDLKHLYQESNEVGDEISKDNIEEFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Nicking enzyme
publication title Molecular basis of antibiotic multiresistance transfer in Staphylococcus aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 117
structure length 340
sequence length 340
ec nomenclature
pdb deposition date 2012-11-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.30 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 4hteA03
1.20.58.1730 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hteA01
1.20.58.1740 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4hteA02
4HTEA
chains in the Genus database with same CATH superfamily
3NZQA 2M6BA 3OYXA 2J62A 3LSVA 2N9DA 3P4PA 1FIOA 1J1JA 2E8IA 3NRYA 2V6XA 2W63A 4GYRA 1XWMA 1UURA 2WS3A 2OWIA 2HN1A 2P9BA 3RI5A 4WW0A 2Y6XA 5AQNB 3H3AA 1H7CA 4H63V 4YJ3E 2XASB 3D0TA 5LHIB 3Q5DA 4WBOA 1WYBA 1HX1B 1KF6A 4IDPA 2IDOB 4WNKA 2CXDA 3ZEFB 3MXZA 4B3MT 3P7IA 3FXDB 4UEMA 4UVAB 3CQXC 3UU5A 4BA9A 4I0UA 1MIVA 3UUMA 3LK2B 2QGSA 2WBLA 2UXBT 3RPUA 1FMVA 4OFZA 1W9RA 1AJ3A 3DJBA 3MJXA 4ADZA 1EZTA 4UV9B 3LK42 3ZN0B 4MK0A 3P4WA 4MFRA 3BQIA 1E2AA 2IK8B 5LG4A 2JJ9A 4XBFB 5JRCB 4TX5A 3QC9A 5HCJA 4ILAA 2LOPA 3ZPOA 4PAGA 3CIRA 2WDQA 3FHNA 4ZZCA 1QSDA 4HTEA 4H9RC 5JQGE 2BBHA 4HWIB 2J1DG 5JDLA 3RX6A 2EHOD 2C5JA 5AQSB 1WFDA 2XQ4A 1D0YA 4CN1A 3EABA 3AE3A 4X20E 5L3GB 3RYFE 4CN6A 2W67A 5HE3A 3M65A 4U31A 4ISTA 3CX8B 3IA3A 2IMLA 4YSYA 3N2KE 5LJNA 3JCFA 4G63A 2DWGA 3HKEE 2XQAA 5ETWA 1XMOT 4QXBB 2WWUA 2X0LB 3N9QA 2ACZA 4ZS3A 2H3RA 1LRZA 2KT9A 4PFOA 2GTPC 3HL6A 2J4GA 4UR9A 1ZP0A 1CMZA 3A8YC 4YJ2E 4ZHQE 3EAMA 3OBVE 5GONE 4JI4T 4EZ4A 2WMOA 3PDYA 2JMHA 2D9JA 2IC6A 4JYAT 2Q9QB 2W4XA 3PUZF 4IE4A 3PUAA 2H89A 4EV6A 2VVSA 3WAJA 2YINA 3TLTA 2H7OA 5KX5E 4H9PC 2BKNA 2LLYA 3ABVA 4U2ZA 4GKKT 1FEWA 2KMFA 3VKGA 3N2GE 3KV6A 2CBJA 3ZMZB 4NIQA 5H6RB 3ZCIA 4PFPA 2BS2A 2NW9A 1KNPA 1FMWA 3UFGA 3BQLA 3KV5A 5L3FB 2A9UA 3ZJ1A 4P09A 2E2AA 5ADXL 5FXZA 2QRXA 1KK7A 1AGRE 5JDNA 1HNZT 2V5DA 5IHYA 4AIUA 2YDSA 1I6ZA 2M6IA 3SWHA 4PJLA 2RPAA 2C0SA 2QVAA 5HE1A 2CHOA 4IE6A 2ZM0A 3RKGA 1S94A 4CQIA 4HFHA 1T8BA 5EZYE 3P4QA 2K3WA 1W0BA 3ZT6A 4TNBA 2JRKA 2WCAA 2IAKA 5AQUB 2UXDT 4I43B 1YQ4A 5AQGB 3T8OA 5C2TA 4PK5A 3B5MA 5LYJE 4L5GA 2N1GA 3UUBA 3JC6C 5FXVA 3L8RA 2HH7A 3E0ZA 4PK6A 4DO0A 2X66A 3DP7A 3LFMA 2CBIA 5IWAT 4H9OC 4XAXB 2JPFA 3ONXA 1HF8A 1US7B 5CGMA 5KXJA 2ACXA 4JI6T 4AKHA 2YN6A 3I0QA 2E5VA 3PUYF 3UULA 2XSBA 4YHHT 2WU5A 5CFBA 3CPZA 3PTRB 3KFWX 1IJ5A 3EDUA 1KEYA 3RYHE 3PUQA 2W00A 4DIDB 5L4HA 3TKLB 3MKDA 1WR6A 3UTKA 2IC9A 2OV9A 4KUMB 3CQGB 3AA7B 3O1IA 5LHHB 4DR5T 5L3BB 1SA0E 4COFA 3AEFA 1N33T 4IREA 3RIUC 1UCUA 3ZCJA 3ZC0A 5LG3A 3PUVF 4WBNE 2B1EA 2MBGA 3LDQB 4EZHA 4ILBA 4ZI2C 5C3JA 3ZMTB 2UXNB 1S35A 4IGUA 4K0UA 3N9MA 3KVAA 4P1NA 2XQ8A 3CWZB 2VWAA 2V26A 4ZI3D 5AQQB 1DK8A 1NWMX 4JI5T 3ZMSB 3AE1A 3FBZA 1W0AA 3CKDA 2D0UA 3AVRA 4QWNB 3A7MA 2PG8A 2VB6A 3QUJA 5HEJA 4KBMB 2DNXA 2QYWA 3MA9A 2CA5A 4UELA 3EI0A 3RH3A 4TNDA 4ILUA 4EYYR 1HCIA 2DI4A 1FQKB 4QXHB 2RP4A 4H9NC 4O4LE 3LG7A 5HWXA 3RC3A 2LM9A 2BKPA 2KNDA 3AA1B 4GIWA 2ZMAA 3MACA 4JI3T 1Y01A 4I50E 3P4RA 4U7YA 2F4VT 1BR0A 3DTOA 4YFSA 3QK6A 2V6YB 1Z8UA 3MZKB 3LJCA 2VL0A 2BZBA 4U33A 5L3CB 3L3PA 4HFVA 3WAKA 3H3MA 1JNZA 2CRPA 2CM0A 3QNUA 2VKHA 1MMNA 1U4QA 3IBPA 3L39A 4X65T 3AEAA 4YSXA 3FXEB 4U3CA 4EEDA 1LKXA 3KVBA 1XNQT 3IEEA 2UU9T 4U72A 4EOZB 2OA5A 5LGTB 4DUZT 2UUAT 4X62T 3TLUA 4AISA 3GMIA 4EAHA 3EUHA 4PNIA 3ETUA 4JI1T 3TLVA 2ODUA 3T1YT 3C98B 4AKLA 3PVUA 2FJDA 1HR0T 5JRCA 3LBXA 3VU7H 4X1YE 1EMUA 5JDGA 4LFAT 2LSKA 3AA6B 3AE7A 2PTFA 5M4YA 5AQRB 1YKHB 3J7Yq 2XM1A 5L4EA 3B57A 2K48A 2V7JA 1WLXA 1ZHCA 2X68A 1U5PA 4HN9A 3PUWF 5KMGP 3VHLA 4OX9T 1YD8G 4B3ST 2V1DB 4JI7T 2XJ7A 5LA6E 3NBXX 4HGAA 5FXWA 1UGOA 4DR1T 4NXNT 4YTPA 2KINB 1OWAA 3ONJA 3SS1A 2V4ZB 3PJAA 4WZXA 5JR9C 3V5SA 3HA4A 2YOEA 5LCYA 2V7IA 2KWIB 5FVLA 4V1Av 5EK3A 3JADA 2YU2A 3K1SA 3VRAA 3K3NA 3K8PC 4DNDA 4HE8A 5ABFA 2BVLA 4GOUA 2XAGB 4JI2T 4OHFA 3LBXB 2L9QA 2XZEA 2Q9QA 1SHZC 3A5XA 3E08A 4WYVA 4IE0A 2RA1A 2XAQB 4GK0E 1L0VA 4IDNA 2A72A 1Z0PA 4EEBA 1VOMA 3ZT7A 5HWYA 3N9NA 3F57A 3MK7C 1XMQT 1D0XA 2VURA 2WAUA 3I5QA 1Y64B 3AAAB 2MTQA 2ZM8A 4HKAA 3K3QC 3NYOA 2V7KA 4NPPA 5FNVE 3ZKRA 1D1CA 3OYZA 3RC8A 2LSJA 3R84B 3PVWA 3N9OA 2WWVA 3N9PA 1JNRA 1MNEA 1ZV4X 3JC6D 2X9WA 2LM2A 3ZYLA 2BVMA 3AXJA 4EYUA 2HPJA 4PK4A 5JTGA 3AEGA 1KFYA 4YTNA 2Q9QD 3HKCE 5ABFB 4X1IE 4U7IA 5EK2A 5DABA 5HEGA 2FBWA 2X9YA 4AQFC 2DL1A 3HKBE 3CQCB 1VCTA 2W2UA 2V8SV 3NYNA 2DLRA 2UUCT 2VVNA 3AE2A 4DBRA 2BT2A 1EZ3A 2CWOA 5KDMC 3ZYKA 3AE4A 2BV1A 3I9YA 3OPCA 4IDOA 3ZJ2A 4AI6A 4MALA 2YDQA 1YW0A 4TUYE 3CK6A 1HNXT 3OKQA 2IUBA 4J2CA 3H37A 5J2TE 4FJOA 4CI3B 2DLVA 4KP3C 4E7ZA 2CHNA 4C90A 3V5WA 4QKNA 5FY1A 4JLEA 4ANJA 2H88A 3PUGA 4DMWA 4M1PA 5JREA 4X64T 3KRWA 4O4JE 1XDOA 1EZYA 2V7LA 3UU4A 1IBMT 3RYCE 3AXJB 4BAYB 3ANWB 4LMJA 3C7KB 1IZNB 4L9IA 1HG5A 5BMVE 4QX7B 3N9LA 5CJ5A 2XSAA 3AA0B 2LSYA 2QA7A 3O1JA 3TLWA 2VQFT 2XAFB 2FUPA 2CRBA 3P8CD 1J5ET 5FL0A 2BS4A 5FL1A 4DV4T 4AKGA 2LKGA 4O2BE 1VRBA 1UX5A 4L0RA 2CMRA 4O4HE 2JQHA 2NW7A 5ABGA 2EHOC 3P50A 3FZHB 4QHOA 5LGNB 4MLKA 4DR6T 2H7VC 2MPKA 5CA0E 1LVFA 3Q5EA 1E7PA 4A98A 2WZIA 5FYMA 5C8YE 2XAJB 3F2EA 5ABHA 1W09A 2XHEB 4TV9E 4LFCT 2LEHA 1WCRA 4P0AA 3GN5B 2X67A 3ZYMA 4DR2T 2XQ7A 3SOLA 4DV1T 4EGWA 5AQJB 4HEAA 4UIGA 3NZPA 2V7MA 2E9XB 1I94T 1WYCA 4BJNA 2V6YA 5JR9A 4UXNB 5FXXA 1OXZA 4NXMT 4IDZA 1NAFA 3GA8A 4O8SA 2BS3A 4I55E 4HFDA 2M67A 2YK0A 2DCFA 3F31A 5EK4A 3UQ4A 2PFVA 2EBZA 1DU2A 3C64A 2CCQA 2XM2A 4DV5T 1SUMB 3KRXA 4PJJA 5L2LA 3IHRA 1KNZA 2DWKA 3SFEA 2PBIA 2VKDA 3CVRA 1BR4A 3I1AA 5AQVB 1HFAA 5FY7A 3JAEA 3NWIA 5AQIB 3ESLA 3ZMVB 3M3ZB 4DR4T 4QH4A 2YU1A 5ABEA 4AQYT 3UU3A 2I6HA 3GWHA 4CI2B 5L3EB 4ZXLA 3U78A 2NTXA 2KXPB 2IHDA 4ILCA 5FVKA 2W66A 1G73A 2CXFA 3AAEB 5F3JA 4EIWA 4YHJA 1LVKA 2ZLYA 1M62A 3HI2A 1BR2A 3NVOA 3QOFA 3UUXB 2X51A 2WP9A 3HR0A 5L47A 3FB2A 3ZN1B 3BK9A 1IBKT 5FKYA 5CA1E 5JR9B 2JM5A 3K3OA 4NUUA 4DR7T 4QXCB 1D1BA 2XTLA 3UU8A 2JQQA 4LF8T 5JDMA 2IW5B 2XPKA 4H9QC 4IHJE 4CXWA 5DQWA 3Q9DA 2I59A 2LRLA 4YXDA 1HG2A 5LP6E 2W0GA 1QLBA 5J0ZA 5J2UE 4IIJE 5AQTB 4EKDB 3U3IA 3AAIA 5HEUA 1D1AA 4AQFA 3HKDE 2HN2A 2AF0A 1ZKEA 3R6NA 4DV0T 3ZSSA 2E9XC 4UVBB 3VR8A 4IT4A 4IDQA 1NEKA 2N2NA 5CB4E 2ODEB 1FJGT 2YDRA 2X9HA 1X79A 5LMNT 4LF7T 2LE8A 4ZOLE 3SFDA 3PU3A 2ES0A 4ISSA 1YKEB 4AKRB 1CHUA 5H6QB 2L8KA 3CX7B 4TNVA 3VR9A 4O4IE 3L09A 5LHGB 4ZS2A 4HFEA 4ASKA 2CXLA 3UFEA 2V5CA 5AQLB 4H9SE 4CI1B 4LF5T 2UUBT 3RF1A 1HS7A 5AQOB 5LBMA 1XZYA 4MBQA 4ZI7E 2ZM2A 4LF4T 2Y8DA 5FP3A 3FBLA 4PJNA 3ZC1A 3AEEA 1UUSA 1M7KA 3EHZA 4TWDA 4X66T 2WU2A 3S4UA 4KHPT 4GYSA 1QUUA 4B3RT 4ZI3C 2JNUA 4HFBA 5HXHA 1R8IA 3ZT5A 3UT5E 5HXRA 3C7LA 4F8HA 2YEVC 1ZEEA 3E22E 4Z91A 4HFCA 1YQ3A 2K9AA 1V9DA 2LSIA 4U74A 3RLFF 2BG9C 1UX4A 5FMNA 2EHOA 5AQHB 4PJMA 4NUVA 4EB6E 2KWHA 4LMLA 2XQ5A 4LFBT 4E7SA 3RRCA 1FQIA 5JDQA 3KINB 2LSGA 3RGLA 4DUYT 1SE7A 1HX8A 2VKOA 2NTYA 4UF0B 3RQWA 2A2FX 1MNDA 2IHBB 2CPTA 3FZKB 4UV8B 4DV7T 3PE0A 2G0UA 3V5UA 2CE7A 3VRBA 4KMCA 3QB5K 3RRWA 4X1KE 2XAHB 2LOSA 1OEDC 3W15B 5IUXA 3ZLIA 1MMAA 2J47A 2OJ4A 5AQPB 2BBJA 3JAFA 3RIUA 1XNRT 3Q5XA 5LBQB 4HFIA 4F6RC 2MOZA 3KV9A 3C51A 5BR8T 2FJAA 3N5LA 4QH5A 2CLYC 3SRZA 2EHOB 4TN7B 3ANWA 3OVUA 1XDPA 2KSRA 3I9WA 4HWHA 2L3LA 5DQVA 4KI0F 2LT3A 2VK9A 4Q25A 3AE9A 2C5KT 5HYAA 1O3XA 1IJ6A 4ZEYA 3C4XA 3ZMUB 4K0KT 4C91A 3AE6A 4MHCA 1T98A 4U2YA 3J9X1 2NP9A 2VKJA 3LK3B 2Z6EA 2WDVA 2E5LT 2BDEA 1MIWA 5HXEA 3KV4A 3PJAJ 2WB5A 3UU6A 2WDRA 3TLSA 2FJEA 2JQ9A 4OK0A 4ZI2D 5LOVE 3FZFB 4EXTA 2X9XA 4QX8B 3AEBA 2MAWA 2IHR1 5JH7E 5LNKA 3B13A 5AQMB 2WY2A 4LF6T 2PJQA 2HPLA 3AE8A 3GN5A 4DV6T 2CEAA 2CWYA 4KX6A 3KBTA 4A56A 2C5IT 4CN4A 2NW8A 1T7SA 4OYKA 2E9XA 2XUEA 4DVDA 1N36T 4A97A 4A5XA 1MMGA 1B7TA 4GK5E 1IAPA 5F5WA 4IL9A 3CIKA 5HEOA 4TWFA 1IBLT 5A1LA 2WM9A 2B76A 3RQUA 4JEUB 2WMNA 1X9BA 4PNKA 4JBWF 1J5WA 4LMKA 5AQKB 2VL8A 5HCMA 2LJLA 1MMDA 2NOXA 4PW8A 2XQ9A 4LF9T 2KLQA 1KNRA 4YTMA 2A3DA 4Z90A 2HHHT 2LHRA 5HE0A 1ZOYA 2JQKA 5FY0A 4AKIA 5TAOA 3CX6B 2W62A 5LXTE 4O2AE 2UXCT 2VASA 3PU8A 3RIFA 3RYIE 3FZLB 2YKSA 3NRXA 5HEHA 2E9XD 2XQYA 3O1HA 3X1DA 4XZCA 2XQ6A 3FZMB 5AQFB 4BJMA 2LHNA 4HWDA 2JMKA 2OLTA 2DHRA 3O9XA 3IF8B 2I0MA 4QH1A 1FQJB 2BG9A 2Q9QC 5HAXA 1NENA 3C4ZA 1HTJF 3EVYA 5IYZE 1VCSA 3AB3B 5LB7B 2XQ3A 4B6XA 5JVDE 2FJBA 4YY3T 5DO9B 5HE2A 2K24A 3UQ7A 2LKHA 4DBQA 3RKOA 2Y48B 5LMUT 4H63H 5JDFA 3VKHA 4CXXA 3AECA 1GQEA 1T72A 4TV8E 2X0HA 3AVSA 2D2SA 3PURA 3ONLC 3RIAA 3BQKA 3PV0F 3NKZA 1OEDA 3N2OA 2GK9A 2AXDS 2LRKA 2JIWA 4CXYA 2AE9A 3RHWA 2WQYA 2WSSV 2SPCA 2NR4A 2UXXB 2BG9E 4DV3T 1YXRA 4P0BA 3AEDA 4GKJT 4N78D 4JI8T 4TZ4C 5LJMA 4HWCA 4OYJA 3KBUA 1OMWA 4B3TT 4Z8XA 4UVCB 2NWBA 4CZZB 4AQGA 2WZHA 4FI5A 3PSCA 2BG9B 5E0OA 3PUXF 5J1GA 1E1HB 3OTOT 3AE5A 4YLHA 5F8PA 4JUYA 3Q2MA 2K5BB 5AFUL 4DR3T 3Q5WA 5DJQC 4AXPA 3I0OA 2ODVA 2R6GF 1UK5A 2ZM6T 1OEDE 4YSZA 4KHZF 3P4SA 4X5TA 2D0TA 3EDVA 5HXCA 1BR1A 3C4WA 3T1HT 4I4TE 3G06A 1HNWT 4IE7A 5HXSA 1WRDA 1OEDB 1N32T 2XY8B 4DMVA 4ERRA 4TNWA 3O4XE 2X0YA 5L3DB 4JV5T 4IE5A 3UUNA 4JI0T 5LGUB 4TWHA 5JDHA 4IL4A 2VQET 4G2AA 1G8XA 4UF0A 3UZTA 2D9DA 2W61A 2D5UA 1D0ZA 1CUNA 3KDSE 4JEHB 3ETVA 4ZZBA 2MYSA 2BCJA 1WR0A 1N34T 3OJAA 2BKOA 3QB5A 3C50A 2CLYB 3PUSA 4YT0A 4HWFA 1MIYA 4DV2T 2KZ7B 3ZSTA 3CMLA 2IIUA 3WI3A
chains in the Genus database with same CATH topology
3NZQA 3OYXA 3C51A 4QWNB 3P8CD 2PG8A 3N5LA 2N9DA 1FIOA 2VB6A 2CLYC 2E8IA 3NRYA 2EHOB 2W63A 3QUJA 4KBMB 3SRZA 2DNXA 4GYRA 4AKGA 3MA9A 4TN7B 2CA5A 4O2BE 1VRBA 3ANWA 4UELA 3RH3A 1UX5A 4L0RA 2P9BA 4WW0A 2CMRA 2Y6XA 4ILUA 4EYYR 3H3AA 1H7CA 1HCIA 2DI4A 4O4HE 4H63V 3I9WA 4YJ3E 2XASB 4QXHB 2RP4A 2NW7A 3D0TA 2L3LA 5DQVA 2EHOC 4H9NC 2LT3A 4O4LE 5LHIB 3LG7A 5HWXA 3RC3A 4QHOA 2LM9A 5LGNB 2VK9A 2KNDA 4WBOA 3AA1B 4GIWA 2C5KT 1WYBA 4MLKA 2ZMAA 3MACA 5HYAA 4I50E 2H7VC 5CA0E 1O3XA 1LVFA 1BR0A 3DTOA 1IJ6A 3C4XA 3QK6A 4YFSA 3ZMUB 4WNKA 4C91A 2CXDA 4MHCA 1T98A 3ZEFB 3MZKB 3MXZA 5FYMA 5C8YE 3J9X1 2XAJB 3LJCA 3P7IA 3FXDB 2NP9A 2VKJA 4UEMA 2BZBA 4UVAB 3F2EA 3CQXC 3LK3B 2Z6EA 2XHEB 4TV9E 5L3CB 4BA9A 2BDEA 1MIWA 2LEHA 5HXEA 3KV4A 4P0AA 3GN5B 1MIVA 3UUMA 2X67A 3ZYMA 3L3PA 4HFVA 3LK2B 2QGSA 2WBLA 4OK0A 4ZI2D 3SOLA 3RPUA 1FMVA 4OFZA 3WAKA 4HEAA 4UIGA 1AJ3A 3DJBA 3MJXA 5LOVE 3NZPA 2CM0A 2E9XB 2V7MA 4EXTA 2VKHA 4ADZA 1WYCA 1MMNA 4UV9B 1U4QA 3IBPA 2X9XA 4BJNA 3LK42 3ZN0B 4QX8B 5JR9A 4MFRA 4UXNB 5FXXA 1OXZA 4IDZA 5JH7E 3FXEB 5LNKA 1NAFA 3B13A 1LKXA 3BQIA 3GA8A 4O8SA 3KVBA 4I55E 2PJQA 5LG4A 2JJ9A 4XBFB 5JRCB 3IEEA 2M67A 2HPLA 4U72A 2YK0A 4EOZB 2DCFA 4TX5A 3GN5A 3QC9A 2OA5A 3F31A 5EK4A 2CEAA 5LGTB 2PFVA 2LOPA 2CWYA 3ZPOA 3KBTA 4PAGA 4A56A 3C64A 2C5IT 2CCQA 3FHNA 2NW8A 3GMIA 4EAHA 3EUHA 4OYKA 1QSDA 4PNIA 4HTEA 2E9XA 4H9RC 3ETUA 4PJJA 2XUEA 4DVDA 5JQGE 5L2LA 3IHRA 1KNZA 2DWKA 2J1DG 2ODUA 2PBIA 1MMGA 2VKDA 5JDLA 1B7TA 4GK5E 3RX6A 1IAPA 3CVRA 1BR4A 2EHOD 3I1AA 2C5JA 3C98B 4AKLA 1HFAA 5FY7A 1D0YA 3ESLA 5JRCA 3ZMVB 3LBXA 3VU7H 4X20E 4X1YE 2YU1A 5A1LA 2WM9A 5JDGA 5L3GB 3RYFE 4JEUB 2LSKA 2WMNA 3AA6B 3GWHA 3M65A 5M4YA 4ISTA 4CI2B 2VL8A 1YKHB 3CX8B 5L3EB 2LJLA 1MMDA 3U78A 3J7Yq 2NTXA 2KXPB 3N2KE 5LJNA 4G63A 2NOXA 3B57A 1G73A 2CXFA 2DWGA 2K48A 3AAEB 5F3JA 4PW8A 4EIWA 4YHJA 2V7JA 1WLXA 3HKEE 5ETWA 1ZHCA 1LVKA 2ZLYA 2KLQA 4QXBB 2WWUA 1BR2A 3HI2A 2A3DA 2X68A 1U5PA 2X0LB 4HN9A 3N9QA 2LHRA 3UUXB 2X51A 4ZS3A 2H3RA 5KMGP 3VHLA 3HR0A 5FY0A 4AKIA 5TAOA 3CX6B 3FB2A 3ZN1B 1LRZA 2W62A 5LXTE 3BK9A 1YD8G 2KT9A 4PFOA 2V1DB 4O2AE 5CA1E 5JR9B 3HL6A 5LA6E 3NBXX 2VASA 3K3OA 4NUUA 4QXCB 3PU8A 4YJ2E 4ZHQE 1D1BA 2XTLA 3RYIE 4HGAA 5FXWA 2JQQA 3OBVE 5GONE 3NRXA 5JDMA 4EZ4A 2IW5B 2WMOA 3PDYA 2E9XD 2KINB 2XQYA 3O1HA 2JMHA 1OWAA 3SS1A 2IC6A 4H9QC 4IHJE 4CXWA 5DQWA 5JR9C 3V5SA 4XZCA 2Q9QB 3Q9DA 2I59A 3HA4A 5LCYA 2V7IA 1HG2A 5LP6E 4IE4A 2KWIB 4BJMA 2W0GA 2LHNA 2JMKA 4V1Av 5J2UE 3PUAA 2DHRA 4IIJE 3O9XA 3IF8B 5EK3A 3U3IA 3AAIA 1D1AA 2YU2A 4AQFA 3HKDE 2Q9QC 5HAXA 3WAJA 3K3NA 3K8PC 2YINA 4HE8A 4DNDA 2BVLA 3C4ZA 4GOUA 1HTJF 1ZKEA 2H7OA 3EVYA 5IYZE 3R6NA 3AB3B 2XAGB 4OHFA 4H9PC 5KX5E 2E9XC 4UVBB 3LBXB 4B6XA 5JVDE 2N2NA 2L9QA 1FEWA 5CB4E 2KMFA 3VKGA 2K24A 2Q9QA 3N2GE 2X9HA 1SHZC 3KV6A 3A5XA 3E08A 3ZMZB 4DBQA 5H6RB 3ZCIA 4IE0A 4PFPA 2Y48B 1X79A 3RKOA 4H63H 5JDFA 2NW9A 3VKHA 2RA1A 2LE8A 2XAQB 4GK0E 1FMWA 4ZOLE 3PU3A 2ES0A 4ISSA 1YKEB 2A72A 4CXXA 1Z0PA 4AKRB 4TV8E 3BQLA 5H6QB 1VOMA 2L8KA 3KV5A 3CX7B 5L3FB 3AVSA 4O4IE 3L09A 5LHGB 4ZS2A 2D2SA 3ZJ1A 4ASKA 5HWYA 4P09A 3N9NA 3PURA 3F57A 3MK7C 2CXLA 3UFEA 5ADXL 5FXZA 1D0XA 2WAUA 3I5QA 4H9SE 4CI1B 1Y64B 1KK7A 3AAAB 2MTQA 3BQKA 5JDNA 2ZM8A 5IHYA 4HKAA 3K3QC 2GK9A 2V7KA 3N2OA 5FNVE 1HS7A 5LBMA 1D1CA 3OYZA 4CXYA 4MBQA 3RC8A 2WSSV 2SPCA 2LSJA 3R84B 2UXXB 4ZI7E 3SWHA 3N9OA 4PJLA 4P0BA 2ZM2A 3N9PA 4N78D 2Y8DA 4TZ4C 5FP3A 2C0SA 1MNEA 1ZV4X 5LJMA 3FBLA 3JC6D 4PJNA 2X9WA 4IE6A 3ZC1A 3ZYLA 2ZM0A 4OYJA 2BVMA 3KBUA 1S94A 4CQIA 4EYUA 3S4UA 2HPJA 4Z8XA 4UVCB 4PK4A 5EZYE 2NWBA 4CZZB 4GYSA 4AQGA 1QUUA 4FI5A 2Q9QD 3HKCE 2JRKA 4ZI3C 2IAKA 5E0OA 5HXHA 4X1IE 5J1GA 3UT5E 5EK2A 5HXRA 1E1HB 4YLHA 5DABA 4I43B 5F8PA 2YEVC 4JUYA 3Q2MA 1ZEEA 2K5BB 3T8OA 3E22E 4PK5A 5AFUL 2K9AA 1V9DA 2LSIA 3Q5WA 2X9YA 5DJQC 4U74A 3HKBE 4AQFC 3CQCB 5LYJE 4L5GA 2N1GA 4AXPA 3JC6C 5FXVA 3I0OA 2HH7A 3E0ZA 1UX4A 5FMNA 4PK6A 2EHOA 2DLRA 2ODVA 4PJMA 4NUVA 4DO0A 4EB6E 2KWHA 2X66A 3DP7A 4DBRA 3LFMA 4E7SA 1EZ3A 2CWOA 3RRCA 2D0TA 3EDVA 4H9OC 5KDMC 4XAXB 5JDQA 3KINB 2JPFA 2LSGA 3ONXA 3ZYKA 5HXCA 1BR1A 1HF8A 3C4WA 1US7B 1HX8A 2VKOA 2NTYA 4I4TE 2ACXA 4UF0B 4AKHA 3I9YA 3I0QA 2A2FX 3ZJ2A 4AI6A 1MNDA 3WI3A 3UULA 4MALA 1YW0A 4TUYE 3CPZA 4UV8B 3PTRB 3KFWX 3OKQA 1IJ5A 1WRDA 4IE7A 5HXSA 3PE0A 4J2CA 3EDUA 3H37A 3RYHE 5J2TE 2G0UA 2W00A 3PUQA 4FJOA 3V5UA 4CI3B 4DMVA 4ERRA 2CE7A 4KP3C 3O4XE 4KMCA 3TKLB 3MKDA 1WR6A 3UTKA 5L3DB 2IC9A 4E7ZA 4KUMB 4IE5A 3RRWA 3UUNA 3CQGB 3AA7B 3O1IA 5LGUB 5LHHB 4C90A 4X1KE 5L3BB 1SA0E 4QKNA 5FY1A 2XAHB 5JDHA 4JLEA 4ANJA 2LOSA 3W15B 3PUGA 4DMWA 1UCUA 4M1PA 5JREA 3ZCJA 3ZC0A 4G2AA 4WBNE 2B1EA 4O4JE 2MBGA 1G8XA 4UF0A 4EZHA 2V7LA 2W61A 4ZI2C 2D5UA 3ZLIA 3RYCE 1D0ZA 1MMAA 1CUNA 3ZMTB 3KDSE 4BAYB 4JEHB 2UXNB 1S35A 3ANWB 3ETVA 4IGUA 2MYSA 4K0UA 3N9MA 3KVAA 1IZNB 3CWZB 4L9IA 1HG5A 3OJAA 5BMVE 2VWAA 4QX7B 3N9LA 2V26A 3C50A 4ZI3D 2CLYB 3Q5XA 3PUSA 5LBQB 3AA0B 1NWMX 1MIYA 2LSYA 4F6RC 2KZ7B 3ZMSB 2MOZA 3KV9A 3FBZA 2QA7A 3CMLA 3O1JA 3CKDA 2D0UA 2XAFB 3AVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTE A; 
#chains in the Genus database with same CATH topology
 3NZQ A;  2M6B A;  3OYX A;  2J62 A;  3LSV A;  2N9D A;  3P4P A;  1FIO A;  1J1J A;  2E8I A;  3NRY A;  2V6X A;  2W63 A;  4GYR A;  1XWM A;  1UUR A;  2WS3 A;  2OWI A;  2HN1 A;  2P9B A;  3RI5 A;  4WW0 A;  2Y6X A;  5AQN B;  3H3A A;  1H7C A;  4H63 V;  4YJ3 E;  2XAS B;  3D0T A;  5LHI B;  3Q5D A;  4WBO A;  1WYB A;  1HX1 B;  1KF6 A;  4IDP A;  2IDO B;  4WNK A;  2CXD A;  3ZEF B;  3MXZ A;  4B3M T;  3P7I A;  3FXD B;  4UEM A;  4UVA B;  3CQX C;  3UU5 A;  4BA9 A;  4I0U A;  1MIV A;  3UUM A;  3LK2 B;  2QGS A;  2WBL A;  2UXB T;  3RPU A;  1FMV A;  4OFZ A;  1W9R A;  1AJ3 A;  3DJB A;  3MJX A;  4ADZ A;  1EZT A;  4UV9 B;  3LK4 2;  3ZN0 B;  4MK0 A;  3P4W A;  4MFR A;  3BQI A;  1E2A A;  2IK8 B;  5LG4 A;  2JJ9 A;  4XBF B;  5JRC B;  4TX5 A;  3QC9 A;  5HCJ A;  4ILA A;  2LOP A;  3ZPO A;  4PAG A;  3CIR A;  2WDQ A;  3FHN A;  4ZZC A;  1QSD A;  4HTE A;  4H9R C;  5JQG E;  2BBH A;  4HWI B;  2J1D G;  5JDL A;  3RX6 A;  2EHO D;  2C5J A;  5AQS B;  1WFD A;  2XQ4 A;  1D0Y A;  4CN1 A;  3EAB A;  3AE3 A;  4X20 E;  5L3G B;  3RYF E;  4CN6 A;  2W67 A;  5HE3 A;  3M65 A;  4U31 A;  4IST A;  3CX8 B;  3IA3 A;  2IML A;  4YSY A;  3N2K E;  5LJN A;  3JCF A;  4G63 A;  2DWG A;  3HKE E;  2XQA A;  5ETW A;  1XMO T;  4QXB B;  2WWU A;  2X0L B;  3N9Q A;  2ACZ A;  4ZS3 A;  2H3R A;  1LRZ A;  2KT9 A;  4PFO A;  2GTP C;  3HL6 A;  2J4G A;  4UR9 A;  1ZP0 A;  1CMZ A;  3A8Y C;  4YJ2 E;  4ZHQ E;  3EAM A;  3OBV E;  5GON E;  4JI4 T;  4EZ4 A;  2WMO A;  3PDY A;  2JMH A;  2D9J A;  2IC6 A;  4JYA T;  2Q9Q B;  2W4X A;  3PUZ F;  4IE4 A;  3PUA A;  2H89 A;  4EV6 A;  2VVS A;  3WAJ A;  2YIN A;  3TLT A;  2H7O A;  5KX5 E;  4H9P C;  2BKN A;  2LLY A;  3ABV A;  4U2Z A;  4GKK T;  1FEW A;  2KMF A;  3VKG A;  3N2G E;  3KV6 A;  2CBJ A;  3ZMZ B;  4NIQ A;  5H6R B;  3ZCI A;  4PFP A;  2BS2 A;  2NW9 A;  1KNP A;  1FMW A;  3UFG A;  3BQL A;  3KV5 A;  5L3F B;  2A9U A;  3ZJ1 A;  4P09 A;  2E2A A;  5ADX L;  5FXZ A;  2QRX A;  1KK7 A;  1AGR E;  5JDN A;  1HNZ T;  2V5D A;  5IHY A;  4AIU A;  2YDS A;  1I6Z A;  2M6I A;  3SWH A;  4PJL A;  2RPA A;  2C0S A;  2QVA A;  5HE1 A;  2CHO A;  4IE6 A;  2ZM0 A;  3RKG A;  1S94 A;  4CQI A;  4HFH A;  1T8B A;  5EZY E;  3P4Q A;  2K3W A;  1W0B A;  3ZT6 A;  4TNB A;  2JRK A;  2WCA A;  2IAK A;  5AQU B;  2UXD T;  4I43 B;  1YQ4 A;  5AQG B;  3T8O A;  5C2T A;  4PK5 A;  3B5M A;  5LYJ E;  4L5G A;  2N1G A;  3UUB A;  3JC6 C;  5FXV A;  3L8R A;  2HH7 A;  3E0Z A;  4PK6 A;  4DO0 A;  2X66 A;  3DP7 A;  3LFM A;  2CBI A;  5IWA T;  4H9O C;  4XAX B;  2JPF A;  3ONX A;  1HF8 A;  1US7 B;  5CGM A;  5KXJ A;  2ACX A;  4JI6 T;  4AKH A;  2YN6 A;  3I0Q A;  2E5V A;  3PUY F;  3UUL A;  2XSB A;  4YHH T;  2WU5 A;  5CFB A;  3CPZ A;  3PTR B;  3KFW X;  1IJ5 A;  3EDU A;  1KEY A;  3RYH E;  3PUQ A;  2W00 A;  4DID B;  5L4H A;  3TKL B;  3MKD A;  1WR6 A;  3UTK A;  2IC9 A;  2OV9 A;  4KUM B;  3CQG B;  3AA7 B;  3O1I A;  5LHH B;  4DR5 T;  5L3B B;  1SA0 E;  4COF A;  3AEF A;  1N33 T;  4IRE A;  3RIU C;  1UCU A;  3ZCJ A;  3ZC0 A;  5LG3 A;  3PUV F;  4WBN E;  2B1E A;  2MBG A;  3LDQ B;  4EZH A;  4ILB A;  4ZI2 C;  5C3J A;  3ZMT B;  2UXN B;  1S35 A;  4IGU A;  4K0U A;  3N9M A;  3KVA A;  4P1N A;  2XQ8 A;  3CWZ B;  2VWA A;  2V26 A;  4ZI3 D;  5AQQ B;  1DK8 A;  1NWM X;  4JI5 T;  3ZMS B;  3AE1 A;  3FBZ A;  1W0A A;  3CKD A;  2D0U A;  3AVR A;  4QWN B;  3A7M A;  2PG8 A;  2VB6 A;  3QUJ A;  5HEJ A;  4KBM B;  2DNX A;  2QYW A;  3MA9 A;  2CA5 A;  4UEL A;  3EI0 A;  3RH3 A;  4TND A;  4ILU A;  4EYY R;  1HCI A;  2DI4 A;  1FQK B;  4QXH B;  2RP4 A;  4H9N C;  4O4L E;  3LG7 A;  5HWX A;  3RC3 A;  2LM9 A;  2BKP A;  2KND A;  3AA1 B;  4GIW A;  2ZMA A;  3MAC A;  4JI3 T;  1Y01 A;  4I50 E;  3P4R A;  4U7Y A;  2F4V T;  1BR0 A;  3DTO A;  4YFS A;  3QK6 A;  2V6Y B;  1Z8U A;  3MZK B;  3LJC A;  2VL0 A;  2BZB A;  4U33 A;  5L3C B;  3L3P A;  4HFV A;  3WAK A;  3H3M A;  1JNZ A;  2CRP A;  2CM0 A;  3QNU A;  2VKH A;  1MMN A;  1U4Q A;  3IBP A;  3L39 A;  4X65 T;  3AEA A;  4YSX A;  3FXE B;  4U3C A;  4EED A;  1LKX A;  3KVB A;  1XNQ T;  3IEE A;  2UU9 T;  4U72 A;  4EOZ B;  2OA5 A;  5LGT B;  4DUZ T;  2UUA T;  4X62 T;  3TLU A;  4AIS A;  3GMI A;  4EAH A;  3EUH A;  4PNI A;  3ETU A;  4JI1 T;  3TLV A;  2ODU A;  3T1Y T;  3C98 B;  4AKL A;  3PVU A;  2FJD A;  1HR0 T;  5JRC A;  3LBX A;  3VU7 H;  4X1Y E;  1EMU A;  5JDG A;  4LFA T;  2LSK A;  3AA6 B;  3AE7 A;  2PTF A;  5M4Y A;  5AQR B;  1YKH B;  3J7Y q;  2XM1 A;  5L4E A;  3B57 A;  2K48 A;  2V7J A;  1WLX A;  1ZHC A;  2X68 A;  1U5P A;  4HN9 A;  3PUW F;  5KMG P;  3VHL A;  4OX9 T;  1YD8 G;  4B3S T;  2V1D B;  4JI7 T;  2XJ7 A;  5LA6 E;  3NBX X;  4HGA A;  5FXW A;  1UGO A;  4DR1 T;  4NXN T;  4YTP A;  2KIN B;  1OWA A;  3ONJ A;  3SS1 A;  2V4Z B;  3PJA A;  4WZX A;  5JR9 C;  3V5S A;  3HA4 A;  2YOE A;  5LCY A;  2V7I A;  2KWI B;  5FVL A;  4V1A v;  5EK3 A;  3JAD A;  2YU2 A;  3K1S A;  3VRA A;  3K3N A;  3K8P C;  4DND A;  4HE8 A;  5ABF A;  2BVL A;  4GOU A;  2XAG B;  4JI2 T;  4OHF A;  3LBX B;  2L9Q A;  2XZE A;  2Q9Q A;  1SHZ C;  3A5X A;  3E08 A;  4WYV A;  4IE0 A;  2RA1 A;  2XAQ B;  4GK0 E;  1L0V A;  4IDN A;  2A72 A;  1Z0P A;  4EEB A;  1VOM A;  3ZT7 A;  5HWY A;  3N9N A;  3F57 A;  3MK7 C;  1XMQ T;  1D0X A;  2VUR A;  2WAU A;  3I5Q A;  1Y64 B;  3AAA B;  2MTQ A;  2ZM8 A;  4HKA A;  3K3Q C;  3NYO A;  2V7K A;  4NPP A;  5FNV E;  3ZKR A;  1D1C A;  3OYZ A;  3RC8 A;  2LSJ A;  3R84 B;  3PVW A;  3N9O A;  2WWV A;  3N9P A;  1JNR A;  1MNE A;  1ZV4 X;  3JC6 D;  2X9W A;  2LM2 A;  3ZYL A;  2BVM A;  3AXJ A;  4EYU A;  2HPJ A;  4PK4 A;  5JTG A;  3AEG A;  1KFY A;  4YTN A;  2Q9Q D;  3HKC E;  5ABF B;  4X1I E;  4U7I A;  5EK2 A;  5DAB A;  5HEG A;  2FBW A;  2X9Y A;  4AQF C;  2DL1 A;  3HKB E;  3CQC B;  1VCT A;  2W2U A;  2V8S V;  3NYN A;  2DLR A;  2UUC T;  2VVN A;  3AE2 A;  4DBR A;  2BT2 A;  1EZ3 A;  2CWO A;  5KDM C;  3ZYK A;  3AE4 A;  2BV1 A;  3I9Y A;  3OPC A;  4IDO A;  3ZJ2 A;  4AI6 A;  4MAL A;  2YDQ A;  1YW0 A;  4TUY E;  3CK6 A;  1HNX T;  3OKQ A;  2IUB A;  4J2C A;  3H37 A;  5J2T E;  4FJO A;  4CI3 B;  2DLV A;  4KP3 C;  4E7Z A;  2CHN A;  4C90 A;  3V5W A;  4QKN A;  5FY1 A;  4JLE A;  4ANJ A;  2H88 A;  3PUG A;  4DMW A;  4M1P A;  5JRE A;  4X64 T;  3KRW A;  4O4J E;  1XDO A;  1EZY A;  2V7L A;  3UU4 A;  1IBM T;  3RYC E;  3AXJ B;  4BAY B;  3ANW B;  4LMJ A;  3C7K B;  1IZN B;  4L9I A;  1HG5 A;  5BMV E;  4QX7 B;  3N9L A;  5CJ5 A;  2XSA A;  3AA0 B;  2LSY A;  2QA7 A;  3O1J A;  3TLW A;  2VQF T;  2XAF B;  2FUP A;  2CRB A;  3P8C D;  1J5E T;  5FL0 A;  2BS4 A;  5FL1 A;  4DV4 T;  4AKG A;  2LKG A;  4O2B E;  1VRB A;  1UX5 A;  4L0R A;  2CMR A;  4O4H E;  2JQH A;  2NW7 A;  5ABG A;  2EHO C;  3P50 A;  3FZH B;  4QHO A;  5LGN B;  4MLK A;  4DR6 T;  2H7V C;  2MPK A;  5CA0 E;  1LVF A;  3Q5E A;  1E7P A;  4A98 A;  2WZI A;  5FYM A;  5C8Y E;  2XAJ B;  3F2E A;  5ABH A;  1W09 A;  2XHE B;  4TV9 E;  4LFC T;  2LEH A;  1WCR A;  4P0A A;  3GN5 B;  2X67 A;  3ZYM A;  4DR2 T;  2XQ7 A;  3SOL A;  4DV1 T;  4EGW A;  5AQJ B;  4HEA A;  4UIG A;  3NZP A;  2V7M A;  2E9X B;  1I94 T;  1WYC A;  4BJN A;  2V6Y A;  5JR9 A;  4UXN B;  5FXX A;  1OXZ A;  4NXM T;  4IDZ A;  1NAF A;  3GA8 A;  4O8S A;  2BS3 A;  4I55 E;  4HFD A;  2M67 A;  2YK0 A;  2DCF A;  3F31 A;  5EK4 A;  3UQ4 A;  2PFV A;  2EBZ A;  1DU2 A;  3C64 A;  2CCQ A;  2XM2 A;  4DV5 T;  1SUM B;  3KRX A;  4PJJ A;  5L2L A;  3IHR A;  1KNZ A;  2DWK A;  3SFE A;  2PBI A;  2VKD A;  3CVR A;  1BR4 A;  3I1A A;  5AQV B;  1HFA A;  5FY7 A;  3JAE A;  3NWI A;  5AQI B;  3ESL A;  3ZMV B;  3M3Z B;  4DR4 T;  4QH4 A;  2YU1 A;  5ABE A;  4AQY T;  3UU3 A;  2I6H A;  3GWH A;  4CI2 B;  5L3E B;  4ZXL A;  3U78 A;  2NTX A;  2KXP B;  2IHD A;  4ILC A;  5FVK A;  2W66 A;  1G73 A;  2CXF A;  3AAE B;  5F3J A;  4EIW A;  4YHJ A;  1LVK A;  2ZLY A;  1M62 A;  3HI2 A;  1BR2 A;  3NVO A;  3QOF A;  3UUX B;  2X51 A;  2WP9 A;  3HR0 A;  5L47 A;  3FB2 A;  3ZN1 B;  3BK9 A;  1IBK T;  5FKY A;  5CA1 E;  5JR9 B;  2JM5 A;  3K3O A;  4NUU A;  4DR7 T;  4QXC B;  1D1B A;  2XTL A;  3UU8 A;  2JQQ A;  4LF8 T;  5JDM A;  2IW5 B;  2XPK A;  4H9Q C;  4IHJ E;  4CXW A;  5DQW A;  3Q9D A;  2I59 A;  2LRL A;  4YXD A;  1HG2 A;  5LP6 E;  2W0G A;  1QLB A;  5J0Z A;  5J2U E;  4IIJ E;  5AQT B;  4EKD B;  3U3I A;  3AAI A;  5HEU A;  1D1A A;  4AQF A;  3HKD E;  2HN2 A;  2AF0 A;  1ZKE A;  3R6N A;  4DV0 T;  3ZSS A;  2E9X C;  4UVB B;  3VR8 A;  4IT4 A;  4IDQ A;  1NEK A;  2N2N A;  5CB4 E;  2ODE B;  1FJG T;  2YDR A;  2X9H A;  1X79 A;  5LMN T;  4LF7 T;  2LE8 A;  4ZOL E;  3SFD A;  3PU3 A;  2ES0 A;  4ISS A;  1YKE B;  4AKR B;  1CHU A;  5H6Q B;  2L8K A;  3CX7 B;  4TNV A;  3VR9 A;  4O4I E;  3L09 A;  5LHG B;  4ZS2 A;  4HFE A;  4ASK A;  2CXL A;  3UFE A;  2V5C A;  5AQL B;  4H9S E;  4CI1 B;  4LF5 T;  2UUB T;  3RF1 A;  1HS7 A;  5AQO B;  5LBM A;  1XZY A;  4MBQ A;  4ZI7 E;  2ZM2 A;  4LF4 T;  2Y8D A;  5FP3 A;  3FBL A;  4PJN A;  3ZC1 A;  3AEE A;  1UUS A;  1M7K A;  3EHZ A;  4TWD A;  4X66 T;  2WU2 A;  3S4U A;  4KHP T;  4GYS A;  1QUU A;  4B3R T;  4ZI3 C;  2JNU A;  4HFB A;  5HXH A;  1R8I A;  3ZT5 A;  3UT5 E;  5HXR A;  3C7L A;  4F8H A;  2YEV C;  1ZEE A;  3E22 E;  4Z91 A;  4HFC A;  1YQ3 A;  2K9A A;  1V9D A;  2LSI A;  4U74 A;  3RLF F;  2BG9 C;  1UX4 A;  5FMN A;  2EHO A;  5AQH B;  4PJM A;  4NUV A;  4EB6 E;  2KWH A;  4LML A;  2XQ5 A;  4LFB T;  4E7S A;  3RRC A;  1FQI A;  5JDQ A;  3KIN B;  2LSG A;  3RGL A;  4DUY T;  1SE7 A;  1HX8 A;  2VKO A;  2NTY A;  4UF0 B;  3RQW A;  2A2F X;  1MND A;  2IHB B;  2CPT A;  3FZK B;  4UV8 B;  4DV7 T;  3PE0 A;  2G0U A;  3V5U A;  2CE7 A;  3VRB A;  4KMC A;  3QB5 K;  3RRW A;  4X1K E;  2XAH B;  2LOS A;  1OED C;  3W15 B;  5IUX A;  3ZLI A;  1MMA A;  2J47 A;  2OJ4 A;  5AQP B;  2BBJ A;  3JAF A;  3RIU A;  1XNR T;  3Q5X A;  5LBQ B;  4HFI A;  4F6R C;  2MOZ A;  3KV9 A;  3C51 A;  5BR8 T;  2FJA A;  3N5L A;  4QH5 A;  2CLY C;  3SRZ A;  2EHO B;  4TN7 B;  3ANW A;  3OVU A;  1XDP A;  2KSR A;  3I9W A;  4HWH A;  2L3L A;  5DQV A;  4KI0 F;  2LT3 A;  2VK9 A;  4Q25 A;  3AE9 A;  2C5K T;  5HYA A;  1O3X A;  1IJ6 A;  4ZEY A;  3C4X A;  3ZMU B;  4K0K T;  4C91 A;  3AE6 A;  4MHC A;  1T98 A;  4U2Y A;  3J9X 1;  2NP9 A;  2VKJ A;  3LK3 B;  2Z6E A;  2WDV A;  2E5L T;  2BDE A;  1MIW A;  5HXE A;  3KV4 A;  3PJA J;  2WB5 A;  3UU6 A;  2WDR A;  3TLS A;  2FJE A;  2JQ9 A;  4OK0 A;  4ZI2 D;  5LOV E;  3FZF B;  4EXT A;  2X9X A;  4QX8 B;  3AEB A;  2MAW A;  2IHR 1;  5JH7 E;  5LNK A;  3B13 A;  5AQM B;  2WY2 A;  4LF6 T;  2PJQ A;  2HPL A;  3AE8 A;  3GN5 A;  4DV6 T;  2CEA A;  2CWY A;  4KX6 A;  3KBT A;  4A56 A;  2C5I T;  4CN4 A;  2NW8 A;  1T7S A;  4OYK A;  2E9X A;  2XUE A;  4DVD A;  1N36 T;  4A97 A;  4A5X A;  1MMG A;  1B7T A;  4GK5 E;  1IAP A;  5F5W A;  4IL9 A;  3CIK A;  5HEO A;  4TWF A;  1IBL T;  5A1L A;  2WM9 A;  2B76 A;  3RQU A;  4JEU B;  2WMN A;  1X9B A;  4PNK A;  4JBW F;  1J5W A;  4LMK A;  5AQK B;  2VL8 A;  5HCM A;  2LJL A;  1MMD A;  2NOX A;  4PW8 A;  2XQ9 A;  4LF9 T;  2KLQ A;  1KNR A;  4YTM A;  2A3D A;  4Z90 A;  2HHH T;  2LHR A;  5HE0 A;  1ZOY A;  2JQK A;  5FY0 A;  4AKI A;  5TAO A;  3CX6 B;  2W62 A;  5LXT E;  4O2A E;  2UXC T;  2VAS A;  3PU8 A;  3RIF A;  3RYI E;  3FZL B;  2YKS A;  3NRX A;  5HEH A;  2E9X D;  2XQY A;  3O1H A;  3X1D A;  4XZC A;  2XQ6 A;  3FZM B;  5AQF B;  4BJM A;  2LHN A;  4HWD A;  2JMK A;  2OLT A;  2DHR A;  3O9X A;  3IF8 B;  2I0M A;  4QH1 A;  1FQJ B;  2BG9 A;  2Q9Q C;  5HAX A;  1NEN A;  3C4Z A;  1HTJ F;  3EVY A;  5IYZ E;  1VCS A;  3AB3 B;  5LB7 B;  2XQ3 A;  4B6X A;  5JVD E;  2FJB A;  4YY3 T;  5DO9 B;  5HE2 A;  2K24 A;  3UQ7 A;  2LKH A;  4DBQ A;  3RKO A;  2Y48 B;  5LMU T;  4H63 H;  5JDF A;  3VKH A;  4CXX A;  3AEC A;  1GQE A;  1T72 A;  4TV8 E;  2X0H A;  3AVS A;  2D2S A;  3PUR A;  3ONL C;  3RIA A;  3BQK A;  3PV0 F;  3NKZ A;  1OED A;  3N2O A;  2GK9 A;  2AXD S;  2LRK A;  2JIW A;  4CXY A;  2AE9 A;  3RHW A;  2WQY A;  2WSS V;  2SPC A;  2NR4 A;  2UXX B;  2BG9 E;  4DV3 T;  1YXR A;  4P0B A;  3AED A;  4GKJ T;  4N78 D;  4JI8 T;  4TZ4 C;  5LJM A;  4HWC A;  4OYJ A;  3KBU A;  1OMW A;  4B3T T;  4Z8X A;  4UVC B;  2NWB A;  4CZZ B;  4AQG A;  2WZH A;  4FI5 A;  3PSC A;  2BG9 B;  5E0O A;  3PUX F;  5J1G A;  1E1H B;  3OTO T;  3AE5 A;  4YLH A;  5F8P A;  4JUY A;  3Q2M A;  2K5B B;  5AFU L;  4DR3 T;  3Q5W A;  5DJQ C;  4AXP A;  3I0O A;  2ODV A;  2R6G F;  1UK5 A;  2ZM6 T;  1OED E;  4YSZ A;  4KHZ F;  3P4S A;  4X5T A;  2D0T A;  3EDV A;  5HXC A;  1BR1 A;  3C4W A;  3T1H T;  4I4T E;  3G06 A;  1HNW T;  4IE7 A;  5HXS A;  1WRD A;  1OED B;  1N32 T;  2XY8 B;  4DMV A;  4ERR A;  4TNW A;  3O4X E;  2X0Y A;  5L3D B;  4JV5 T;  4IE5 A;  3UUN A;  4JI0 T;  5LGU B;  4TWH A;  5JDH A;  4IL4 A;  2VQE T;  4G2A A;  1G8X A;  4UF0 A;  3UZT A;  2D9D A;  2W61 A;  2D5U A;  1D0Z A;  1CUN A;  3KDS E;  4JEH B;  3ETV A;  4ZZB A;  2MYS A;  2BCJ A;  1WR0 A;  1N34 T;  3OJA A;  2BKO A;  3QB5 A;  3C50 A;  2CLY B;  3PUS A;  4YT0 A;  4HWF A;  1MIY A;  4DV2 T;  2KZ7 B;  3ZST A;  3CML A;  2IIU A;  3WI3 A; 
#chains in the Genus database with same CATH homology
 3NZQ A;  3OYX A;  3C51 A;  4QWN B;  3P8C D;  2PG8 A;  3N5L A;  2N9D A;  1FIO A;  2VB6 A;  2CLY C;  2E8I A;  3NRY A;  2EHO B;  2W63 A;  3QUJ A;  4KBM B;  3SRZ A;  2DNX A;  4GYR A;  4AKG A;  3MA9 A;  4TN7 B;  2CA5 A;  4O2B E;  1VRB A;  3ANW A;  4UEL A;  3RH3 A;  1UX5 A;  4L0R A;  2P9B A;  4WW0 A;  2CMR A;  2Y6X A;  4ILU A;  4EYY R;  3H3A A;  1H7C A;  1HCI A;  2DI4 A;  4O4H E;  4H63 V;  3I9W A;  4YJ3 E;  2XAS B;  4QXH B;  2RP4 A;  2NW7 A;  3D0T A;  2L3L A;  5DQV A;  2EHO C;  4H9N C;  2LT3 A;  4O4L E;  5LHI B;  3LG7 A;  5HWX A;  3RC3 A;  4QHO A;  2LM9 A;  5LGN B;  2VK9 A;  2KND A;  4WBO A;  3AA1 B;  4GIW A;  2C5K T;  1WYB A;  4MLK A;  2ZMA A;  3MAC A;  5HYA A;  4I50 E;  2H7V C;  5CA0 E;  1O3X A;  1LVF A;  1BR0 A;  3DTO A;  1IJ6 A;  3C4X A;  3QK6 A;  4YFS A;  3ZMU B;  4WNK A;  4C91 A;  2CXD A;  4MHC A;  1T98 A;  3ZEF B;  3MZK B;  3MXZ A;  5FYM A;  5C8Y E;  3J9X 1;  2XAJ B;  3LJC A;  3P7I A;  3FXD B;  2NP9 A;  2VKJ A;  4UEM A;  2BZB A;  4UVA B;  3F2E A;  3CQX C;  3LK3 B;  2Z6E A;  2XHE B;  4TV9 E;  5L3C B;  4BA9 A;  2BDE A;  1MIW A;  2LEH A;  5HXE A;  3KV4 A;  4P0A A;  3GN5 B;  1MIV A;  3UUM A;  2X67 A;  3ZYM A;  3L3P A;  4HFV A;  3LK2 B;  2QGS A;  2WBL A;  4OK0 A;  4ZI2 D;  3SOL A;  3RPU A;  1FMV A;  4OFZ A;  3WAK A;  4HEA A;  4UIG A;  1AJ3 A;  3DJB A;  3MJX A;  5LOV E;  3NZP A;  2CM0 A;  2E9X B;  2V7M A;  4EXT A;  2VKH A;  4ADZ A;  1WYC A;  1MMN A;  4UV9 B;  1U4Q A;  3IBP A;  2X9X A;  4BJN A;  3LK4 2;  3ZN0 B;  4QX8 B;  5JR9 A;  4MFR A;  4UXN B;  5FXX A;  1OXZ A;  4IDZ A;  5JH7 E;  3FXE B;  5LNK A;  1NAF A;  3B13 A;  1LKX A;  3BQI A;  3GA8 A;  4O8S A;  3KVB A;  4I55 E;  2PJQ A;  5LG4 A;  2JJ9 A;  4XBF B;  5JRC B;  3IEE A;  2M67 A;  2HPL A;  4U72 A;  2YK0 A;  4EOZ B;  2DCF A;  4TX5 A;  3GN5 A;  3QC9 A;  2OA5 A;  3F31 A;  5EK4 A;  2CEA A;  5LGT B;  2PFV A;  2LOP A;  2CWY A;  3ZPO A;  3KBT A;  4PAG A;  4A56 A;  3C64 A;  2C5I T;  2CCQ A;  3FHN A;  2NW8 A;  3GMI A;  4EAH A;  3EUH A;  4OYK A;  1QSD A;  4PNI A;  4HTE A;  2E9X A;  4H9R C;  3ETU A;  4PJJ A;  2XUE A;  4DVD A;  5JQG E;  5L2L A;  3IHR A;  1KNZ A;  2DWK A;  2J1D G;  2ODU A;  2PBI A;  1MMG A;  2VKD A;  5JDL A;  1B7T A;  4GK5 E;  3RX6 A;  1IAP A;  3CVR A;  1BR4 A;  2EHO D;  3I1A A;  2C5J A;  3C98 B;  4AKL A;  1HFA A;  5FY7 A;  1D0Y A;  3ESL A;  5JRC A;  3ZMV B;  3LBX A;  3VU7 H;  4X20 E;  4X1Y E;  2YU1 A;  5A1L A;  2WM9 A;  5JDG A;  5L3G B;  3RYF E;  4JEU B;  2LSK A;  2WMN A;  3AA6 B;  3GWH A;  3M65 A;  5M4Y A;  4IST A;  4CI2 B;  2VL8 A;  1YKH B;  3CX8 B;  5L3E B;  2LJL A;  1MMD A;  3U78 A;  3J7Y q;  2NTX A;  2KXP B;  3N2K E;  5LJN A;  4G63 A;  2NOX A;  3B57 A;  1G73 A;  2CXF A;  2DWG A;  2K48 A;  3AAE B;  5F3J A;  4PW8 A;  4EIW A;  4YHJ A;  2V7J A;  1WLX A;  3HKE E;  5ETW A;  1ZHC A;  1LVK A;  2ZLY A;  2KLQ A;  4QXB B;  2WWU A;  1BR2 A;  3HI2 A;  2A3D A;  2X68 A;  1U5P A;  2X0L B;  4HN9 A;  3N9Q A;  2LHR A;  3UUX B;  2X51 A;  4ZS3 A;  2H3R A;  5KMG P;  3VHL A;  3HR0 A;  5FY0 A;  4AKI A;  5TAO A;  3CX6 B;  3FB2 A;  3ZN1 B;  1LRZ A;  2W62 A;  5LXT E;  3BK9 A;  1YD8 G;  2KT9 A;  4PFO A;  2V1D B;  4O2A E;  5CA1 E;  5JR9 B;  3HL6 A;  5LA6 E;  3NBX X;  2VAS A;  3K3O A;  4NUU A;  4QXC B;  3PU8 A;  4YJ2 E;  4ZHQ E;  1D1B A;  2XTL A;  3RYI E;  4HGA A;  5FXW A;  2JQQ A;  3OBV E;  5GON E;  3NRX A;  5JDM A;  4EZ4 A;  2IW5 B;  2WMO A;  3PDY A;  2E9X D;  2KIN B;  2XQY A;  3O1H A;  2JMH A;  1OWA A;  3SS1 A;  2IC6 A;  4H9Q C;  4IHJ E;  4CXW A;  5DQW A;  5JR9 C;  3V5S A;  4XZC A;  2Q9Q B;  3Q9D A;  2I59 A;  3HA4 A;  5LCY A;  2V7I A;  1HG2 A;  5LP6 E;  4IE4 A;  2KWI B;  4BJM A;  2W0G A;  2LHN A;  2JMK A;  4V1A v;  5J2U E;  3PUA A;  2DHR A;  4IIJ E;  3O9X A;  3IF8 B;  5EK3 A;  3U3I A;  3AAI A;  1D1A A;  2YU2 A;  4AQF A;  3HKD E;  2Q9Q C;  5HAX A;  3WAJ A;  3K3N A;  3K8P C;  2YIN A;  4HE8 A;  4DND A;  2BVL A;  3C4Z A;  4GOU A;  1HTJ F;  1ZKE A;  2H7O A;  3EVY A;  5IYZ E;  3R6N A;  3AB3 B;  2XAG B;  4OHF A;  4H9P C;  5KX5 E;  2E9X C;  4UVB B;  3LBX B;  4B6X A;  5JVD E;  2N2N A;  2L9Q A;  1FEW A;  5CB4 E;  2KMF A;  3VKG A;  2K24 A;  2Q9Q A;  3N2G E;  2X9H A;  1SHZ C;  3KV6 A;  3A5X A;  3E08 A;  3ZMZ B;  4DBQ A;  5H6R B;  3ZCI A;  4IE0 A;  4PFP A;  2Y48 B;  1X79 A;  3RKO A;  4H63 H;  5JDF A;  2NW9 A;  3VKH A;  2RA1 A;  2LE8 A;  2XAQ B;  4GK0 E;  1FMW A;  4ZOL E;  3PU3 A;  2ES0 A;  4ISS A;  1YKE B;  2A72 A;  4CXX A;  1Z0P A;  4AKR B;  4TV8 E;  3BQL A;  5H6Q B;  1VOM A;  2L8K A;  3KV5 A;  3CX7 B;  5L3F B;  3AVS A;  4O4I E;  3L09 A;  5LHG B;  4ZS2 A;  2D2S A;  3ZJ1 A;  4ASK A;  5HWY A;  4P09 A;  3N9N A;  3PUR A;  3F57 A;  3MK7 C;  2CXL A;  3UFE A;  5ADX L;  5FXZ A;  1D0X A;  2WAU A;  3I5Q A;  4H9S E;  4CI1 B;  1Y64 B;  1KK7 A;  3AAA B;  2MTQ A;  3BQK A;  5JDN A;  2ZM8 A;  5IHY A;  4HKA A;  3K3Q C;  2GK9 A;  2V7K A;  3N2O A;  5FNV E;  1HS7 A;  5LBM A;  1D1C A;  3OYZ A;  4CXY A;  4MBQ A;  3RC8 A;  2WSS V;  2SPC A;  2LSJ A;  3R84 B;  2UXX B;  4ZI7 E;  3SWH A;  3N9O A;  4PJL A;  4P0B A;  2ZM2 A;  3N9P A;  4N78 D;  2Y8D A;  4TZ4 C;  5FP3 A;  2C0S A;  1MNE A;  1ZV4 X;  5LJM A;  3FBL A;  3JC6 D;  4PJN A;  2X9W A;  4IE6 A;  3ZC1 A;  3ZYL A;  2ZM0 A;  4OYJ A;  2BVM A;  3KBU A;  1S94 A;  4CQI A;  4EYU A;  3S4U A;  2HPJ A;  4Z8X A;  4UVC B;  4PK4 A;  5EZY E;  2NWB A;  4CZZ B;  4GYS A;  4AQG A;  1QUU A;  4FI5 A;  2Q9Q D;  3HKC E;  2JRK A;  4ZI3 C;  2IAK A;  5E0O A;  5HXH A;  4X1I E;  5J1G A;  3UT5 E;  5EK2 A;  5HXR A;  1E1H B;  4YLH A;  5DAB A;  4I43 B;  5F8P A;  2YEV C;  4JUY A;  3Q2M A;  1ZEE A;  2K5B B;  3T8O A;  3E22 E;  4PK5 A;  5AFU L;  2K9A A;  1V9D A;  2LSI A;  3Q5W A;  2X9Y A;  5DJQ C;  4U74 A;  3HKB E;  4AQF C;  3CQC B;  5LYJ E;  4L5G A;  2N1G A;  4AXP A;  3JC6 C;  5FXV A;  3I0O A;  2HH7 A;  3E0Z A;  1UX4 A;  5FMN A;  4PK6 A;  2EHO A;  2DLR A;  2ODV A;  4PJM A;  4NUV A;  4DO0 A;  4EB6 E;  2KWH A;  2X66 A;  3DP7 A;  4DBR A;  3LFM A;  4E7S A;  1EZ3 A;  2CWO A;  3RRC A;  2D0T A;  3EDV A;  4H9O C;  5KDM C;  4XAX B;  5JDQ A;  3KIN B;  2JPF A;  2LSG A;  3ONX A;  3ZYK A;  5HXC A;  1BR1 A;  1HF8 A;  3C4W A;  1US7 B;  1HX8 A;  2VKO A;  2NTY A;  4I4T E;  2ACX A;  4UF0 B;  4AKH A;  3I9Y A;  3I0Q A;  2A2F X;  3ZJ2 A;  4AI6 A;  1MND A;  3WI3 A;  3UUL A;  4MAL A;  1YW0 A;  4TUY E;  3CPZ A;  4UV8 B;  3PTR B;  3KFW X;  3OKQ A;  1IJ5 A;  1WRD A;  4IE7 A;  5HXS A;  3PE0 A;  4J2C A;  3EDU A;  3H37 A;  3RYH E;  5J2T E;  2G0U A;  2W00 A;  3PUQ A;  4FJO A;  3V5U A;  4CI3 B;  4DMV A;  4ERR A;  2CE7 A;  4KP3 C;  3O4X E;  4KMC A;  3TKL B;  3MKD A;  1WR6 A;  3UTK A;  5L3D B;  2IC9 A;  4E7Z A;  4KUM B;  4IE5 A;  3RRW A;  3UUN A;  3CQG B;  3AA7 B;  3O1I A;  5LGU B;  5LHH B;  4C90 A;  4X1K E;  5L3B B;  1SA0 E;  4QKN A;  5FY1 A;  2XAH B;  5JDH A;  4JLE A;  4ANJ A;  2LOS A;  3W15 B;  3PUG A;  4DMW A;  1UCU A;  4M1P A;  5JRE A;  3ZCJ A;  3ZC0 A;  4G2A A;  4WBN E;  2B1E A;  4O4J E;  2MBG A;  1G8X A;  4UF0 A;  4EZH A;  2V7L A;  2W61 A;  4ZI2 C;  2D5U A;  3ZLI A;  3RYC E;  1D0Z A;  1MMA A;  1CUN A;  3ZMT B;  3KDS E;  4BAY B;  4JEH B;  2UXN B;  1S35 A;  3ANW B;  3ETV A;  4IGU A;  2MYS A;  4K0U A;  3N9M A;  3KVA A;  1IZN B;  3CWZ B;  4L9I A;  1HG5 A;  3OJA A;  5BMV E;  2VWA A;  4QX7 B;  3N9L A;  2V26 A;  3C50 A;  4ZI3 D;  2CLY B;  3Q5X A;  3PUS A;  5LBQ B;  3AA0 B;  1NWM X;  1MIY A;  2LSY A;  4F6R C;  2KZ7 B;  3ZMS B;  2MOZ A;  3KV9 A;  3FBZ A;  2QA7 A;  3CML A;  3O1J A;  3CKD A;  2D0U A;  2XAF B;  3AVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...