3I5QA

Nup170(aa1253-1502) at 2.2 a, s.cerevisiae
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
248
Chain Sequence
IVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 83
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.20 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 3i5qA02
1.20.120.1050 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5qA01
3I5QA
chains in the Genus database with same CATH superfamily
3V7OA 3K1HA 3DWWA 3H2UA 1TR2A 2W4MA 2W45A 3DAFA 3LNRA 4LDQA 4NTFA 4OINF 3C7JA 2G3VA 3CSKA 3NYOA 1CGOA 4P9TA 4E17A 2W4BA 2LK4A 3UMKA 3K33A 3ZTMA 1OW7A 5K0IA 4QI2A 1EMUA 1MMAA 3EG9B 5B3IA 2QE9A 1LI7A 2OWIA 1CGNA 2GWWA 5D91A 2CNWA 5DVWA 3POVA 1WN0A 3DJNB 4JJGA 3V5YA 2QNLA 3HKKA 3QZCA 4U9DA 2HJMA 4RD9A 3NG1A 2ZPAA 3SZRA 2XSEA 2XS8A 4C3EA 2AVKA 1BDJB 3KMIA 4JC7A 2PX0A 1EKYA 4XLPF 2EIMC 3JZ0A 1B68A 2CCYA 2YLDA 4C7OB 3I4UA 3CAXA 2XLWA 3AQBA 1D0ZA 1HE1A 4AK9A 4H4KC 1TWHA 1GM5A 2J7PA 1M6TA 1W2WA 2J8WA 1FMVA 4HEAJ 3SXMA 3U2LA 1ORJA 4E0HA 2A0BA 2A6HF 3HJCA 4ZLDA 2R7UA 1AGRE 3EZIA 1HW2A 1YARO 3DE8A 3X2QC 3NRHA 1T5OA 1FFTC 3M4BA 3SNHA 1SF8A 1YAUO 2EPNA 3HLZA 4AE4B 4CDYA 1EA8A 3C63A 3LEVA 1WTYA 2L6GA 2OJ4A 4KI2A 2IXNA 3ZTZA 5IY5C 5L0IA 4PACA 1Z7Qc 1DOWA 1ZYRF 1TKNA 1Q0KA 1GGQA 3AGTA 1YJGA 5BQHA 5A6JA 4Q4ZF 1ZHWA 3BRJA 3RVZA 3LESA 5DS4A 1QKRA 1AVOB 2RD9A 4CS9C 1JPJA 3RH3A 5KYXA 4K7BA 4MVZA 3X1OA 3U9JA 3WHNA 3ZQYA 2G3KA 3KPHA 3DXJF 5KYUA 2IXMA 2NSGA 3TK0A 5E3AA 1D0YA 4G7OF 2A1DD 4LERA 2E87A 4FX5A 4CBEA 4JE9A 1JMWA 5A6KA 2R7RA 3C8GB 1FR0A 4WGZA 2TMVP 2Q4FA 4XEFA 3CZ6A 1TQGA 2OU6A 2EBZA 3FMSA 4KNWA 2GAQA 3US6A 4MQ9F 3SP1A 1RJ9A 4PJLA 1RKEA 2YL1A 3DI5A 5JRAA 2GTPC 1PD1A 2LFFA 2LFDA 5T3WA 1HMOA 1EZYA 3EGDA 2HUJA 2ETSA 2OCCC 2P1AA 3LUTB 4NY3A 4CS7A 1PV3A 3F47A 4R32A 3M15A 4CSAC 2OEVA 3A9CA 3NMKA 2Y3BA 2X0CA 2V26A 3C8GD 5KYXB 3J06A 4P9FA 3V5WA 2NUPB 2R7OA 3PHF2 4GEHA 3UZTA 2H8AA 2ZXOA 4JURI 4O6YA 3TJ6A 1JR8A 3JT1A 4C3BA 1C03A 2C03A 3FAPB 2CYDA 2QUPA 2EINC 1Q0FA 2H7BA 1L7CA 2HSQA 5B1BC 1WWPA 2DGJA 3S27A 1MMNA 3QW1A 1ORYA 4HE8D 4BJ5C 1NBBA 2Q00A 1WATA 5L0HA 3UNGC 2NPUA 3GORA 4JTDB 1OKKD 2CW0F 3U8PA 3UR3C 2WVNA 2Q7RA 3NDBB 4FESA 3DM5A 1QZXA 3E9VA 2GA0A 2HMZA 2R7TA 4N6CA 4NTBA 4JEBA 2Q9AA 1FAPB 1D0XA 3IQ5A 4BJTA 2R7WA 2FAPB 2FFHA 4Q5SF 3KRXA 4MTGA 4YT4A 1G8XA 2VH3A 3OWTA 3ZQVA 1AEPA 3T9OA 4ONSA 1ZHZA 2MWQA 3U0CA 4Q7CA 3FDQA 4BJ6C 1NFOA 2AP3A 1NFNA 1DOVA 1QLEC 2KYHA 2EPOA 2YLIA 3LEOA 2XL4A 2LQGA 1A7DA 2CNWD 2GFHA 3JYYA 3M79A 1Z3IX 4O6MA 4DVYP 4YT2A 2PNOA 3GM1A 4JCZA 2HZ8A 4ULWA 4WGYA 3ABKC 2KK1A 3DAGA 5COGA 1NU9C 1V55C 1NLXA 2Y3DA 3MBGA 2O9XA 2VCAA 2R25A 4PJJA 5E3CA 5JT4A 4DRHB 1ORSC 2R7QA 3LS1A 1O5HA 1LS4A 3TD7A 1YA7O 3RQFA 4U5FE 1Z6AA 5JLIA 4PFPA 1FQIA 2R7VA 2HFIA 3RYLA 2HSBA 1IZMA 2WZGA 5E33A 2J7PD 1G4WR 2LP4A 1T01A 2Y3GA 5CIVA 2XLEA 2WZLA 3EZHA 4J32B 3LAYA 4DOZA 2EIJC 4CX9A 3ABLC 4EBKA 1E83A 4P6IC 5D92A 3AG4C 2ZXPA 3HNLA 3K7DA 3ZIBA 5KYYA 2XLMA 1Q0DA 3ASOC 4O7GA 2EILC 3W2WA 5DQTA 1O3UA 2Y69C 3AG2C 3DE9A 5BQIA 3ITFA 2XS1A 1A7VA 2L9JA 4W8PA 3MYIA 3ZDLA 2KC3A 4BG0A 1M2VB 2OJED 1GS9A 1H7IA 4E18A 2ZXRA 3GM2A 4OD4A 2YZSA 3WG7C 1K04A 4LLCA 4WJ0A 1XZQA 1CGME 4OIOF 2PFDA 4F4BA 2BC5A 1A7EA 1A41A 2B0JA 4C3DA 1RJ9B 1WASA 3QMKA 4H54A 1ZVZA 4DRIB 2R03A 3JYHA 4I1OB 1RKEB 2WVQA 2EPMX 4KBLA 5F28E 5HE2A 4YJWA 2R7XA 4JZAA 2BCJA 1MMDA 3EGDB 4MK0A 3JRTA 3QVYA 1RKCA 5DQZA 1U6HA 4ZLCA 4N06A 2G62A 3RKOF 4B6IA 1YLMA 1ZHYA 256BA 2CGEA 5CI9A 3EFOA 1NU7D 2BE5F 2Q3TA 5EK0A 3I5PA 5L0GA 3JSEO 5L0FA 3PDMP 1I4ZA 2XM0A 1H9TA 1VLTA 3CIKA 1APCA 3HNIA 4QDLA 3EH2A 4LACB 3EGXA 3VF0A 2KQ9A 4DRJB 1BBHA 5DS6A 2M64A 1J8YF 2IK8B 4G7HF 4MVRA 5T3TA 3RQEA 5T1DB 1C17M 3DZAA 3F46A 4CS9A 5JS5A 1T9KA 3GEHA 2OEXA 2XL6A 4G7ZF 3KL4A 1YYJA 4PJNA 1T6QA 3O10A 3V5XA 4DJ9A 1KU2A 4KNVA 3L1MA 3QTHA 4CJOA 1PD0A 5L0JA 1Q0GA 1RCPA 4CJGA 1UFBA 1FMWA 1GQAA 4YWQA 2AF0A 3U8VA 1J8MF 1WOLA 3RVYA 4EKWA 1A0BA 4N4WA 4NTAA 1KTMA 4JEAA 3LS0A 1VTMP 4RDAA 1H6GA 2WB7A 4PFOA 2CDQA 2ZD9A 2J45A 3G4ZA 5L0DA 2BV1A 2VCCA 4MVSA 1SYQA 4MVUA 1E85A 3FXHA 2HV7A 2L81A 2NSFA 4IARA 5F5HA 4FAPB 4CSAA 3HNKA 2I15A 4HTEA 3S0XA 1CPRA 1FQJB 4MW3A 2M4EA 3Q7LA 1PCXA 2XLDA 2F22A 3W8HA 3DMDA 2PP4A 4GYTA 1QVXA 2JX0A 3T6JA 2UUHA 1SR2A 2YHSA 3T6BA 3PVUA 5DO9B 3O6XA 3HNJA 3U3FA 3ECSA 1NZEA 3SXZA 5COMA 2DB4A 5L3QA 3KYIA 3ZG1A 4PNKA 1T6UA 1I4YA 1TWCA 3VAYA 4CDVA 1OCCC 5A6BA 3ATPA 1OR3A 4OD5A 4E0IA 1M57C 1VK5A 2J46A 3GEIA 1VYIA 3JTLO 4U9EA 4YN0B 1S7ZA 3CQZA 4JTCB 3K6BA 4C7OA 4NC3A 1LM3B 1M2OA 3IQCA 5KYYB 3L34A 2P0NA 3DM9B 1Y6DA 3L8IA 4XWJA 3GODA 5HE1A 3MFNA 5AGFA 1FNTc 2HKVA 2YL3A 2VB6A 3BEHA 4IRUA 4BJ6A 3ZC4A 4LLEA 2YRFA 1Z63A 4AX2A 4ANJA 5JSLA 4N6HA 2MHRA 3L0IA 3IEEA 4EBJA 3C8ZA 3VM6A 5FCLA 1LVKA 1V74B 3EJNA 1FTSA 3ZWIA 5HE0A 3AJMA 1OMWA 5COFA 2Z15A 2LCHA 3U3BA 3C7KB 3T6GB 3EPVA 1E86A 3S28A 3DKAA 4U5CE 5B1AC 4FWVA 1BZ4A 3WODF 3GM3A 3B0UX 4EIYA 2VC9A 5HE3A 1VOMA 2D5RB 2EPKX 3NMIA 4BEJA 2A68F 1XWJA 5HV9A 3M4CA 4CS8C 3TOMA 3GANA 3O55A 5HSWA 1OCRC 1K40A 3E70C 3EFOB 5KYWA 4MVQA 1LPEA 3K1IC 3LLKA 5JVEA 2XLHA 3C18A 2DLVA 4PR9A 1LKXA 1NG1A 1OCZC 2A69F 2AU5A 2JPUA 3EGXB 4J7TA 3RF3A 3Q6NA 1UG7A 2ASRA 2IM8A 4J30B 2HS5A 4Z9HA 1G5ZA 4HFFB 4Z9JA 3RIPA 1LI5A 4IAQA 3W2VA 4A2NB 2IYLD 3NYJA 1QSPA 3UMHA 3S84A 4OIPF 2YLGA 1JPNA 1Q0MA 4MVOA 4XPWA 3GEEA 4EKDB 3PCVA 1D1BA 2EIKC 5A6AA 2R7SA 3SYNA 3TJ5A 2P6VA 4IAOA 4BEMJ 1H9GA 3U5SA 2XM4A 1S05A 1AUEA 3QW0A 3TQOA 2XL8A 4CIHA 1Z5ZA 2D4UA 3NMJA 4D4XA 1TWGA 5KYUB 4W8KA 2IXPA 4MTOA 5BQGA 1QQ3A 1HE9A 4XQ1A 4EBBA 1V4AA 2D9JA 2KJGA 2NUTA 1KNYA 1R5ID 3NYMA 4JCHA 2OQMA 1EI7A 3C62A 3IQ6A 3NYLA 3Q6MA 2HJ3A 5FZTA 3U9MA 2J0XA 4EUKB 2DYSC 3HTKC 5DLJA 3FAJA 3IQTA 4G78A 2I8BA 5TJ5E 1VLSA 1LS1A 2Q9BA 5KYNA 1OW6A 3T4RA 4OIRF 1OXBA 4BPMA 3L8JA 4NQFA 2YQYA 1OR2A 2V4ZB 3B29A 3H2VA 2HV6A 1CMZA 1HW1A 4L6RA 4O79A 3PVWA 3S29A 3FHDA 3KH2A 3O39A 1SMYF 2IHBB 1BR2A 1FFHA 2PX3A 4RBNA 5AC5A 2JM5A 5DS5A 1VMAA 2IBFA 1BR4A 3EHNA 3MLGA 4TNDA 2DYRC 3NKDA 4K0DA 3AG3C 2XXAA 1FQKB 1LE2A 1Y4CA 2OG2A 2YL0A 3FOOA 3EQLF 4J7YA 4PJMA 1U0BB 3GWLA 3UMIA 3PSCA 4WABA 2PBEA 5CI8A 1IW7F 1EQ1A 2EPLX 2ODEB 2J0WA 3CEXA 2J9BA 1CPQA 3LNMB 5L0CA 2XLOA 1MQVA 1O87A 3Q7GA 1LE4A 4JRZA 4YL1A 1I5NA 2VCBA 3JRMO 2QTVA 3LJBA 4GQHA 5F5FA 2L6FA 2YVKA 4IB4A 1WGWA 3UGPA 3MX3A 2IHDA 4I1MA 4U5HA 1G4US 3B0PA 1TFOB 3GWNA 3K66A 4X0RA 5A6BD 1Z23A 2L6HA 4QI0A 3N0TA 3RQGA 4U5DE 3H65A 3W8IA 4YT5A 3KKBA 2IOQA 2B0HA 3JSZA 4JIOA 1YZAA 3TULA 1TFKB 1OQCA 2FGYA 1D1CA 4DBRA 2LIGA 4Z9IA 2H7VC 3V5ZA 3ABMC 1JRAA 5JP7A 2OKUA 1BR1A 2QLAA 4AL1A 5KYWB 3RFYA 4A4AA 3EG9A 4TNBA 2P61A 2PF4E 1MNEA 4MW8A 5GPGB 4EWCA 1ST6A 2LD6A 1OXKA 3G4XA 3NYNA 4XPXA 4U5GA 4O6NA 4DVZA 4YL3A 2QY9A 1M2VA 4BJ5A 2WL8A 3EHMA 2JNUA 3C7LA 1OCOC 2VASA 3B9QA 1T6IA 4JJFA 3QVZA 2YWAA 2Y39A 3VYWA 3WAQA 5B3SC 4MVMA 1YA9A 2R9RB 2AWYA 3TOLA 2W9YA 2XRHA 3W4YA 1HMDA 1C02A 2XLVA 4MNDA 4DBQA 1DK8A 3AOUA 2KGOA 4IJJA 2MYSA 2KW3C 4JTAB 2GDCA 4CIPA 2ZXWC 3MYFA 3IPMO 2X51A 2R02A 4XLNF 3IHUA 5EGYA 4UDVA 4JKVA 5AC4A 1N1CA 3ASNC 4U5BE 2NUTB 2ICWG 2LSEA 1ZU4A 2OOCA 1L3PA 1VB5A 3SXKA 3LLIA 3N2ZB 2BL2A 3AG1C 1M56C 2AWCA 4D4NA 2KSFA 2DI3A 3S90A 3VRCA 4AE4A 3NKEA 4IGGA 3R2PA 5L3VA 2H7OA 3DD7A 4HFKB 1OW8A 4MS2A 1ZW2A 4CS8A 3B0VC 2J9WA 5JUAA 1XZPA 2IXOA 3SXYA 1R4TA 4I3MA 1VYKA 5E2QA 1YVIA 5EHHA 1LIHA 1RXQA 2A0UA 1MMGA 3AQCA 2CRPA 3K1IA 3OA1A 3OEOA 4DXWA 1D1AA 1NSGB 1TWAA 3KYJA 2OJQA 1ZW3A 3FOPA 1YZCA 4LDKA 4AL0A 3B71A 4U5EE 4NCQA 4PK4A 4JW1A 4K1OA 3SEOA 4OIQF 1JOGA 2Q9CA 4LDRA 1ZU5A 2WVOA 3U2MA 2J9UA 5A69A 3A11A 2UUIA 1HY5A 2J9VA 4MTFA 2XXAB 1SZIA 4XPYA 1E84A 1RMVA 2R05A 2WZFA 4XTKA 2KNHA 2Y3HA 2V3CC 4EHPA 4I44A 3C8GA 4IWBA 1YYXA 2BT2A 3AGUA 4KC9A 1JAFA 3G50A 3N24A 3RW0A 3M1CB 4BJ1A 3ZSUA 1ZHXA 2JD3A 2A6EF 2NG1A 1ZZPA 1U89A 3EH1A 3JCUQ 2C04A 4JVSA 4ULVA 1MNDA 4XEKA 4YT8A 1QPUA 5BUOA 3I5QA 2HMQA 4CDAA 4YK5A 1YDIA 2RSEB 1E2XA 1F1MA 2YEVA 3KRWA 2YKZA 3FVYA 4M63A 1V54C 1OKKA 4XEVA 3ZVRA 4YL0A 3R7CA 3S9OA 1EZTA 1K05A 1ZHTA 3DJUB 2YL7A 4ER9A 2L7AA 3PMRA 4G0HA 4E7SA 2P7VA 4E7ZA 3UGOA 2NUPA
chains in the Genus database with same CATH topology
3V7OA 3K1HA 1TR2A 2W4MA 2W45A 3DAFA 3LNRA 4OINF 2G3VA 3CSKA 2W4BA 3UMKA 3K33A 4QI2A 1MMAA 3EG9B 5D91A 5DVWA 2CNWA 3DJNB 4JJGA 3QZCA 4RD9A 3NG1A 2ZPAA 3SZRA 2XSEA 4C3EA 3KMIA 2PX0A 4XLPF 2EIMC 4C7OB 3I4UA 3AQBA 1D0ZA 4AK9A 4H4KC 1TWHA 2J7PA 1W2WA 4HEAJ 1FMVA 2A6HF 3HJCA 4ZLDA 2R7UA 3EZIA 3X2QC 3NRHA 3SNHA 1FFTC 4AE4B 1SF8A 3HLZA 3LEVA 4KI2A 2IXNA 5IY5C 1ZYRF 1TKNA 4Q4ZF 1ZHWA 3LESA 5DS4A 4CS9C 1JPJA 3RH3A 4K7BA 3X1OA 2G3KA 5KYUA 3DXJF 2IXMA 5E3AA 1D0YA 2A1DD 4LERA 2E87A 4FX5A 4CBEA 2R7RA 3CZ6A 4KNWA 4MQ9F 3SP1A 1RJ9A 4PJLA 1PD1A 5T3WA 3EGDA 2OCCC 4NY3A 4CS7A 3F47A 4CSAC 2Y3BA 2V26A 5KYXB 2NUPB 2R7OA 3PHF2 4GEHA 4JURI 2ZXOA 4O6YA 4C3BA 3JT1A 2C03A 2EINC 2H7BA 5B1BC 2DGJA 3S27A 1MMNA 4HE8D 4BJ5C 3UNGC 3UR3C 1OKKD 2CW0F 3NDBB 2WVNA 4FESA 3DM5A 1QZXA 3E9VA 2R7TA 2Q9AA 1D0XA 4BJTA 2FFHA 4YT4A 1G8XA 2VH3A 3OWTA 1ZHZA 2MWQA 4Q7CA 3FDQA 4BJ6C 1QLEC 2XL4A 2CNWD 2GFHA 4O6MA 4DVYP 1Z3IX 4YT2A 4ULWA 3ABKC 3DAGA 1NU9C 1V55C 2Y3DA 2O9XA 4PJJA 5E3CA 2R7QA 3LS1A 1O5HA 3TD7A 4U5FE 1Z6AA 2R7VA 4PFPA 3RYLA 1IZMA 2WZGA 5E33A 2J7PD 2Y3GA 4J32B 2WZLA 3EZHA 4DOZA 3LAYA 2EIJC 3ABLC 4P6IC 5D92A 3AG4C 2ZXPA 3K7DA 3ZIBA 5KYYA 3ASOC 4O7GA 2EILC 3W2WA 5DQTA 2Y69C 3AG2C 3ITFA 2L9JA 4BG0A 1M2VB 2ZXRA 4OD4A 2YZSA 3WG7C 4LLCA 4WJ0A 4OIOF 2PFDA 4F4BA 2B0JA 4C3DA 1RJ9B 3QMKA 3JYHA 4I1OB 2WVQA 4KBLA 2R7XA 4YJWA 4JZAA 1MMDA 3EGDB 3JRTA 5DQZA 4ZLCA 4N06A 2G62A 3RKOF 4B6IA 1ZHYA 2CGEA 5CI9A 3EFOA 1NU7D 2BE5F 2Q3TA 5F5FA 3I5PA 4QDLA 3EH2A 4LACB 3EGXA 4G7HF 2KQ9A 4Q5SF 5DS6A 1J8YF 5T3TA 5T1DB 3DZAA 3F46A 4CS9A 4G7ZF 3KL4A 4PJNA 1KU2A 4KNVA 1PD0A 4YWQA 1FMWA 1J8MF 3LS0A 4RDAA 2WB7A 4PFOA 2CDQA 2J45A 2HV7A 2L81A 5F5HA 4CSAA 3S0XA 4HTEA 2M4EA 3Q7LA 1PCXA 3W8HA 3DMDA 2PP4A 4GYTA 3T6JA 2YHSA 3T6BA 3O6XA 3ECSA 1NZEA 5L3QA 3ZG1A 3VAYA 1TWCA 1OCCC 4OD5A 1M57C 1VK5A 2J46A 1VYIA 4YN0B 1S7ZA 3CQZA 4C7OA 3K6BA 1M2OA 5KYYB 3L34A 3DM9B 4XWJA 3GODA 4BJ6A 2VB6A 4IRUA 3ZC4A 4LLEA 1Z63A 4AX2A 4ANJA 3L0IA 3IEEA 5FCLA 1LVKA 3EJNA 1FTSA 2Z15A 3EPVA 3S28A 4U5CE 5B1AC 4FWVA 3WODF 3B0UX 2D5RB 1VOMA 4BEJA 2A68F 4CS8C 3GANA 5HSWA 1OCRC 3E70C 3EFOB 5KYWA 3K1IC 3LLKA 1LKXA 1NG1A 1OCZC 2A69F 3EGXB 3Q6NA 4J30B 3RIPA 4HFFB 3W2VA 4A2NB 2IYLD 3NYJA 3UMHA 4OIPF 1JPNA 1D1BA 2EIKC 2R7SA 3SYNA 2P6VA 4IAOA 4CIHA 1Z5ZA 5KYUB 1TWGA 4W8KA 2IXPA 4EBBA 2KJGA 2NUTA 3NYMA 4JCHA 3Q6MA 3NYLA 2R7WA 2J0XA 2DYSC 3HTKC 5DLJA 3FAJA 2I8BA 1LS1A 2Q9BA 5KYNA 3T4RA 4OIRF 4O79A 2HV6A 3S29A 3FHDA 3KH2A 3O39A 1SMYF 1BR2A 1FFHA 2PX3A 4RBNA 5DS5A 1VMAA 3NKDA 1BR4A 3MLGA 3EHNA 2DYRC 4K0DA 3AG3C 2XXAA 2OG2A 3EQLF 4PJMA 3UMIA 5CI8A 1IW7F 2J0WA 1O87A 3Q7GA 3LJBA 2QTVA 1WGWA 3UGPA 3MX3A 4I1MA 4U5HA 3B0PA 3K66A 4X0RA 1Z23A 4QI0A 3N0TA 4U5DE 3H65A 3W8IA 4YT5A 3KKBA 2IOQA 3JSZA 2FGYA 1D1CA 4DBRA 2H7VC 3ABMC 1BR1A 5KYWB 3RFYA 3EG9A 2PF4E 1MNEA 4EWCA 1ST6A 4U5GA 4O6NA 4DVZA 2QY9A 1M2VA 4BJ5A 2WL8A 3EHMA 4JJFA 1OCOC 2VASA 3B9QA 3VYWA 2Y39A 5B3SC 2W9YA 2XRHA 4MNDA 4DBQA 2KGOA 4IJJA 2MYSA 2KW3C 2ZXWC 2X51A 4XLNF 5EGYA 1N1CA 3ASNC 4U5BE 2NUTB 2LSEA 1ZU4A 4G7OF 3LLIA 3N2ZB 3AG1C 1M56C 4AE4A 3NKEA 5L3VA 2H7OA 3DD7A 4HFKB 4CS8A 3B0VC 2J9WA 2IXOA 5E2QA 4I3MA 1VYKA 5EHHA 3AQCA 3OA1A 1MMGA 3OEOA 1D1AA 1TWAA 4U5EE 4PK4A 4JW1A 3SEOA 4OIQF 2Q9CA 1ZU5A 2WVOA 2J9UA 2J9VA 2XXAB 1SZIA 2WZFA 4XTKA 2KNHA 2Y3HA 2V3CC 4I44A 4IWBA 4KC9A 3N24A 3M1CB 4BJ1A 3ZSUA 1ZHXA 2JD3A 2A6EF 2NG1A 3JCUQ 3EH1A 4JVSA 4YT8A 2C04A 3POVA 1MNDA 5BUOA 3I5QA 2YEVA 3FVYA 4M63A 1V54C 1OKKA 3ZVRA 1ZHTA 3DJUB 4E7SA 4E7ZA 3PMRA 4G0HA 3UGOA 2P7VA 5KYXA 2NUPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5Q A; 
#chains in the Genus database with same CATH topology
 3V7O A;  3K1H A;  3DWW A;  3H2U A;  1TR2 A;  2W4M A;  2W45 A;  3DAF A;  3LNR A;  4LDQ A;  4NTF A;  4OIN F;  3C7J A;  2G3V A;  3CSK A;  3NYO A;  1CGO A;  4P9T A;  4E17 A;  2W4B A;  2LK4 A;  3UMK A;  3K33 A;  3ZTM A;  1OW7 A;  5K0I A;  4QI2 A;  1EMU A;  1MMA A;  3EG9 B;  5B3I A;  2QE9 A;  1LI7 A;  2OWI A;  1CGN A;  2GWW A;  5D91 A;  2CNW A;  5DVW A;  3POV A;  1WN0 A;  3DJN B;  4JJG A;  3V5Y A;  2QNL A;  3HKK A;  3QZC A;  4U9D A;  2HJM A;  4RD9 A;  3NG1 A;  2ZPA A;  3SZR A;  2XSE A;  2XS8 A;  4C3E A;  2AVK A;  1BDJ B;  3KMI A;  4JC7 A;  2PX0 A;  1EKY A;  4XLP F;  2EIM C;  3JZ0 A;  1B68 A;  2CCY A;  2YLD A;  4C7O B;  3I4U A;  3CAX A;  2XLW A;  3AQB A;  1D0Z A;  1HE1 A;  4AK9 A;  4H4K C;  1TWH A;  1GM5 A;  2J7P A;  1M6T A;  1W2W A;  2J8W A;  1FMV A;  4HEA J;  3SXM A;  3U2L A;  1ORJ A;  4E0H A;  2A0B A;  2A6H F;  3HJC A;  4ZLD A;  2R7U A;  1AGR E;  3EZI A;  1HW2 A;  1YAR O;  3DE8 A;  3X2Q C;  3NRH A;  1T5O A;  1FFT C;  3M4B A;  3SNH A;  1SF8 A;  1YAU O;  2EPN A;  3HLZ A;  4AE4 B;  4CDY A;  1EA8 A;  3C63 A;  3LEV A;  1WTY A;  2L6G A;  2OJ4 A;  4KI2 A;  2IXN A;  3ZTZ A;  5IY5 C;  5L0I A;  4PAC A;  1Z7Q c;  1DOW A;  1ZYR F;  1TKN A;  1Q0K A;  1GGQ A;  3AGT A;  1YJG A;  5BQH A;  5A6J A;  4Q4Z F;  1ZHW A;  3BRJ A;  3RVZ A;  3LES A;  5DS4 A;  1QKR A;  1AVO B;  2RD9 A;  4CS9 C;  1JPJ A;  3RH3 A;  5KYX A;  4K7B A;  4MVZ A;  3X1O A;  3U9J A;  3WHN A;  3ZQY A;  2G3K A;  3KPH A;  3DXJ F;  5KYU A;  2IXM A;  2NSG A;  3TK0 A;  5E3A A;  1D0Y A;  4G7O F;  2A1D D;  4LER A;  2E87 A;  4FX5 A;  4CBE A;  4JE9 A;  1JMW A;  5A6K A;  2R7R A;  3C8G B;  1FR0 A;  4WGZ A;  2TMV P;  2Q4F A;  4XEF A;  3CZ6 A;  1TQG A;  2OU6 A;  2EBZ A;  3FMS A;  4KNW A;  2GAQ A;  3US6 A;  4MQ9 F;  3SP1 A;  1RJ9 A;  4PJL A;  1RKE A;  2YL1 A;  3DI5 A;  5JRA A;  2GTP C;  1PD1 A;  2LFF A;  2LFD A;  5T3W A;  1HMO A;  1EZY A;  3EGD A;  2HUJ A;  2ETS A;  2OCC C;  2P1A A;  3LUT B;  4NY3 A;  4CS7 A;  1PV3 A;  3F47 A;  4R32 A;  3M15 A;  4CSA C;  2OEV A;  3A9C A;  3NMK A;  2Y3B A;  2X0C A;  2V26 A;  3C8G D;  5KYX B;  3J06 A;  4P9F A;  3V5W A;  2NUP B;  2R7O A;  3PHF 2;  4GEH A;  3UZT A;  2H8A A;  2ZXO A;  4JUR I;  4O6Y A;  3TJ6 A;  1JR8 A;  3JT1 A;  4C3B A;  1C03 A;  2C03 A;  3FAP B;  2CYD A;  2QUP A;  2EIN C;  1Q0F A;  2H7B A;  1L7C A;  2HSQ A;  5B1B C;  1WWP A;  2DGJ A;  3S27 A;  1MMN A;  3QW1 A;  1ORY A;  4HE8 D;  4BJ5 C;  1NBB A;  2Q00 A;  1WAT A;  5L0H A;  3UNG C;  2NPU A;  3GOR A;  4JTD B;  1OKK D;  2CW0 F;  3U8P A;  3UR3 C;  2WVN A;  2Q7R A;  3NDB B;  4FES A;  3DM5 A;  1QZX A;  3E9V A;  2GA0 A;  2HMZ A;  2R7T A;  4N6C A;  4NTB A;  4JEB A;  2Q9A A;  1FAP B;  1D0X A;  3IQ5 A;  4BJT A;  2R7W A;  2FAP B;  2FFH A;  4Q5S F;  3KRX A;  4MTG A;  4YT4 A;  1G8X A;  2VH3 A;  3OWT A;  3ZQV A;  1AEP A;  3T9O A;  4ONS A;  1ZHZ A;  2MWQ A;  3U0C A;  4Q7C A;  3FDQ A;  4BJ6 C;  1NFO A;  2AP3 A;  1NFN A;  1DOV A;  1QLE C;  2KYH A;  2EPO A;  2YLI A;  3LEO A;  2XL4 A;  2LQG A;  1A7D A;  2CNW D;  2GFH A;  3JYY A;  3M79 A;  1Z3I X;  4O6M A;  4DVY P;  4YT2 A;  2PNO A;  3GM1 A;  4JCZ A;  2HZ8 A;  4ULW A;  4WGY A;  3ABK C;  2KK1 A;  3DAG A;  5COG A;  1NU9 C;  1V55 C;  1NLX A;  2Y3D A;  3MBG A;  2O9X A;  2VCA A;  2R25 A;  4PJJ A;  5E3C A;  5JT4 A;  4DRH B;  1ORS C;  2R7Q A;  3LS1 A;  1O5H A;  1LS4 A;  3TD7 A;  1YA7 O;  3RQF A;  4U5F E;  1Z6A A;  5JLI A;  4PFP A;  1FQI A;  2R7V A;  2HFI A;  3RYL A;  2HSB A;  1IZM A;  2WZG A;  5E33 A;  2J7P D;  1G4W R;  2LP4 A;  1T01 A;  2Y3G A;  5CIV A;  2XLE A;  2WZL A;  3EZH A;  4J32 B;  3LAY A;  4DOZ A;  2EIJ C;  4CX9 A;  3ABL C;  4EBK A;  1E83 A;  4P6I C;  5D92 A;  3AG4 C;  2ZXP A;  3HNL A;  3K7D A;  3ZIB A;  5KYY A;  2XLM A;  1Q0D A;  3ASO C;  4O7G A;  2EIL C;  3W2W A;  5DQT A;  1O3U A;  2Y69 C;  3AG2 C;  3DE9 A;  5BQI A;  3ITF A;  2XS1 A;  1A7V A;  2L9J A;  4W8P A;  3MYI A;  3ZDL A;  2KC3 A;  4BG0 A;  1M2V B;  2OJE D;  1GS9 A;  1H7I A;  4E18 A;  2ZXR A;  3GM2 A;  4OD4 A;  2YZS A;  3WG7 C;  1K04 A;  4LLC A;  4WJ0 A;  1XZQ A;  1CGM E;  4OIO F;  2PFD A;  4F4B A;  2BC5 A;  1A7E A;  1A41 A;  2B0J A;  4C3D A;  1RJ9 B;  1WAS A;  3QMK A;  4H54 A;  1ZVZ A;  4DRI B;  2R03 A;  3JYH A;  4I1O B;  1RKE B;  2WVQ A;  2EPM X;  4KBL A;  5F28 E;  5HE2 A;  4YJW A;  2R7X A;  4JZA A;  2BCJ A;  1MMD A;  3EGD B;  4MK0 A;  3JRT A;  3QVY A;  1RKC A;  5DQZ A;  1U6H A;  4ZLC A;  4N06 A;  2G62 A;  3RKO F;  4B6I A;  1YLM A;  1ZHY A;  256B A;  2CGE A;  5CI9 A;  3EFO A;  1NU7 D;  2BE5 F;  2Q3T A;  5EK0 A;  3I5P A;  5L0G A;  3JSE O;  5L0F A;  3PDM P;  1I4Z A;  2XM0 A;  1H9T A;  1VLT A;  3CIK A;  1APC A;  3HNI A;  4QDL A;  3EH2 A;  4LAC B;  3EGX A;  3VF0 A;  2KQ9 A;  4DRJ B;  1BBH A;  5DS6 A;  2M64 A;  1J8Y F;  2IK8 B;  4G7H F;  4MVR A;  5T3T A;  3RQE A;  5T1D B;  1C17 M;  3DZA A;  3F46 A;  4CS9 A;  5JS5 A;  1T9K A;  3GEH A;  2OEX A;  2XL6 A;  4G7Z F;  3KL4 A;  1YYJ A;  4PJN A;  1T6Q A;  3O10 A;  3V5X A;  4DJ9 A;  1KU2 A;  4KNV A;  3L1M A;  3QTH A;  4CJO A;  1PD0 A;  5L0J A;  1Q0G A;  1RCP A;  4CJG A;  1UFB A;  1FMW A;  1GQA A;  4YWQ A;  2AF0 A;  3U8V A;  1J8M F;  1WOL A;  3RVY A;  4EKW A;  1A0B A;  4N4W A;  4NTA A;  1KTM A;  4JEA A;  3LS0 A;  1VTM P;  4RDA A;  1H6G A;  2WB7 A;  4PFO A;  2CDQ A;  2ZD9 A;  2J45 A;  3G4Z A;  5L0D A;  2BV1 A;  2VCC A;  4MVS A;  1SYQ A;  4MVU A;  1E85 A;  3FXH A;  2HV7 A;  2L81 A;  2NSF A;  4IAR A;  5F5H A;  4FAP B;  4CSA A;  3HNK A;  2I15 A;  4HTE A;  3S0X A;  1CPR A;  1FQJ B;  4MW3 A;  2M4E A;  3Q7L A;  1PCX A;  2XLD A;  2F22 A;  3W8H A;  3DMD A;  2PP4 A;  4GYT A;  1QVX A;  2JX0 A;  3T6J A;  2UUH A;  1SR2 A;  2YHS A;  3T6B A;  3PVU A;  5DO9 B;  3O6X A;  3HNJ A;  3U3F A;  3ECS A;  1NZE A;  3SXZ A;  5COM A;  2DB4 A;  5L3Q A;  3KYI A;  3ZG1 A;  4PNK A;  1T6U A;  1I4Y A;  1TWC A;  3VAY A;  4CDV A;  1OCC C;  5A6B A;  3ATP A;  1OR3 A;  4OD5 A;  4E0I A;  1M57 C;  1VK5 A;  2J46 A;  3GEI A;  1VYI A;  3JTL O;  4U9E A;  4YN0 B;  1S7Z A;  3CQZ A;  4JTC B;  3K6B A;  4C7O A;  4NC3 A;  1LM3 B;  1M2O A;  3IQC A;  5KYY B;  3L34 A;  2P0N A;  3DM9 B;  1Y6D A;  3L8I A;  4XWJ A;  3GOD A;  5HE1 A;  3MFN A;  5AGF A;  1FNT c;  2HKV A;  2YL3 A;  2VB6 A;  3BEH A;  4IRU A;  4BJ6 A;  3ZC4 A;  4LLE A;  2YRF A;  1Z63 A;  4AX2 A;  4ANJ A;  5JSL A;  4N6H A;  2MHR A;  3L0I A;  3IEE A;  4EBJ A;  3C8Z A;  3VM6 A;  5FCL A;  1LVK A;  1V74 B;  3EJN A;  1FTS A;  3ZWI A;  5HE0 A;  3AJM A;  1OMW A;  5COF A;  2Z15 A;  2LCH A;  3U3B A;  3C7K B;  3T6G B;  3EPV A;  1E86 A;  3S28 A;  3DKA A;  4U5C E;  5B1A C;  4FWV A;  1BZ4 A;  3WOD F;  3GM3 A;  3B0U X;  4EIY A;  2VC9 A;  5HE3 A;  1VOM A;  2D5R B;  2EPK X;  3NMI A;  4BEJ A;  2A68 F;  1XWJ A;  5HV9 A;  3M4C A;  4CS8 C;  3TOM A;  3GAN A;  3O55 A;  5HSW A;  1OCR C;  1K40 A;  3E70 C;  3EFO B;  5KYW A;  4MVQ A;  1LPE A;  3K1I C;  3LLK A;  5JVE A;  2XLH A;  3C18 A;  2DLV A;  4PR9 A;  1LKX A;  1NG1 A;  1OCZ C;  2A69 F;  2AU5 A;  2JPU A;  3EGX B;  4J7T A;  3RF3 A;  3Q6N A;  1UG7 A;  2ASR A;  2IM8 A;  4J30 B;  2HS5 A;  4Z9H A;  1G5Z A;  4HFF B;  4Z9J A;  3RIP A;  1LI5 A;  4IAQ A;  3W2V A;  4A2N B;  2IYL D;  3NYJ A;  1QSP A;  3UMH A;  3S84 A;  4OIP F;  2YLG A;  1JPN A;  1Q0M A;  4MVO A;  4XPW A;  3GEE A;  4EKD B;  3PCV A;  1D1B A;  2EIK C;  5A6A A;  2R7S A;  3SYN A;  3TJ5 A;  2P6V A;  4IAO A;  4BEM J;  1H9G A;  3U5S A;  2XM4 A;  1S05 A;  1AUE A;  3QW0 A;  3TQO A;  2XL8 A;  4CIH A;  1Z5Z A;  2D4U A;  3NMJ A;  4D4X A;  1TWG A;  5KYU B;  4W8K A;  2IXP A;  4MTO A;  5BQG A;  1QQ3 A;  1HE9 A;  4XQ1 A;  4EBB A;  1V4A A;  2D9J A;  2KJG A;  2NUT A;  1KNY A;  1R5I D;  3NYM A;  4JCH A;  2OQM A;  1EI7 A;  3C62 A;  3IQ6 A;  3NYL A;  3Q6M A;  2HJ3 A;  5FZT A;  3U9M A;  2J0X A;  4EUK B;  2DYS C;  3HTK C;  5DLJ A;  3FAJ A;  3IQT A;  4G78 A;  2I8B A;  5TJ5 E;  1VLS A;  1LS1 A;  2Q9B A;  5KYN A;  1OW6 A;  3T4R A;  4OIR F;  1OXB A;  4BPM A;  3L8J A;  4NQF A;  2YQY A;  1OR2 A;  2V4Z B;  3B29 A;  3H2V A;  2HV6 A;  1CMZ A;  1HW1 A;  4L6R A;  4O79 A;  3PVW A;  3S29 A;  3FHD A;  3KH2 A;  3O39 A;  1SMY F;  2IHB B;  1BR2 A;  1FFH A;  2PX3 A;  4RBN A;  5AC5 A;  2JM5 A;  5DS5 A;  1VMA A;  2IBF A;  1BR4 A;  3EHN A;  3MLG A;  4TND A;  2DYR C;  3NKD A;  4K0D A;  3AG3 C;  2XXA A;  1FQK B;  1LE2 A;  1Y4C A;  2OG2 A;  2YL0 A;  3FOO A;  3EQL F;  4J7Y A;  4PJM A;  1U0B B;  3GWL A;  3UMI A;  3PSC A;  4WAB A;  2PBE A;  5CI8 A;  1IW7 F;  1EQ1 A;  2EPL X;  2ODE B;  2J0W A;  3CEX A;  2J9B A;  1CPQ A;  3LNM B;  5L0C A;  2XLO A;  1MQV A;  1O87 A;  3Q7G A;  1LE4 A;  4JRZ A;  4YL1 A;  1I5N A;  2VCB A;  3JRM O;  2QTV A;  3LJB A;  4GQH A;  5F5F A;  2L6F A;  2YVK A;  4IB4 A;  1WGW A;  3UGP A;  3MX3 A;  2IHD A;  4I1M A;  4U5H A;  1G4U S;  3B0P A;  1TFO B;  3GWN A;  3K66 A;  4X0R A;  5A6B D;  1Z23 A;  2L6H A;  4QI0 A;  3N0T A;  3RQG A;  4U5D E;  3H65 A;  3W8I A;  4YT5 A;  3KKB A;  2IOQ A;  2B0H A;  3JSZ A;  4JIO A;  1YZA A;  3TUL A;  1TFK B;  1OQC A;  2FGY A;  1D1C A;  4DBR A;  2LIG A;  4Z9I A;  2H7V C;  3V5Z A;  3ABM C;  1JRA A;  5JP7 A;  2OKU A;  1BR1 A;  2QLA A;  4AL1 A;  5KYW B;  3RFY A;  4A4A A;  3EG9 A;  4TNB A;  2P61 A;  2PF4 E;  1MNE A;  4MW8 A;  5GPG B;  4EWC A;  1ST6 A;  2LD6 A;  1OXK A;  3G4X A;  3NYN A;  4XPX A;  4U5G A;  4O6N A;  4DVZ A;  4YL3 A;  2QY9 A;  1M2V A;  4BJ5 A;  2WL8 A;  3EHM A;  2JNU A;  3C7L A;  1OCO C;  2VAS A;  3B9Q A;  1T6I A;  4JJF A;  3QVZ A;  2YWA A;  2Y39 A;  3VYW A;  3WAQ A;  5B3S C;  4MVM A;  1YA9 A;  2R9R B;  2AWY A;  3TOL A;  2W9Y A;  2XRH A;  3W4Y A;  1HMD A;  1C02 A;  2XLV A;  4MND A;  4DBQ A;  1DK8 A;  3AOU A;  2KGO A;  4IJJ A;  2MYS A;  2KW3 C;  4JTA B;  2GDC A;  4CIP A;  2ZXW C;  3MYF A;  3IPM O;  2X51 A;  2R02 A;  4XLN F;  3IHU A;  5EGY A;  4UDV A;  4JKV A;  5AC4 A;  1N1C A;  3ASN C;  4U5B E;  2NUT B;  2ICW G;  2LSE A;  1ZU4 A;  2OOC A;  1L3P A;  1VB5 A;  3SXK A;  3LLI A;  3N2Z B;  2BL2 A;  3AG1 C;  1M56 C;  2AWC A;  4D4N A;  2KSF A;  2DI3 A;  3S90 A;  3VRC A;  4AE4 A;  3NKE A;  4IGG A;  3R2P A;  5L3V A;  2H7O A;  3DD7 A;  4HFK B;  1OW8 A;  4MS2 A;  1ZW2 A;  4CS8 A;  3B0V C;  2J9W A;  5JUA A;  1XZP A;  2IXO A;  3SXY A;  1R4T A;  4I3M A;  1VYK A;  5E2Q A;  1YVI A;  5EHH A;  1LIH A;  1RXQ A;  2A0U A;  1MMG A;  3AQC A;  2CRP A;  3K1I A;  3OA1 A;  3OEO A;  4DXW A;  1D1A A;  1NSG B;  1TWA A;  3KYJ A;  2OJQ A;  1ZW3 A;  3FOP A;  1YZC A;  4LDK A;  4AL0 A;  3B71 A;  4U5E E;  4NCQ A;  4PK4 A;  4JW1 A;  4K1O A;  3SEO A;  4OIQ F;  1JOG A;  2Q9C A;  4LDR A;  1ZU5 A;  2WVO A;  3U2M A;  2J9U A;  5A69 A;  3A11 A;  2UUI A;  1HY5 A;  2J9V A;  4MTF A;  2XXA B;  1SZI A;  4XPY A;  1E84 A;  1RMV A;  2R05 A;  2WZF A;  4XTK A;  2KNH A;  2Y3H A;  2V3C C;  4EHP A;  4I44 A;  3C8G A;  4IWB A;  1YYX A;  2BT2 A;  3AGU A;  4KC9 A;  1JAF A;  3G50 A;  3N24 A;  3RW0 A;  3M1C B;  4BJ1 A;  3ZSU A;  1ZHX A;  2JD3 A;  2A6E F;  2NG1 A;  1ZZP A;  1U89 A;  3EH1 A;  3JCU Q;  2C04 A;  4JVS A;  4ULV A;  1MND A;  4XEK A;  4YT8 A;  1QPU A;  5BUO A;  3I5Q A;  2HMQ A;  4CDA A;  4YK5 A;  1YDI A;  2RSE B;  1E2X A;  1F1M A;  2YEV A;  3KRW A;  2YKZ A;  3FVY A;  4M63 A;  1V54 C;  1OKK A;  4XEV A;  3ZVR A;  4YL0 A;  3R7C A;  3S9O A;  1EZT A;  1K05 A;  1ZHT A;  3DJU B;  2YL7 A;  4ER9 A;  2L7A A;  3PMR A;  4G0H A;  4E7S A;  2P7V A;  4E7Z A;  3UGO A;  2NUP A; 
#chains in the Genus database with same CATH homology
 3V7O A;  3K1H A;  1TR2 A;  2W4M A;  2W45 A;  3DAF A;  3LNR A;  4OIN F;  2G3V A;  3CSK A;  2W4B A;  3UMK A;  3K33 A;  4QI2 A;  1MMA A;  3EG9 B;  5D91 A;  5DVW A;  2CNW A;  3DJN B;  4JJG A;  3QZC A;  4RD9 A;  3NG1 A;  2ZPA A;  3SZR A;  2XSE A;  4C3E A;  3KMI A;  2PX0 A;  4XLP F;  2EIM C;  4C7O B;  3I4U A;  3AQB A;  1D0Z A;  4AK9 A;  4H4K C;  1TWH A;  2J7P A;  1W2W A;  4HEA J;  1FMV A;  2A6H F;  3HJC A;  4ZLD A;  2R7U A;  3EZI A;  3X2Q C;  3NRH A;  3SNH A;  1FFT C;  4AE4 B;  1SF8 A;  3HLZ A;  3LEV A;  4KI2 A;  2IXN A;  5IY5 C;  1ZYR F;  1TKN A;  4Q4Z F;  1ZHW A;  3LES A;  5DS4 A;  4CS9 C;  1JPJ A;  3RH3 A;  4K7B A;  3X1O A;  2G3K A;  5KYU A;  3DXJ F;  2IXM A;  5E3A A;  1D0Y A;  2A1D D;  4LER A;  2E87 A;  4FX5 A;  4CBE A;  2R7R A;  3CZ6 A;  4KNW A;  4MQ9 F;  3SP1 A;  1RJ9 A;  4PJL A;  1PD1 A;  5T3W A;  3EGD A;  2OCC C;  4NY3 A;  4CS7 A;  3F47 A;  4CSA C;  2Y3B A;  2V26 A;  5KYX B;  2NUP B;  2R7O A;  3PHF 2;  4GEH A;  4JUR I;  2ZXO A;  4O6Y A;  4C3B A;  3JT1 A;  2C03 A;  2EIN C;  2H7B A;  5B1B C;  2DGJ A;  3S27 A;  1MMN A;  4HE8 D;  4BJ5 C;  3UNG C;  3UR3 C;  1OKK D;  2CW0 F;  3NDB B;  2WVN A;  4FES A;  3DM5 A;  1QZX A;  3E9V A;  2R7T A;  2Q9A A;  1D0X A;  4BJT A;  2FFH A;  4YT4 A;  1G8X A;  2VH3 A;  3OWT A;  1ZHZ A;  2MWQ A;  4Q7C A;  3FDQ A;  4BJ6 C;  1QLE C;  2XL4 A;  2CNW D;  2GFH A;  4O6M A;  4DVY P;  1Z3I X;  4YT2 A;  4ULW A;  3ABK C;  3DAG A;  1NU9 C;  1V55 C;  2Y3D A;  2O9X A;  4PJJ A;  5E3C A;  2R7Q A;  3LS1 A;  1O5H A;  3TD7 A;  4U5F E;  1Z6A A;  2R7V A;  4PFP A;  3RYL A;  1IZM A;  2WZG A;  5E33 A;  2J7P D;  2Y3G A;  4J32 B;  2WZL A;  3EZH A;  4DOZ A;  3LAY A;  2EIJ C;  3ABL C;  4P6I C;  5D92 A;  3AG4 C;  2ZXP A;  3K7D A;  3ZIB A;  5KYY A;  3ASO C;  4O7G A;  2EIL C;  3W2W A;  5DQT A;  2Y69 C;  3AG2 C;  3ITF A;  2L9J A;  4BG0 A;  1M2V B;  2ZXR A;  4OD4 A;  2YZS A;  3WG7 C;  4LLC A;  4WJ0 A;  4OIO F;  2PFD A;  4F4B A;  2B0J A;  4C3D A;  1RJ9 B;  3QMK A;  3JYH A;  4I1O B;  2WVQ A;  4KBL A;  2R7X A;  4YJW A;  4JZA A;  1MMD A;  3EGD B;  3JRT A;  5DQZ A;  4ZLC A;  4N06 A;  2G62 A;  3RKO F;  4B6I A;  1ZHY A;  2CGE A;  5CI9 A;  3EFO A;  1NU7 D;  2BE5 F;  2Q3T A;  5F5F A;  3I5P A;  4QDL A;  3EH2 A;  4LAC B;  3EGX A;  4G7H F;  2KQ9 A;  4Q5S F;  5DS6 A;  1J8Y F;  5T3T A;  5T1D B;  3DZA A;  3F46 A;  4CS9 A;  4G7Z F;  3KL4 A;  4PJN A;  1KU2 A;  4KNV A;  1PD0 A;  4YWQ A;  1FMW A;  1J8M F;  3LS0 A;  4RDA A;  2WB7 A;  4PFO A;  2CDQ A;  2J45 A;  2HV7 A;  2L81 A;  5F5H A;  4CSA A;  3S0X A;  4HTE A;  2M4E A;  3Q7L A;  1PCX A;  3W8H A;  3DMD A;  2PP4 A;  4GYT A;  3T6J A;  2YHS A;  3T6B A;  3O6X A;  3ECS A;  1NZE A;  5L3Q A;  3ZG1 A;  3VAY A;  1TWC A;  1OCC C;  4OD5 A;  1M57 C;  1VK5 A;  2J46 A;  1VYI A;  4YN0 B;  1S7Z A;  3CQZ A;  4C7O A;  3K6B A;  1M2O A;  5KYY B;  3L34 A;  3DM9 B;  4XWJ A;  3GOD A;  4BJ6 A;  2VB6 A;  4IRU A;  3ZC4 A;  4LLE A;  1Z63 A;  4AX2 A;  4ANJ A;  3L0I A;  3IEE A;  5FCL A;  1LVK A;  3EJN A;  1FTS A;  2Z15 A;  3EPV A;  3S28 A;  4U5C E;  5B1A C;  4FWV A;  3WOD F;  3B0U X;  2D5R B;  1VOM A;  4BEJ A;  2A68 F;  4CS8 C;  3GAN A;  5HSW A;  1OCR C;  3E70 C;  3EFO B;  5KYW A;  3K1I C;  3LLK A;  1LKX A;  1NG1 A;  1OCZ C;  2A69 F;  3EGX B;  3Q6N A;  4J30 B;  3RIP A;  4HFF B;  3W2V A;  4A2N B;  2IYL D;  3NYJ A;  3UMH A;  4OIP F;  1JPN A;  1D1B A;  2EIK C;  2R7S A;  3SYN A;  2P6V A;  4IAO A;  4CIH A;  1Z5Z A;  5KYU B;  1TWG A;  4W8K A;  2IXP A;  4EBB A;  2KJG A;  2NUT A;  3NYM A;  4JCH A;  3Q6M A;  3NYL A;  2R7W A;  2J0X A;  2DYS C;  3HTK C;  5DLJ A;  3FAJ A;  2I8B A;  1LS1 A;  2Q9B A;  5KYN A;  3T4R A;  4OIR F;  4O79 A;  2HV6 A;  3S29 A;  3FHD A;  3KH2 A;  3O39 A;  1SMY F;  1BR2 A;  1FFH A;  2PX3 A;  4RBN A;  5DS5 A;  1VMA A;  3NKD A;  1BR4 A;  3MLG A;  3EHN A;  2DYR C;  4K0D A;  3AG3 C;  2XXA A;  2OG2 A;  3EQL F;  4PJM A;  3UMI A;  5CI8 A;  1IW7 F;  2J0W A;  1O87 A;  3Q7G A;  3LJB A;  2QTV A;  1WGW A;  3UGP A;  3MX3 A;  4I1M A;  4U5H A;  3B0P A;  3K66 A;  4X0R A;  1Z23 A;  4QI0 A;  3N0T A;  4U5D E;  3H65 A;  3W8I A;  4YT5 A;  3KKB A;  2IOQ A;  3JSZ A;  2FGY A;  1D1C A;  4DBR A;  2H7V C;  3ABM C;  1BR1 A;  5KYW B;  3RFY A;  3EG9 A;  2PF4 E;  1MNE A;  4EWC A;  1ST6 A;  4U5G A;  4O6N A;  4DVZ A;  2QY9 A;  1M2V A;  4BJ5 A;  2WL8 A;  3EHM A;  4JJF A;  1OCO C;  2VAS A;  3B9Q A;  3VYW A;  2Y39 A;  5B3S C;  2W9Y A;  2XRH A;  4MND A;  4DBQ A;  2KGO A;  4IJJ A;  2MYS A;  2KW3 C;  2ZXW C;  2X51 A;  4XLN F;  5EGY A;  1N1C A;  3ASN C;  4U5B E;  2NUT B;  2LSE A;  1ZU4 A;  4G7O F;  3LLI A;  3N2Z B;  3AG1 C;  1M56 C;  4AE4 A;  3NKE A;  5L3V A;  2H7O A;  3DD7 A;  4HFK B;  4CS8 A;  3B0V C;  2J9W A;  2IXO A;  5E2Q A;  4I3M A;  1VYK A;  5EHH A;  3AQC A;  3OA1 A;  1MMG A;  3OEO A;  1D1A A;  1TWA A;  4U5E E;  4PK4 A;  4JW1 A;  3SEO A;  4OIQ F;  2Q9C A;  1ZU5 A;  2WVO A;  2J9U A;  2J9V A;  2XXA B;  1SZI A;  2WZF A;  4XTK A;  2KNH A;  2Y3H A;  2V3C C;  4I44 A;  4IWB A;  4KC9 A;  3N24 A;  3M1C B;  4BJ1 A;  3ZSU A;  1ZHX A;  2JD3 A;  2A6E F;  2NG1 A;  3JCU Q;  3EH1 A;  4JVS A;  4YT8 A;  2C04 A;  3POV A;  1MND A;  5BUO A;  3I5Q A;  2YEV A;  3FVY A;  4M63 A;  1V54 C;  1OKK A;  3ZVR A;  1ZHT A;  3DJU B;  4E7S A;  4E7Z A;  3PMR A;  4G0H A;  3UGO A;  2P7V A;  5KYX A;  2NUP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...