3I5QA

Nup170(aa1253-1502) at 2.2 a, s.cerevisiae
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
248
Chain Sequence
IVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 83
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.20 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 3i5qA02
1.20.120.1050 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5qA01
3I5QA
chains in the Genus database with same CATH superfamily
3OEOA 5HE2A 3TJ6A 4CDYA 1A0BA 1FNTc 3C8GB 2YKZA 3RKOF 2M4EA 1QPUA 1QZXA 2XS1A 4ULVA 1NG1A 3AOUA 3L34A 2XLDA 4W8PA 4CIPA 5L0FA 5KYNA 3PHF2 3AG1C 1BR4A 1CPRA 5HE3A 3VYWA 4O6NA 4CSAC 3DAGA 4BPMA 1NSGB 2HMQA 2J9BA 2RSEB 2YQYA 2EPOA 2D4UA 2YLDA 4MS2A 3R7CA 3U2MA 1V55C 1BBHA 2MWQA 4JW1A 3UMIA 4E17A 3CAXA 1NU9C 5HE0A 2IHBB 3U0CA 3T6JA 1EMUA 4A2NB 3L0IA 2ZPAA 1DOWA 1D0ZA 1D1AA 1YZAA 3ZIBA 1IZMA 1I5NA 2GAQA 1TFKB 3BEHA 4FAPB 2XXAA 1TWHA 2YL0A 3LLKA 2HV6A 3PMRA 3W8IA 5DS5A 4EHPA 3EGDB 1ZHYA 3C8ZA 1OCZC 2A69F 3UGOA 4OIOF 2Z15A 3JYHA 4DVYP 3TJ5A 1JPNA 2R7XA 2IXNA 1WWPA 4CX9A 1BR2A 1S05A 2XLHA 2Y39A 4H4KC 4J7YA 5KYWB 1LKXA 4PFPA 4G7OF 2IK8B 3US6A 3UGPA 4P9FA 5B1AC 4CDAA 4E0HA 2XM0A 4LLEA 3GWNA 4RDAA 4EUKB 4O7GA 5DQZA 2JX0A 1OW8A 4YL3A 4CBEA 1HW2A 3C63A 2P61A 3T6BA 1YYXA 2EIMC 3LS0A 1D0YA 2B0HA 3DWWA 3GWLA 4PJJA 3M79A 3HLZA 2W9YA 5DLJA 5KYYA 5JUAA 5D91A 2W45A 1Q0GA 3QVYA 4JVSA 4MQ9F 3QW0A 1OW7A 3Q7GA 4BG0A 4YWQA 1T6IA 3MBGA 3NRHA 4E0IA 2YEVA 3JRTA 3NMIA 3ATPA 1M6TA 3IQCA 3B71A 3JRMO 3C8GA 2Q9BA 3M4CA 1ZYRF 3E70C 1LS1A 1MQVA 4DXWA 3F46A 1B68A 3JT1A 3R2PA 2XSEA 1BR1A 4DJ9A 3DAFA 4XTKA 3SXZA 2R7TA 3QW1A 4MVRA 2H7OA 5JSLA 4MVZA 1F1MA 3ZQYA 2FGYA 1CGME 3B29A 3DXJF 4PNKA 2DGJA 3U8PA 4D4XA 5CIVA 2I15A 2NSGA 4JJGA 3VRCA 4QDLA 3FHDA 4EBKA 4TNDA 2AWYA 4XQ1A 2YLIA 3ZTMA 1Z3IX 2J7PA 4K7BA 4MVQA 3DJUB 1NBBA 5AC4A 2OJED 2KSFA 4XPYA 2AF0A 2OQMA 3LNMB 2CNWD 1WTYA 4MVOA 4EKWA 2Y3DA 1KTMA 1L7CA 1NZEA 1AUEA 2EPKX 1VYKA 3SEOA 3V5ZA 3VM6A 1Q0FA 3DKAA 2AWCA 3K1HA 4CSAA 2J9VA 2KGOA 3U8VA 4EBJA 4CS9C 3EFOB 2W4MA 3EG9B 4OD5A 5A6BD 1A7DA 2YRFA 5KYWA 2AU5A 2YLGA 3EJNA 5HSWA 2AP3A 2L9JA 2BL2A 2DYRC 2HKVA 4MW8A 4KNVA 2PFDA 4IAQA 3IQ6A 2CYDA 3JSZA 3HNJA 2VH3A 4O79A 2O9XA 3O6XA 2C04A 1T9KA 2GA0A 2Q9CA 2OOCA 4I1OB 2Q3TA 3SXYA 2IM8A 2KNHA 1MMAA 1Z7Qc 1WOLA 3K7DA 3ABMC 1ST6A 2NG1A 2OG2A 1XZPA 4HE8D 5EGYA 2Q7RA 4LERA 5JT4A 2R7UA 2J46A 3V5WA 5KYXB 2QE9A 4MTFA 2EPLX 3DE8A 2GWWA 3AG4C 1R4TA 2CDQA 3GM3A 2OEXA 4CDVA 4NY3A 2XLEA 3ZSUA 3V5XA 2YZSA 2XL8A 1E86A 4DRHB 1Z63A 3AQBA 4JKVA 5T3TA 3W2VA 4LDRA 4CJOA 3NYJA 4NTAA 3SXMA 5AC5A 5DQTA 2X51A 3E9VA 4PACA 5HE1A 4DBRA 5JS5A 3RQFA 5L0IA 3TD7A 4OIQF 1YDIA 1NLXA 3S28A 2CCYA 4LDQA 1ZU4A 1DK8A 3MX3A 4P9TA 4U5HA 4LLCA 2Q00A 4C3DA 4DRJB 5B3SC 5JRAA 4JTCB 5JLIA 2YWAA 3ITFA 3GANA 3X2QC 1L3PA 4BJTA 2R25A 3G4XA 4U5DE 4GYTA 1E84A 3CIKA 1GQAA 5BUOA 2M64A 4IARA 3K66A 2Q4FA 3G50A 3W2WA 4NTBA 3B0UX 2LD6A 2R05A 2YHSA 3MYFA 3S27A 3EFOA 3EG9A 3FVYA 3DM5A 4GQHA 5L0HA 2UUHA 2JPUA 4WGZA 4MNDA 5F5HA 4ZLDA 1BZ4A 4X0RA 2W4BA 2LQGA 5HV9A 5CI8A 2EPMX 4JTAB 1M56C 2HSBA 2LFDA 3WODF 4NC3A 3POVA 1K04A 2I8BA 3KYJA 3LAYA 1PV3A 4E7SA 2GFHA 4WABA 1TWCA 3ABLC 3GODA 1VMAA 1ZHXA 4HEAJ 3GEIA 1CMZA 5COGA 4JIOA 5E3CA 1OCOC 1Q0DA 1HY5A 2H8AA 4FESA 2CW0F 1Z6AA 2L6GA 3B9QA 4YL1A 3S29A 2V4ZB 2VCCA 4MTGA 4CS9A 1OCRC 1RKCA 1EI7A 1G4WR 4J7TA 3ZVRA 5KYXA 4U5EE 3K1IC 1G5ZA 4L6RA 3I5QA 4JE9A 3RH3A 3PDMP 4J30B 4YK5A 3MFNA 2DYSC 3SNHA 4WGYA 4F4BA 3WAQA 3TOLA 4XEFA 4KI2A 3AQCA 3IPMO 4BEJA 1D1BA 1NFOA 2Y3HA 2R7RA 5FZTA 4RD9A 4B6IA 3S0XA 1OR3A 3OWTA 1K05A 4M63A 3O55A 3KRWA 3NKEA 2R7WA 4N6HA 4PJNA 1O3UA 3DJNB 1ZHWA 4P6IC 5CI9A 4DBQA 1T6UA 3C18A 2Q9AA 3BRJA 1U89A 4N06A 4N4WA 3RIPA 5BQGA 5DO9B 3FOPA 1J8YF 1H6GA 3UR3C 3ZG1A 2L6FA 1SR2A 3B0VC 2L81A 1SYQA 2X0CA 4O6YA 4N6CA 1A41A 1K40A 1SMYF 5L0GA 2FFHA 3SXKA 1ZU5A 1E2XA 3Q7LA 1LM3B 4K0DA 4G7HF 2H7VC 3DI5A 3EZIA 4C7OB 1JR8A 3N0TA 1FAPB 3FAJA 2J8WA 4G78A 4AE4B 4G7ZF 2LIGA 2ZXWC 4YT4A 1GGQA 3I4UA 2JNUA 1FFTC 2WZLA 3W4YA 2DB4A 4J32B 4KBLA 4AX2A 3TULA 1JOGA 2OKUA 2HUJA 2LP4A 3MLGA 5E33A 1M2OA 1ZW3A 2A0BA 2BT2A 3QZCA 4I3MA 3FXHA 4BJ6C 4JC7A 3L1MA 1YA9A 2PX3A 4MVUA 3W8HA 2WVQA 3F47A 3UZTA 3EH1A 4IAOA 1TWAA 3I5PA 4G0HA 4OIRF 2NUTB 2Y3GA 2OEVA 1V54C 2WZGA 3FDQA 3LUTB 1RKEB 2A6EF 2IXMA 2IHDA 1A7VA 3AG3C 1VTMP 2HS5A 4QI0A 2P1AA 2LSEA 3S90A 3JSEO 4JURI 3SP1A 3DM9B 1TR2A 3CQZA 2NUPA 3M4BA 1R5ID 4O6MA 5BQHA 3M1CB 4Z9IA 3CSKA 5L3QA 1RMVA 2F22A 3G4ZA 3NG1A 2RD9A 3PCVA 3ZDLA 2BV1A 3H65A 4PFOA 4WJ0A 1V74B 2YL1A 4Q7CA 5A6KA 3VAYA 1XZQA 2CRPA 1UG7A 1TKNA 1XWJA 3IHUA 4BJ5C 4R32A 1EZYA 1JRAA 1MMGA 1MMDA 4MVMA 2HMZA 3DZAA 5B3IA 5A6AA 1RJ9B 3RFYA 5BQIA 2A0UA 3CEXA 3T9OA 3AGUA 1TQGA 4IJJA 5L0JA 2G62A 2MYSA 3HNKA 4YT2A 2HJMA 3EHMA 4XEVA 3A11A 1LE4A 3LNRA 3K1IA 4U9EA 5E2QA 1JPJA 1LIHA 4HFFB 3GM2A 3RF3A 2DLVA 4DOZA 4OD4A 3NYOA 1MMNA 2XLOA 2IXOA 4U9DA 3T6GB 3HNLA 5DVWA 1EA8A 4I1MA 5B1BC 1WASA 2R7VA 1ZW2A 2E87A 4C7OA 2XLMA 1CPQA 4ZLCA 1TWGA 4AE4A 2L6HA 1H7IA 1OXBA 4FX5A 2ICWG 5COFA 1QQ3A 4BJ1A 5DS4A 2QLAA 2YL7A 2VCAA 4A4AA 2BCJA 4TNBA 1UFBA 4PR9A 1CGOA 2XLWA 5K0IA 2EIJC 3QTHA 1QKRA 3JTLO 4IGGA 4DRIB 5L0DA 3LESA 4ULWA 2HZ8A 2LK4A 3U9JA 4E18A 5JP7A 2QTVA 3ABKC 1V4AA 2KJGA 2XM4A 3TOMA 1T5OA 2BE5F 1PCXA 3AG2C 2J9UA 3RYLA 3Q6MA 1VLSA 2PX0A 4U5FE 3OA1A 3UMHA 3RQEA 2MHRA 2P6VA 2WZFA 2V3CC 5KYUB 2J9WA 2VB6A 2ZD9A 1HE9A 2IXPA 3KMIA 5T3WA 2NUTA 3U9MA 4XPWA 1OW6A 3HNIA 3X1OA 2XL6A 4NCQA 1RKEA 4UDVA 2AVKA 2R9RB 3EHNA 4FWVA 1E83A 1M57C 4ER9A 4Z9JA 4CJGA 3L8IA 1FQIA 5A6BA 256BA 3C8GD 4EWCA 2CGEA 1PD0A 1ZZPA 3UNGC 2EBZA 1HMDA 5A69A 1PD1A 3K33A 1ORJA 3K6BA 3QMKA 4E7ZA 2JD3A 2XL4A 5L0CA 3PSCA 3ASNC 2OU6A 4MTOA 3JYYA 1YARO 2OJQA 2UUIA 4BJ6A 1Z5ZA 3RW0A 4HFKB 1FFHA 4NTFA 3NYLA 1U0BB 4PJLA 3T4RA 2KK1A 4KNWA 4PJMA 1G4US 4MW3A 4YL0A 1S7ZA 3WG7C 1RJ9A 5D92A 1AGRE 2ODEB 2J7PD 3FAPB 3FMSA 1Y4CA 2KQ9A 1YYJA 2NUPB 3SYNA 3A9CA 3TQOA 4XLPF 1DOVA 1KNYA 2WVOA 3LEOA 2LCHA 4JEAA 4PK4A 4YT5A 5GPGB 2YL3A 2NSFA 3NMKA 1FR0A 4BEMJ 3TK0A 3ECSA 1OKKA 1U6HA 2QUPA 1EZTA 1O87A 3MYIA 2ETSA 1O5HA 2WL8A 3EGXB 4K1OA 1OR2A 2J45A 3FOOA 1EKYA 3M15A 3JCUQ 4EBBA 4AL1A 4JRZA 4C3BA 4BJ5A 4CS8C 3NDBB 4QI2A 2OCCC 2BC5A 4MVSA 2P0NA 4Q4ZF 3HKKA 2B0JA 1GS9A 1NU7D 3EZHA 1JAFA 4GEHA 1HE1A 4OINF 1J8MF 1WATA 3RQGA 4HTEA 5T1DB 2TMVP 1APCA 5F28E 1A7EA 3CZ6A 3LLIA 2L7AA 5F5FA 2LFFA 2OJ4A 2FAPB 3DD7A 1T01A 1Y6DA 1YVIA 3S9OA 4CS7A 2PF4E 4JCZA 5KYUA 1LPEA 2VCBA 1RCPA 2Y3BA 2H7BA 1I4YA 2WB7A 4LACB 1M2VB 5IY5C 1YA7O 1C02A 3KRXA 1FMVA 1CGNA 4EKDB 2A6HF 1VYIA 2JM5A 3C7KB 4JJFA 4LDKA 1LS4A 3U3BA 4ANJA 1LE2A 2KC3A 2R02A 1BDJB 2OWIA 1WN0A 2VASA 3NKDA 2XLVA 3EPVA 3J06A 2GDCA 3HTKC 4U5GA 3ZQVA 4XEKA 2PNOA 2G3VA 5TJ5E 3DMDA 1YJGA 1E85A 2HFIA 5EK0A 4Z9HA 4YJWA 2IYLD 2P7VA 3VF0A 2HJ3A 3HJCA 3C62A 1H9GA 1ORYA 2PBEA 3C7JA 2KYHA 3GORA 4DVZA 3GEEA 1LI7A 2J0XA 1YZCA 2PP4A 3N2ZB 1NFNA 2VC9A 1ZHZA 1ZVZA 3S84A 3SZRA 3IQ5A 2J0WA 1VOMA 2V26A 1VK5A 1FMWA 3PVWA 1AEPA 1Z23A 3NYNA 2HSQA 2NPUA 5EHHA 2QY9A 2IBFA 1N1CA 3EGDA 1MNDA 1VLTA 3EGXA 1GM5A 4RBNA 3V7OA 1RXQA 3KKBA 2EIKC 1QLEC 3IQTA 1FTSA 3V5YA 3QVZA 4YT8A 4Q5SF 4JTDB 2Y69C 1OMWA 1ORSC 2WVNA 3LS1A 5DS6A 5JVEA 4C3EA 1D0XA 1LI5A 4H54A 3NMJA 3UMKA 5L3VA 4D4NA 2QNLA 1Q0KA 2ZXPA 4ONSA 1OCCC 3JZ0A 2C03A 3H2VA 3ASOC 3LEVA 3NYMA 4NQFA 4XWJA 3ZTZA 1VB5A 2XXAB 3L8JA 2R7OA 3B0PA 4AK9A 3DE9A 4AL0A 1H9TA 1WGWA 1TFOB 5A6JA 3KYIA 3O39A 4XPXA 2R7SA 4MK0A 2YVKA 3GEHA 2GTPC 1IW7F 4JZAA 2DI3A 5COMA 1EQ1A 1FQKB 2R03A 1OXKA 4CS8A 1YAUO 2ASRA 1YLMA 2KW3C 3C7LA 4JEBA 1M2VA 3O10A 1HW1A 5E3AA 5AGFA 3U3FA 1SF8A 4CIHA 4OIPF 1SZIA 1LVKA 3ZWIA 4XLNF 1D1CA 4U5BE 3KH2A 2D9JA 2D5RB 1OQCA 1FQJB 2EILC 3U2LA 4U5CE 2ZXOA 3WHNA 1HMOA 2EINC 1QSPA 2R7QA 1Q0MA 1OKKD 3IEEA 3LJBA 3Q6NA 1C03A 4EIYA 3AGTA 4I44A 3RVZA 2CNWA 1JMWA 3U5SA 2XS8A 4W8KA 4IB4A 4IWBA 2G3KA 2EPNA 2HV7A 2IOQA 3AJMA 3PVUA 5KYYB 2XRHA 1I4ZA 1C17M 2ZXRA 3RVYA 4JCHA 1G8XA 4IRUA 4YN0B 3EH2A 3N24A 1QVXA 3ZC4A 2A1DD 3KL4A 3H2UA 1MNEA 1T6QA 3EQLF 4KC9A 1ZHTA 1AVOB 1W2WA 3KPHA 1KU2A 5FCLA 2A68F 3GM1A
chains in the Genus database with same CATH topology
3OEOA 3RKOF 2M4EA 1QZXA 1NG1A 3L34A 5KYNA 3PHF2 3AG1C 1BR4A 3VYWA 4O6NA 4CSAC 3DAGA 1V55C 2MWQA 4JW1A 3UMIA 1NU9C 3T6JA 3L0IA 2ZPAA 1D0ZA 1D1AA 3ZIBA 1IZMA 2XXAA 1TWHA 3PMRA 3LLKA 2HV6A 3W8IA 5DS5A 3EGDB 1ZHYA 1OCZC 2A69F 3UGOA 4OIOF 2Z15A 3JYHA 4DVYP 1JPNA 2R7XA 2IXNA 1BR2A 2Y39A 4H4KC 5KYWB 1LKXA 4PFPA 4G7OF 3UGPA 5B1AC 4LLEA 4RDAA 4O7GA 5DQZA 4CBEA 3T6BA 2EIMC 3LS0A 1D0YA 5KYYA 4PJJA 3HLZA 2W9YA 5DLJA 5D91A 2W45A 4JVSA 4MQ9F 4BG0A 3Q7GA 4YWQA 3NRHA 2YEVA 3JRTA 2Q9BA 1ZYRF 3E70C 1LS1A 3F46A 3JT1A 2XSEA 1BR1A 2R7TA 3DAFA 4XTKA 2H7OA 2FGYA 3DXJF 2DGJA 4JJGA 4QDLA 3FHDA 1Z3IX 2J7PA 4K7BA 3DJUB 2CNWD 2Y3DA 1NZEA 1VYKA 3SEOA 4CSAA 3K1HA 2J9VA 2KGOA 4CS9C 3EFOB 2W4MA 3EG9B 4OD5A 5KYWA 5HSWA 3EJNA 2L9JA 2DYRC 4KNVA 2PFDA 3JSZA 2VH3A 4O79A 2O9XA 3O6XA 2C04A 2Q9CA 4I1OB 2Q3TA 2KNHA 1MMAA 3K7DA 3ABMC 1ST6A 2NG1A 2OG2A 4HE8D 5EGYA 4LERA 2R7UA 2J46A 5KYXB 3AG4C 2CDQA 4NY3A 3ZSUA 2YZSA 1Z63A 3AQBA 5T3TA 3W2VA 3NYJA 5DQTA 2X51A 3E9VA 4DBRA 3TD7A 4OIQF 3S28A 4U5HA 4C3DA 1ZU4A 3MX3A 5B3SC 4LLCA 3ITFA 3GANA 3X2QC 4BJTA 4U5DE 4GYTA 5BUOA 3K66A 3W2WA 3B0UX 2YHSA 3S27A 3EFOA 3EG9A 3FVYA 3DM5A 4MNDA 5F5HA 4ZLDA 4X0RA 2W4BA 5CI8A 1M56C 3WODF 3POVA 2I8BA 3LAYA 4E7SA 2GFHA 1TWCA 3ABLC 3GODA 1VMAA 1ZHXA 4HEAJ 5E3CA 1OCOC 4FESA 2CW0F 1Z6AA 3B9QA 3S29A 4CS9A 1OCRC 3ZVRA 5KYXA 4U5EE 3K1IC 3I5QA 3RH3A 4J30B 4F4BA 2DYSC 3SNHA 4KI2A 3AQCA 4BEJA 1D1BA 2Y3HA 2R7RA 4RD9A 4B6IA 3S0XA 3OWTA 4M63A 3NKEA 2R7WA 4PJNA 3DJNB 1ZHWA 4P6IC 5CI9A 4DBQA 4N06A 2Q9AA 3RIPA 1J8YF 3UR3C 3ZG1A 3B0VC 2L81A 4O6YA 1SMYF 2FFHA 1ZU5A 3Q7LA 4G7HF 4K0DA 2H7VC 3EZIA 4C7OB 3N0TA 3FAJA 4AE4B 4G7ZF 2ZXWC 4YT4A 3I4UA 1FFTC 2WZLA 4J32B 4AX2A 4KBLA 3MLGA 5E33A 1M2OA 3QZCA 4I3MA 4BJ6C 2PX3A 3W8HA 2WVQA 3F47A 4IAOA 3EH1A 1TWAA 3I5PA 4G0HA 4OIRF 2NUTB 2Y3GA 1V54C 2WZGA 3FDQA 2A6EF 2IXMA 3AG3C 4QI0A 2LSEA 3SP1A 4JURI 3DM9B 1TR2A 3CQZA 2NUPA 4O6MA 3M1CB 3CSKA 5L3QA 3NG1A 4WJ0A 3H65A 4PFOA 4Q7CA 3VAYA 1TKNA 4BJ5C 1MMGA 1MMDA 3DZAA 1RJ9B 3RFYA 4IJJA 2G62A 2MYSA 4YT2A 3EHMA 3LNRA 5E2QA 1JPJA 4DOZA 4HFFB 4OD4A 1MMNA 2IXOA 5DVWA 4I1MA 5B1BC 2R7VA 4C7OA 2E87A 4ZLCA 1TWGA 4AE4A 4FX5A 4BJ1A 5DS4A 2EIJC 3LESA 4ULWA 2QTVA 3ABKC 2KJGA 2BE5F 1PCXA 3AG2C 2J9UA 3RYLA 3Q6MA 2PX0A 4U5FE 3OA1A 3UMHA 2P6VA 2WZFA 2V3CC 5KYUB 2J9WA 2VB6A 3KMIA 2IXPA 5T3WA 4A2NB 2NUTA 3X1OA 3EHNA 4FWVA 1M57C 4EWCA 2CGEA 1PD0A 3UNGC 1PD1A 3K33A 3K6BA 4E7ZA 3QMKA 2JD3A 2XL4A 3ASNC 4BJ6A 1Z5ZA 4HFKB 1FFHA 3NYLA 4PJLA 3T4RA 4KNWA 4PJMA 1S7ZA 3WG7C 1RJ9A 5D92A 2J7PD 2KQ9A 3SYNA 2NUPB 4XLPF 2WVOA 4PK4A 4YT5A 3ECSA 1OKKA 1O87A 1O5HA 2WL8A 3EGXB 2J45A 3JCUQ 4EBBA 4C3BA 4BJ5A 4CS8C 3NDBB 4QI2A 2OCCC 4Q4ZF 2B0JA 1NU7D 3EZHA 4GEHA 4OINF 1J8MF 4HTEA 5T1DB 3LLIA 3CZ6A 5F5FA 3DD7A 4CS7A 2PF4E 5KYUA 2Y3BA 2H7BA 2WB7A 4LACB 1M2VB 5IY5C 1FMVA 1VYIA 2A6HF 4JJFA 4ANJA 2VASA 3NKDA 3EPVA 3HTKC 4U5GA 2G3VA 3DMDA 4YJWA 2IYLD 2P7VA 3HJCA 4DVZA 2J0XA 2PP4A 3N2ZB 1ZHZA 3SZRA 2J0WA 1VOMA 2V26A 1VK5A 1FMWA 1Z23A 5EHHA 2QY9A 1N1CA 3EGDA 1MNDA 3EGXA 4RBNA 3V7OA 3KKBA 2EIKC 1QLEC 1FTSA 4YT8A 4Q5SF 2Y69C 2WVNA 5DS6A 3LS1A 4C3EA 1D0XA 3UMKA 5L3VA 2ZXPA 1OCCC 2C03A 3NYMA 3ASOC 3LEVA 2XXAB 4XWJA 4AK9A 2R7OA 3B0PA 1WGWA 3O39A 2R7SA 1IW7F 4JZAA 4CS8A 2KW3C 5E3AA 1M2VA 4OIPF 4CIHA 1SF8A 1SZIA 1LVKA 4XLNF 1D1CA 4U5BE 3KH2A 2D5RB 2EILC 4U5CE 2ZXOA 2EINC 2R7QA 3LJBA 3IEEA 1OKKD 3Q6NA 4I44A 2CNWA 4W8KA 4IWBA 2G3KA 2HV7A 2IOQA 5KYYB 2XRHA 2ZXRA 4JCHA 1G8XA 4IRUA 4YN0B 3EH2A 3N24A 3ZC4A 2A1DD 3KL4A 1MNEA 3EQLF 4KC9A 1ZHTA 1W2WA 1KU2A 5FCLA 2A68F
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5Q A; 
#chains in the Genus database with same CATH topology
 3OEO A;  5HE2 A;  3TJ6 A;  4CDY A;  1A0B A;  1FNT c;  3C8G B;  2YKZ A;  3RKO F;  2M4E A;  1QPU A;  1QZX A;  2XS1 A;  4ULV A;  1NG1 A;  3AOU A;  3L34 A;  2XLD A;  4W8P A;  4CIP A;  5L0F A;  5KYN A;  3PHF 2;  3AG1 C;  1BR4 A;  1CPR A;  5HE3 A;  3VYW A;  4O6N A;  4CSA C;  3DAG A;  4BPM A;  1NSG B;  2HMQ A;  2J9B A;  2RSE B;  2YQY A;  2EPO A;  2D4U A;  2YLD A;  4MS2 A;  3R7C A;  3U2M A;  1V55 C;  1BBH A;  2MWQ A;  4JW1 A;  3UMI A;  4E17 A;  3CAX A;  1NU9 C;  5HE0 A;  2IHB B;  3U0C A;  3T6J A;  1EMU A;  4A2N B;  3L0I A;  2ZPA A;  1DOW A;  1D0Z A;  1D1A A;  1YZA A;  3ZIB A;  1IZM A;  1I5N A;  2GAQ A;  1TFK B;  3BEH A;  4FAP B;  2XXA A;  1TWH A;  2YL0 A;  3LLK A;  2HV6 A;  3PMR A;  3W8I A;  5DS5 A;  4EHP A;  3EGD B;  1ZHY A;  3C8Z A;  1OCZ C;  2A69 F;  3UGO A;  4OIO F;  2Z15 A;  3JYH A;  4DVY P;  3TJ5 A;  1JPN A;  2R7X A;  2IXN A;  1WWP A;  4CX9 A;  1BR2 A;  1S05 A;  2XLH A;  2Y39 A;  4H4K C;  4J7Y A;  5KYW B;  1LKX A;  4PFP A;  4G7O F;  2IK8 B;  3US6 A;  3UGP A;  4P9F A;  5B1A C;  4CDA A;  4E0H A;  2XM0 A;  4LLE A;  3GWN A;  4RDA A;  4EUK B;  4O7G A;  5DQZ A;  2JX0 A;  1OW8 A;  4YL3 A;  4CBE A;  1HW2 A;  3C63 A;  2P61 A;  3T6B A;  1YYX A;  2EIM C;  3LS0 A;  1D0Y A;  2B0H A;  3DWW A;  3GWL A;  4PJJ A;  3M79 A;  3HLZ A;  2W9Y A;  5DLJ A;  5KYY A;  5JUA A;  5D91 A;  2W45 A;  1Q0G A;  3QVY A;  4JVS A;  4MQ9 F;  3QW0 A;  1OW7 A;  3Q7G A;  4BG0 A;  4YWQ A;  1T6I A;  3MBG A;  3NRH A;  4E0I A;  2YEV A;  3JRT A;  3NMI A;  3ATP A;  1M6T A;  3IQC A;  3B71 A;  3JRM O;  3C8G A;  2Q9B A;  3M4C A;  1ZYR F;  3E70 C;  1LS1 A;  1MQV A;  4DXW A;  3F46 A;  1B68 A;  3JT1 A;  3R2P A;  2XSE A;  1BR1 A;  4DJ9 A;  3DAF A;  4XTK A;  3SXZ A;  2R7T A;  3QW1 A;  4MVR A;  2H7O A;  5JSL A;  4MVZ A;  1F1M A;  3ZQY A;  2FGY A;  1CGM E;  3B29 A;  3DXJ F;  4PNK A;  2DGJ A;  3U8P A;  4D4X A;  5CIV A;  2I15 A;  2NSG A;  4JJG A;  3VRC A;  4QDL A;  3FHD A;  4EBK A;  4TND A;  2AWY A;  4XQ1 A;  2YLI A;  3ZTM A;  1Z3I X;  2J7P A;  4K7B A;  4MVQ A;  3DJU B;  1NBB A;  5AC4 A;  2OJE D;  2KSF A;  4XPY A;  2AF0 A;  2OQM A;  3LNM B;  2CNW D;  1WTY A;  4MVO A;  4EKW A;  2Y3D A;  1KTM A;  1L7C A;  1NZE A;  1AUE A;  2EPK X;  1VYK A;  3SEO A;  3V5Z A;  3VM6 A;  1Q0F A;  3DKA A;  2AWC A;  3K1H A;  4CSA A;  2J9V A;  2KGO A;  3U8V A;  4EBJ A;  4CS9 C;  3EFO B;  2W4M A;  3EG9 B;  4OD5 A;  5A6B D;  1A7D A;  2YRF A;  5KYW A;  2AU5 A;  2YLG A;  3EJN A;  5HSW A;  2AP3 A;  2L9J A;  2BL2 A;  2DYR C;  2HKV A;  4MW8 A;  4KNV A;  2PFD A;  4IAQ A;  3IQ6 A;  2CYD A;  3JSZ A;  3HNJ A;  2VH3 A;  4O79 A;  2O9X A;  3O6X A;  2C04 A;  1T9K A;  2GA0 A;  2Q9C A;  2OOC A;  4I1O B;  2Q3T A;  3SXY A;  2IM8 A;  2KNH A;  1MMA A;  1Z7Q c;  1WOL A;  3K7D A;  3ABM C;  1ST6 A;  2NG1 A;  2OG2 A;  1XZP A;  4HE8 D;  5EGY A;  2Q7R A;  4LER A;  5JT4 A;  2R7U A;  2J46 A;  3V5W A;  5KYX B;  2QE9 A;  4MTF A;  2EPL X;  3DE8 A;  2GWW A;  3AG4 C;  1R4T A;  2CDQ A;  3GM3 A;  2OEX A;  4CDV A;  4NY3 A;  2XLE A;  3ZSU A;  3V5X A;  2YZS A;  2XL8 A;  1E86 A;  4DRH B;  1Z63 A;  3AQB A;  4JKV A;  5T3T A;  3W2V A;  4LDR A;  4CJO A;  3NYJ A;  4NTA A;  3SXM A;  5AC5 A;  5DQT A;  2X51 A;  3E9V A;  4PAC A;  5HE1 A;  4DBR A;  5JS5 A;  3RQF A;  5L0I A;  3TD7 A;  4OIQ F;  1YDI A;  1NLX A;  3S28 A;  2CCY A;  4LDQ A;  1ZU4 A;  1DK8 A;  3MX3 A;  4P9T A;  4U5H A;  4LLC A;  2Q00 A;  4C3D A;  4DRJ B;  5B3S C;  5JRA A;  4JTC B;  5JLI A;  2YWA A;  3ITF A;  3GAN A;  3X2Q C;  1L3P A;  4BJT A;  2R25 A;  3G4X A;  4U5D E;  4GYT A;  1E84 A;  3CIK A;  1GQA A;  5BUO A;  2M64 A;  4IAR A;  3K66 A;  2Q4F A;  3G50 A;  3W2W A;  4NTB A;  3B0U X;  2LD6 A;  2R05 A;  2YHS A;  3MYF A;  3S27 A;  3EFO A;  3EG9 A;  3FVY A;  3DM5 A;  4GQH A;  5L0H A;  2UUH A;  2JPU A;  4WGZ A;  4MND A;  5F5H A;  4ZLD A;  1BZ4 A;  4X0R A;  2W4B A;  2LQG A;  5HV9 A;  5CI8 A;  2EPM X;  4JTA B;  1M56 C;  2HSB A;  2LFD A;  3WOD F;  4NC3 A;  3POV A;  1K04 A;  2I8B A;  3KYJ A;  3LAY A;  1PV3 A;  4E7S A;  2GFH A;  4WAB A;  1TWC A;  3ABL C;  3GOD A;  1VMA A;  1ZHX A;  4HEA J;  3GEI A;  1CMZ A;  5COG A;  4JIO A;  5E3C A;  1OCO C;  1Q0D A;  1HY5 A;  2H8A A;  4FES A;  2CW0 F;  1Z6A A;  2L6G A;  3B9Q A;  4YL1 A;  3S29 A;  2V4Z B;  2VCC A;  4MTG A;  4CS9 A;  1OCR C;  1RKC A;  1EI7 A;  1G4W R;  4J7T A;  3ZVR A;  5KYX A;  4U5E E;  3K1I C;  1G5Z A;  4L6R A;  3I5Q A;  4JE9 A;  3RH3 A;  3PDM P;  4J30 B;  4YK5 A;  3MFN A;  2DYS C;  3SNH A;  4WGY A;  4F4B A;  3WAQ A;  3TOL A;  4XEF A;  4KI2 A;  3AQC A;  3IPM O;  4BEJ A;  1D1B A;  1NFO A;  2Y3H A;  2R7R A;  5FZT A;  4RD9 A;  4B6I A;  3S0X A;  1OR3 A;  3OWT A;  1K05 A;  4M63 A;  3O55 A;  3KRW A;  3NKE A;  2R7W A;  4N6H A;  4PJN A;  1O3U A;  3DJN B;  1ZHW A;  4P6I C;  5CI9 A;  4DBQ A;  1T6U A;  3C18 A;  2Q9A A;  3BRJ A;  1U89 A;  4N06 A;  4N4W A;  3RIP A;  5BQG A;  5DO9 B;  3FOP A;  1J8Y F;  1H6G A;  3UR3 C;  3ZG1 A;  2L6F A;  1SR2 A;  3B0V C;  2L81 A;  1SYQ A;  2X0C A;  4O6Y A;  4N6C A;  1A41 A;  1K40 A;  1SMY F;  5L0G A;  2FFH A;  3SXK A;  1ZU5 A;  1E2X A;  3Q7L A;  1LM3 B;  4K0D A;  4G7H F;  2H7V C;  3DI5 A;  3EZI A;  4C7O B;  1JR8 A;  3N0T A;  1FAP B;  3FAJ A;  2J8W A;  4G78 A;  4AE4 B;  4G7Z F;  2LIG A;  2ZXW C;  4YT4 A;  1GGQ A;  3I4U A;  2JNU A;  1FFT C;  2WZL A;  3W4Y A;  2DB4 A;  4J32 B;  4KBL A;  4AX2 A;  3TUL A;  1JOG A;  2OKU A;  2HUJ A;  2LP4 A;  3MLG A;  5E33 A;  1M2O A;  1ZW3 A;  2A0B A;  2BT2 A;  3QZC A;  4I3M A;  3FXH A;  4BJ6 C;  4JC7 A;  3L1M A;  1YA9 A;  2PX3 A;  4MVU A;  3W8H A;  2WVQ A;  3F47 A;  3UZT A;  3EH1 A;  4IAO A;  1TWA A;  3I5P A;  4G0H A;  4OIR F;  2NUT B;  2Y3G A;  2OEV A;  1V54 C;  2WZG A;  3FDQ A;  3LUT B;  1RKE B;  2A6E F;  2IXM A;  2IHD A;  1A7V A;  3AG3 C;  1VTM P;  2HS5 A;  4QI0 A;  2P1A A;  2LSE A;  3S90 A;  3JSE O;  4JUR I;  3SP1 A;  3DM9 B;  1TR2 A;  3CQZ A;  2NUP A;  3M4B A;  1R5I D;  4O6M A;  5BQH A;  3M1C B;  4Z9I A;  3CSK A;  5L3Q A;  1RMV A;  2F22 A;  3G4Z A;  3NG1 A;  2RD9 A;  3PCV A;  3ZDL A;  2BV1 A;  3H65 A;  4PFO A;  4WJ0 A;  1V74 B;  2YL1 A;  4Q7C A;  5A6K A;  3VAY A;  1XZQ A;  2CRP A;  1UG7 A;  1TKN A;  1XWJ A;  3IHU A;  4BJ5 C;  4R32 A;  1EZY A;  1JRA A;  1MMG A;  1MMD A;  4MVM A;  2HMZ A;  3DZA A;  5B3I A;  5A6A A;  1RJ9 B;  3RFY A;  5BQI A;  2A0U A;  3CEX A;  3T9O A;  3AGU A;  1TQG A;  4IJJ A;  5L0J A;  2G62 A;  2MYS A;  3HNK A;  4YT2 A;  2HJM A;  3EHM A;  4XEV A;  3A11 A;  1LE4 A;  3LNR A;  3K1I A;  4U9E A;  5E2Q A;  1JPJ A;  1LIH A;  4HFF B;  3GM2 A;  3RF3 A;  2DLV A;  4DOZ A;  4OD4 A;  3NYO A;  1MMN A;  2XLO A;  2IXO A;  4U9D A;  3T6G B;  3HNL A;  5DVW A;  1EA8 A;  4I1M A;  5B1B C;  1WAS A;  2R7V A;  1ZW2 A;  2E87 A;  4C7O A;  2XLM A;  1CPQ A;  4ZLC A;  1TWG A;  4AE4 A;  2L6H A;  1H7I A;  1OXB A;  4FX5 A;  2ICW G;  5COF A;  1QQ3 A;  4BJ1 A;  5DS4 A;  2QLA A;  2YL7 A;  2VCA A;  4A4A A;  2BCJ A;  4TNB A;  1UFB A;  4PR9 A;  1CGO A;  2XLW A;  5K0I A;  2EIJ C;  3QTH A;  1QKR A;  3JTL O;  4IGG A;  4DRI B;  5L0D A;  3LES A;  4ULW A;  2HZ8 A;  2LK4 A;  3U9J A;  4E18 A;  5JP7 A;  2QTV A;  3ABK C;  1V4A A;  2KJG A;  2XM4 A;  3TOM A;  1T5O A;  2BE5 F;  1PCX A;  3AG2 C;  2J9U A;  3RYL A;  3Q6M A;  1VLS A;  2PX0 A;  4U5F E;  3OA1 A;  3UMH A;  3RQE A;  2MHR A;  2P6V A;  2WZF A;  2V3C C;  5KYU B;  2J9W A;  2VB6 A;  2ZD9 A;  1HE9 A;  2IXP A;  3KMI A;  5T3W A;  2NUT A;  3U9M A;  4XPW A;  1OW6 A;  3HNI A;  3X1O A;  2XL6 A;  4NCQ A;  1RKE A;  4UDV A;  2AVK A;  2R9R B;  3EHN A;  4FWV A;  1E83 A;  1M57 C;  4ER9 A;  4Z9J A;  4CJG A;  3L8I A;  1FQI A;  5A6B A;  256B A;  3C8G D;  4EWC A;  2CGE A;  1PD0 A;  1ZZP A;  3UNG C;  2EBZ A;  1HMD A;  5A69 A;  1PD1 A;  3K33 A;  1ORJ A;  3K6B A;  3QMK A;  4E7Z A;  2JD3 A;  2XL4 A;  5L0C A;  3PSC A;  3ASN C;  2OU6 A;  4MTO A;  3JYY A;  1YAR O;  2OJQ A;  2UUI A;  4BJ6 A;  1Z5Z A;  3RW0 A;  4HFK B;  1FFH A;  4NTF A;  3NYL A;  1U0B B;  4PJL A;  3T4R A;  2KK1 A;  4KNW A;  4PJM A;  1G4U S;  4MW3 A;  4YL0 A;  1S7Z A;  3WG7 C;  1RJ9 A;  5D92 A;  1AGR E;  2ODE B;  2J7P D;  3FAP B;  3FMS A;  1Y4C A;  2KQ9 A;  1YYJ A;  2NUP B;  3SYN A;  3A9C A;  3TQO A;  4XLP F;  1DOV A;  1KNY A;  2WVO A;  3LEO A;  2LCH A;  4JEA A;  4PK4 A;  4YT5 A;  5GPG B;  2YL3 A;  2NSF A;  3NMK A;  1FR0 A;  4BEM J;  3TK0 A;  3ECS A;  1OKK A;  1U6H A;  2QUP A;  1EZT A;  1O87 A;  3MYI A;  2ETS A;  1O5H A;  2WL8 A;  3EGX B;  4K1O A;  1OR2 A;  2J45 A;  3FOO A;  1EKY A;  3M15 A;  3JCU Q;  4EBB A;  4AL1 A;  4JRZ A;  4C3B A;  4BJ5 A;  4CS8 C;  3NDB B;  4QI2 A;  2OCC C;  2BC5 A;  4MVS A;  2P0N A;  4Q4Z F;  3HKK A;  2B0J A;  1GS9 A;  1NU7 D;  3EZH A;  1JAF A;  4GEH A;  1HE1 A;  4OIN F;  1J8M F;  1WAT A;  3RQG A;  4HTE A;  5T1D B;  2TMV P;  1APC A;  5F28 E;  1A7E A;  3CZ6 A;  3LLI A;  2L7A A;  5F5F A;  2LFF A;  2OJ4 A;  2FAP B;  3DD7 A;  1T01 A;  1Y6D A;  1YVI A;  3S9O A;  4CS7 A;  2PF4 E;  4JCZ A;  5KYU A;  1LPE A;  2VCB A;  1RCP A;  2Y3B A;  2H7B A;  1I4Y A;  2WB7 A;  4LAC B;  1M2V B;  5IY5 C;  1YA7 O;  1C02 A;  3KRX A;  1FMV A;  1CGN A;  4EKD B;  2A6H F;  1VYI A;  2JM5 A;  3C7K B;  4JJF A;  4LDK A;  1LS4 A;  3U3B A;  4ANJ A;  1LE2 A;  2KC3 A;  2R02 A;  1BDJ B;  2OWI A;  1WN0 A;  2VAS A;  3NKD A;  2XLV A;  3EPV A;  3J06 A;  2GDC A;  3HTK C;  4U5G A;  3ZQV A;  4XEK A;  2PNO A;  2G3V A;  5TJ5 E;  3DMD A;  1YJG A;  1E85 A;  2HFI A;  5EK0 A;  4Z9H A;  4YJW A;  2IYL D;  2P7V A;  3VF0 A;  2HJ3 A;  3HJC A;  3C62 A;  1H9G A;  1ORY A;  2PBE A;  3C7J A;  2KYH A;  3GOR A;  4DVZ A;  3GEE A;  1LI7 A;  2J0X A;  1YZC A;  2PP4 A;  3N2Z B;  1NFN A;  2VC9 A;  1ZHZ A;  1ZVZ A;  3S84 A;  3SZR A;  3IQ5 A;  2J0W A;  1VOM A;  2V26 A;  1VK5 A;  1FMW A;  3PVW A;  1AEP A;  1Z23 A;  3NYN A;  2HSQ A;  2NPU A;  5EHH A;  2QY9 A;  2IBF A;  1N1C A;  3EGD A;  1MND A;  1VLT A;  3EGX A;  1GM5 A;  4RBN A;  3V7O A;  1RXQ A;  3KKB A;  2EIK C;  1QLE C;  3IQT A;  1FTS A;  3V5Y A;  3QVZ A;  4YT8 A;  4Q5S F;  4JTD B;  2Y69 C;  1OMW A;  1ORS C;  2WVN A;  3LS1 A;  5DS6 A;  5JVE A;  4C3E A;  1D0X A;  1LI5 A;  4H54 A;  3NMJ A;  3UMK A;  5L3V A;  4D4N A;  2QNL A;  1Q0K A;  2ZXP A;  4ONS A;  1OCC C;  3JZ0 A;  2C03 A;  3H2V A;  3ASO C;  3LEV A;  3NYM A;  4NQF A;  4XWJ A;  3ZTZ A;  1VB5 A;  2XXA B;  3L8J A;  2R7O A;  3B0P A;  4AK9 A;  3DE9 A;  4AL0 A;  1H9T A;  1WGW A;  1TFO B;  5A6J A;  3KYI A;  3O39 A;  4XPX A;  2R7S A;  4MK0 A;  2YVK A;  3GEH A;  2GTP C;  1IW7 F;  4JZA A;  2DI3 A;  5COM A;  1EQ1 A;  1FQK B;  2R03 A;  1OXK A;  4CS8 A;  1YAU O;  2ASR A;  1YLM A;  2KW3 C;  3C7L A;  4JEB A;  1M2V A;  3O10 A;  1HW1 A;  5E3A A;  5AGF A;  3U3F A;  1SF8 A;  4CIH A;  4OIP F;  1SZI A;  1LVK A;  3ZWI A;  4XLN F;  1D1C A;  4U5B E;  3KH2 A;  2D9J A;  2D5R B;  1OQC A;  1FQJ B;  2EIL C;  3U2L A;  4U5C E;  2ZXO A;  3WHN A;  1HMO A;  2EIN C;  1QSP A;  2R7Q A;  1Q0M A;  1OKK D;  3IEE A;  3LJB A;  3Q6N A;  1C03 A;  4EIY A;  3AGT A;  4I44 A;  3RVZ A;  2CNW A;  1JMW A;  3U5S A;  2XS8 A;  4W8K A;  4IB4 A;  4IWB A;  2G3K A;  2EPN A;  2HV7 A;  2IOQ A;  3AJM A;  3PVU A;  5KYY B;  2XRH A;  1I4Z A;  1C17 M;  2ZXR A;  3RVY A;  4JCH A;  1G8X A;  4IRU A;  4YN0 B;  3EH2 A;  3N24 A;  1QVX A;  3ZC4 A;  2A1D D;  3KL4 A;  3H2U A;  1MNE A;  1T6Q A;  3EQL F;  4KC9 A;  1ZHT A;  1AVO B;  1W2W A;  3KPH A;  1KU2 A;  5FCL A;  2A68 F;  3GM1 A; 
#chains in the Genus database with same CATH homology
 3OEO A;  3RKO F;  2M4E A;  1QZX A;  1NG1 A;  3L34 A;  5KYN A;  3PHF 2;  3AG1 C;  1BR4 A;  3VYW A;  4O6N A;  4CSA C;  3DAG A;  1V55 C;  2MWQ A;  4JW1 A;  3UMI A;  1NU9 C;  3T6J A;  3L0I A;  2ZPA A;  1D0Z A;  1D1A A;  3ZIB A;  1IZM A;  2XXA A;  1TWH A;  3PMR A;  3LLK A;  2HV6 A;  3W8I A;  5DS5 A;  3EGD B;  1ZHY A;  1OCZ C;  2A69 F;  3UGO A;  4OIO F;  2Z15 A;  3JYH A;  4DVY P;  1JPN A;  2R7X A;  2IXN A;  1BR2 A;  2Y39 A;  4H4K C;  5KYW B;  1LKX A;  4PFP A;  4G7O F;  3UGP A;  5B1A C;  4LLE A;  4RDA A;  4O7G A;  5DQZ A;  4CBE A;  3T6B A;  2EIM C;  3LS0 A;  1D0Y A;  5KYY A;  4PJJ A;  3HLZ A;  2W9Y A;  5DLJ A;  5D91 A;  2W45 A;  4JVS A;  4MQ9 F;  4BG0 A;  3Q7G A;  4YWQ A;  3NRH A;  2YEV A;  3JRT A;  2Q9B A;  1ZYR F;  3E70 C;  1LS1 A;  3F46 A;  3JT1 A;  2XSE A;  1BR1 A;  2R7T A;  3DAF A;  4XTK A;  2H7O A;  2FGY A;  3DXJ F;  2DGJ A;  4JJG A;  4QDL A;  3FHD A;  1Z3I X;  2J7P A;  4K7B A;  3DJU B;  2CNW D;  2Y3D A;  1NZE A;  1VYK A;  3SEO A;  4CSA A;  3K1H A;  2J9V A;  2KGO A;  4CS9 C;  3EFO B;  2W4M A;  3EG9 B;  4OD5 A;  5KYW A;  5HSW A;  3EJN A;  2L9J A;  2DYR C;  4KNV A;  2PFD A;  3JSZ A;  2VH3 A;  4O79 A;  2O9X A;  3O6X A;  2C04 A;  2Q9C A;  4I1O B;  2Q3T A;  2KNH A;  1MMA A;  3K7D A;  3ABM C;  1ST6 A;  2NG1 A;  2OG2 A;  4HE8 D;  5EGY A;  4LER A;  2R7U A;  2J46 A;  5KYX B;  3AG4 C;  2CDQ A;  4NY3 A;  3ZSU A;  2YZS A;  1Z63 A;  3AQB A;  5T3T A;  3W2V A;  3NYJ A;  5DQT A;  2X51 A;  3E9V A;  4DBR A;  3TD7 A;  4OIQ F;  3S28 A;  4U5H A;  4C3D A;  1ZU4 A;  3MX3 A;  5B3S C;  4LLC A;  3ITF A;  3GAN A;  3X2Q C;  4BJT A;  4U5D E;  4GYT A;  5BUO A;  3K66 A;  3W2W A;  3B0U X;  2YHS A;  3S27 A;  3EFO A;  3EG9 A;  3FVY A;  3DM5 A;  4MND A;  5F5H A;  4ZLD A;  4X0R A;  2W4B A;  5CI8 A;  1M56 C;  3WOD F;  3POV A;  2I8B A;  3LAY A;  4E7S A;  2GFH A;  1TWC A;  3ABL C;  3GOD A;  1VMA A;  1ZHX A;  4HEA J;  5E3C A;  1OCO C;  4FES A;  2CW0 F;  1Z6A A;  3B9Q A;  3S29 A;  4CS9 A;  1OCR C;  3ZVR A;  5KYX A;  4U5E E;  3K1I C;  3I5Q A;  3RH3 A;  4J30 B;  4F4B A;  2DYS C;  3SNH A;  4KI2 A;  3AQC A;  4BEJ A;  1D1B A;  2Y3H A;  2R7R A;  4RD9 A;  4B6I A;  3S0X A;  3OWT A;  4M63 A;  3NKE A;  2R7W A;  4PJN A;  3DJN B;  1ZHW A;  4P6I C;  5CI9 A;  4DBQ A;  4N06 A;  2Q9A A;  3RIP A;  1J8Y F;  3UR3 C;  3ZG1 A;  3B0V C;  2L81 A;  4O6Y A;  1SMY F;  2FFH A;  1ZU5 A;  3Q7L A;  4G7H F;  4K0D A;  2H7V C;  3EZI A;  4C7O B;  3N0T A;  3FAJ A;  4AE4 B;  4G7Z F;  2ZXW C;  4YT4 A;  3I4U A;  1FFT C;  2WZL A;  4J32 B;  4AX2 A;  4KBL A;  3MLG A;  5E33 A;  1M2O A;  3QZC A;  4I3M A;  4BJ6 C;  2PX3 A;  3W8H A;  2WVQ A;  3F47 A;  4IAO A;  3EH1 A;  1TWA A;  3I5P A;  4G0H A;  4OIR F;  2NUT B;  2Y3G A;  1V54 C;  2WZG A;  3FDQ A;  2A6E F;  2IXM A;  3AG3 C;  4QI0 A;  2LSE A;  3SP1 A;  4JUR I;  3DM9 B;  1TR2 A;  3CQZ A;  2NUP A;  4O6M A;  3M1C B;  3CSK A;  5L3Q A;  3NG1 A;  4WJ0 A;  3H65 A;  4PFO A;  4Q7C A;  3VAY A;  1TKN A;  4BJ5 C;  1MMG A;  1MMD A;  3DZA A;  1RJ9 B;  3RFY A;  4IJJ A;  2G62 A;  2MYS A;  4YT2 A;  3EHM A;  3LNR A;  5E2Q A;  1JPJ A;  4DOZ A;  4HFF B;  4OD4 A;  1MMN A;  2IXO A;  5DVW A;  4I1M A;  5B1B C;  2R7V A;  4C7O A;  2E87 A;  4ZLC A;  1TWG A;  4AE4 A;  4FX5 A;  4BJ1 A;  5DS4 A;  2EIJ C;  3LES A;  4ULW A;  2QTV A;  3ABK C;  2KJG A;  2BE5 F;  1PCX A;  3AG2 C;  2J9U A;  3RYL A;  3Q6M A;  2PX0 A;  4U5F E;  3OA1 A;  3UMH A;  2P6V A;  2WZF A;  2V3C C;  5KYU B;  2J9W A;  2VB6 A;  3KMI A;  2IXP A;  5T3W A;  4A2N B;  2NUT A;  3X1O A;  3EHN A;  4FWV A;  1M57 C;  4EWC A;  2CGE A;  1PD0 A;  3UNG C;  1PD1 A;  3K33 A;  3K6B A;  4E7Z A;  3QMK A;  2JD3 A;  2XL4 A;  3ASN C;  4BJ6 A;  1Z5Z A;  4HFK B;  1FFH A;  3NYL A;  4PJL A;  3T4R A;  4KNW A;  4PJM A;  1S7Z A;  3WG7 C;  1RJ9 A;  5D92 A;  2J7P D;  2KQ9 A;  3SYN A;  2NUP B;  4XLP F;  2WVO A;  4PK4 A;  4YT5 A;  3ECS A;  1OKK A;  1O87 A;  1O5H A;  2WL8 A;  3EGX B;  2J45 A;  3JCU Q;  4EBB A;  4C3B A;  4BJ5 A;  4CS8 C;  3NDB B;  4QI2 A;  2OCC C;  4Q4Z F;  2B0J A;  1NU7 D;  3EZH A;  4GEH A;  4OIN F;  1J8M F;  4HTE A;  5T1D B;  3LLI A;  3CZ6 A;  5F5F A;  3DD7 A;  4CS7 A;  2PF4 E;  5KYU A;  2Y3B A;  2H7B A;  2WB7 A;  4LAC B;  1M2V B;  5IY5 C;  1FMV A;  1VYI A;  2A6H F;  4JJF A;  4ANJ A;  2VAS A;  3NKD A;  3EPV A;  3HTK C;  4U5G A;  2G3V A;  3DMD A;  4YJW A;  2IYL D;  2P7V A;  3HJC A;  4DVZ A;  2J0X A;  2PP4 A;  3N2Z B;  1ZHZ A;  3SZR A;  2J0W A;  1VOM A;  2V26 A;  1VK5 A;  1FMW A;  1Z23 A;  5EHH A;  2QY9 A;  1N1C A;  3EGD A;  1MND A;  3EGX A;  4RBN A;  3V7O A;  3KKB A;  2EIK C;  1QLE C;  1FTS A;  4YT8 A;  4Q5S F;  2Y69 C;  2WVN A;  5DS6 A;  3LS1 A;  4C3E A;  1D0X A;  3UMK A;  5L3V A;  2ZXP A;  1OCC C;  2C03 A;  3NYM A;  3ASO C;  3LEV A;  2XXA B;  4XWJ A;  4AK9 A;  2R7O A;  3B0P A;  1WGW A;  3O39 A;  2R7S A;  1IW7 F;  4JZA A;  4CS8 A;  2KW3 C;  5E3A A;  1M2V A;  4OIP F;  4CIH A;  1SF8 A;  1SZI A;  1LVK A;  4XLN F;  1D1C A;  4U5B E;  3KH2 A;  2D5R B;  2EIL C;  4U5C E;  2ZXO A;  2EIN C;  2R7Q A;  3LJB A;  3IEE A;  1OKK D;  3Q6N A;  4I44 A;  2CNW A;  4W8K A;  4IWB A;  2G3K A;  2HV7 A;  2IOQ A;  5KYY B;  2XRH A;  2ZXR A;  4JCH A;  1G8X A;  4IRU A;  4YN0 B;  3EH2 A;  3N24 A;  3ZC4 A;  2A1D D;  3KL4 A;  1MNE A;  3EQL F;  4KC9 A;  1ZHT A;  1W2W A;  1KU2 A;  5FCL A;  2A68 F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...