3I5QA

Nup170(aa1253-1502) at 2.2 a, s.cerevisiae
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
248
Chain Sequence
b'IVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 83
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.20 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 3i5qA02
1.20.120.1050 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5qA01
3I5QA
chains in the Genus database with same CATH superfamily
1LPEA 2G3KA 1RXQA 1LM3B 4MW3A 2W45A 4JW1A 5TJ5E 5KYWB 3EQLF 4CS8C 3FHDA 3JYHA 3CAXA 4JVSA 4MW8A 4Z9JA 4P9FA 1Q0DA 2VB6A 4NQFA 1NLXA 4XPXA 4HE8D 2ETSA 3H2VA 1WGWA 3JYYA 3C8ZA 3R2PA 5T3WA 2R7WA 2HKVA 1ZU5A 3HNLA 2RD9A 1W2WA 4XEKA 1NBBA 2XLMA 1OXKA 4HFFB 2X0CA 3ZDLA 1XZPA 5DS6A 2HZ8A 4MVZA 1M6TA 1Y4CA 5K0IA 3ASOC 2ZXPA 3DZAA 3EZHA 1OR3A 3DM5A 4JIOA 2J9BA 3PVWA 3IQ6A 3DAFA 1OKKA 3H2UA 2H7BA 2WL8A 3ATPA 4JTDB 3DE9A 3JTLO 4FAPB 2IHBB 3IPMO 4WGYA 1ZZPA 4CS9C 1DOWA 2OCCC 3V5WA 1K04A 1Z6AA 2JD3A 2Q9AA 2YWAA 3FOOA 1U0BB 3GORA 4CX9A 3LEOA 4R32A 1JMWA 1ZHTA 3GM2A 2Q9CA 2Y3GA 2ICWG 3I5PA 3QVYA 1PCXA 2GTPC 2I8BA 4MVUA 4U5DE 4Z9HA 4ANJA 3LAYA 4BJ5A 4DRHB 3TQOA 1Z5ZA 2XSEA 3KPHA 3MBGA 2IK8B 2R7OA 1D0ZA 1OCOC 4OIOF 4BEMJ 5BUOA 2YVKA 1E85A 2R7XA 4Z9IA 1T9KA 3W2VA 3B29A 1OKKD 4NC3A 4IARA 4P6IC 1YVIA 4PACA 4JKVA 3GWNA 4OD4A 4JEAA 4XPYA 4AE4B 1YYXA 2DI3A 2XLOA 2LIGA 4P9TA 4YT5A 5E3CA 4CS9A 2HJMA 4DVYP 3KH2A 2R7TA 3ASNC 1APCA 4EBJA 5CIVA 3IQCA 2Y3DA 3GODA 4QI2A 2A0UA 1RCPA 1HY5A 2OEVA 1YA7O 5AC4A 1VMAA 1QZXA 2HSQA 2QNLA 5JT4A 2HV7A 3FVYA 5JSLA 1HW2A 2ZXOA 5HV9A 3L8IA 3VAYA 3VRCA 4CIHA 2J7PA 2HFIA 3ITFA 1LS1A 2CRPA 3EHNA 1AEPA 1GGQA 1YJGA 2KC3A 2M64A 3MX3A 3K1IC 1DK8A 1HMOA 1PV3A 3EG9B 3V7OA 4XEVA 2VH3A 3NMJA 1LI5A 4AK9A 1WWPA 1HMDA 2MHRA 1EZTA 2EIKC 3JRMO 3S84A 4AX2A 2LFDA 2QY9A 1H9GA 2PX3A 2ZXRA 3M79A 4JJFA 5L0CA 3B0PA 4K1OA 2VC9A 3U9MA 3H65A 4YT8A 3C7JA 1J8MF 3SEOA 4XLNF 5DQZA 1T01A 3G4ZA 4U5BE 3TOMA 2QLAA 4U5CE 1GS9A 4OD5A 5L3QA 4YT4A 1YA9A 2FFHA 2YLIA 1Z7Qc 1OW8A 2M4EA 4J7YA 1WTYA 2QUPA 2PNOA 3AJMA 4EHPA 4DBQA 3GWLA 2EPOA 5HE1A 2J7PD 3OA1A 4IJJA 1QLEC 2XLVA 3CQZA 4PNKA 1OW6A 1D1CA 2ZD9A 3DMDA 4N6HA 1TFKB 3K1IA 5HE0A 4U9EA 3NMIA 4OIRF 5A6BA 4JJGA 2EPKX 1ZHZA 1LIHA 4NTAA 5FZTA 5L0JA 2A6HF 1SMYF 3PHF2 2L7AA 1M2OA 1Q0KA 3TOLA 2OKUA 4KI2A 2IXOA 4O6YA 2P7VA 3SXYA 3CZ6A 1Y6DA 1Z3IX 5BQGA 4TNBA 4B6IA 4EBBA 1KTMA 1A7VA 1GQAA 1Q0MA 5A6KA 2P6VA 2NSGA 2XLEA 4EKWA 3BEHA 2YRFA 3W8HA 2J46A 1D1AA 3OWTA 4PJMA 2EINC 1TFOB 3M4CA 4JE9A 2OG2A 2KQ9A 2VCAA 4MTOA 3UMKA 2OWIA 4TNDA 4NTBA 4CJGA 1TKNA 3GM3A 2JPUA 1D0XA 1OCRC 2IXNA 2J9WA 4N6CA 4BEJA 1V55C 4LLCA 1FMWA 1FMVA 4PR9A 2Q7RA 5L0FA 3AQBA 4Q4ZF 4RBNA 1MMAA 2PF4E 1TWAA 5JVEA 3SXMA 4MS2A 5F28E 4E7ZA 1JR8A 1HE1A 2DGJA 1XWJA 3SNHA 3N24A 3FXHA 1MMGA 4O7GA 5JLIA 1T6UA 4RDAA 4C3DA 4CJOA 2WZLA 4AE4A 4E17A 5DO9B 1ZYRF 1FQIA 3L8JA 3NYLA 4DRIB 2NUPB 3Q6NA 4OIPF 1T6QA 2H7VC 2H7OA 3ZSUA 5L0GA 2YLGA 5DS4A 1CPRA 1Q0FA 1I5NA 1IZMA 1JOGA 4EBKA 2A68F 4C3EA 4JEBA 3KMIA 5T3TA 2PFDA 3SYNA 2KYHA 2R02A 4JTCB 2O9XA 4YL1A 2L6HA 2LCHA 4WJ0A 2TMVP 2DYSC 4CDYA 2QE9A 2KSFA 3WAQA 3LNRA 2WB7A 3N0TA 2W9YA 4DBRA 1EZYA 4JCHA 3DE8A 4RD9A 4D4NA 1ORJA 3NG1A 2A0BA 4H4KC 5E2QA 5AC5A 3PDMP 3EPVA 1YZCA 3EHMA 4W8KA 3EG9A 3RVYA 4BJ6A 2XM0A 2CNWD 4CS8A 3NYNA 1ZW3A 2OOCA 4BJ5C 4MTFA 4EUKB 2B0JA 3C63A 2LQGA 1BZ4A 4YT2A 3HNKA 5COGA 1FAPB 2HMQA 2G3VA 2YL0A 2L6GA 3RIPA 1K40A 2EIJC 3QW0A 3E70C 1LKXA 2ODEB 2RSEB 4QDLA 2VCCA 4CDVA 5JUAA 4C3BA 3UZTA 3I4UA 4U5GA 4G7HF 3C8GD 5JS5A 3DKAA 2Q00A 3NMKA 1B68A 2YQYA 4MVSA 2KK1A 4EKDB 2XLHA 1OCCC 5EGYA 2XRHA 2WVOA 3PSCA 1YYJA 5GPGB 4BJTA 1C02A 5EHHA 2WVQA 2XL6A 5COMA 3VM6A 2C03A 4YN0B 3RVZA 2KJGA 3AG3C 4U9DA 2R05A 2D5RB 2IYLD 3W4YA 1LE4A 1YAUO 1MQVA 1LI7A 256BA 3QMKA 1E2XA 2AWCA 4ZLCA 4Q5SF 1BBHA 3ZTMA 3I5QA 4ONSA 3SXKA 2HUJA 3L1MA 5CI9A 2ASRA 5T1DB 1V54C 1ORSC 3Q7LA 4M63A 5DLJA 1RKEB 2W4BA 5F5FA 2IBFA 5HE3A 1ZW2A 2UUIA 5KYYB 1VB5A 5KYXB 4G7ZF 2YHSA 2X51A 3PCVA 2V26A 1SF8A 4CBEA 3RF3A 4E0IA 5BQIA 4UDVA 3NRHA 3U3BA 2EBZA 4J32B 1MNEA 4J7TA 3HLZA 5AGFA 2PP4A 1F1MA 2AP3A 5IY5C 1R5ID 3C8GB 2CGEA 3GM1A 3AQCA 3HNIA 1EA8A 2EPLX 4C7OB 1BR4A 1VLTA 3LS0A 3JSEO 3C7KB 2BT2A 4LACB 4CSAC 5E33A 3ECSA 2NUPA 2J0XA 3ZQVA 3J06A 2L81A 1EI7A 1HW1A 1OCZC 1R4TA 4K7BA 4IRUA 5COFA 3GEHA 4J30B 4XWJA 3RQEA 1JPNA 4IGGA 1FNTc 1RMVA 3HKKA 5L0IA 1JPJA 5DQTA 2OJED 4NY3A 1WN0A 1E84A 2PBEA 1RJ9B 1PD0A 2KW3C 2HV6A 2YEVA 4LDRA 2BCJA 1XZQA 2XS1A 4NTFA 5EK0A 1G4US 1SYQA 4OIQF 4OINF 3LEVA 3EH2A 1CGOA 3JRTA 2V3CC 2BV1A 2Y69C 2D9JA 4Q7CA 4A4AA 1OQCA 2Y3HA 3ZG1A 4CSAA 2HSBA 3DJUB 3W8IA 4AL0A 2KGOA 1TWCA 1KNYA 2R7QA 5D92A 2LSEA 3K1HA 1QPUA 3RFYA 3PMRA 1EKYA 1FQKB 1BDJB 3GEIA 2NG1A 3TULA 2IOQA 1QQ3A 4W8PA 1KU2A 1Z23A 1SZIA 4XPWA 4JURI 2EPNA 3RQGA 4E18A 4PJJA 1VK5A 3GANA 1TR2A 3RYLA 3DM9B 3UGOA 1VLSA 1ORYA 1NFNA 1YLMA 4IB4A 3IEEA 3KRWA 2WZGA 3U8VA 2I15A 4BG0A 4YWQA 1OW7A 2J9UA 1MMNA 1H7IA 2CCYA 2CDQA 1ZHXA 3AGUA 2QTVA 3MYIA 5JP7A 3ABLC 1AVOB 5A6AA 1S05A 5D91A 2ZPAA 3HTKC 4U5FE 4CIPA 2C04A 2YL7A 3V5ZA 2V4ZB 3S90A 1TWGA 4JRZA 1OR2A 4ULWA 3IQ5A 1RKEA 4MVRA 4BJ6C 1TQGA 2BE5F 2CNWA 3FAJA 3C7LA 1JRAA 2Z15A 3EGXB 3KL4A 1L3PA 3TJ5A 3PVUA 2Q3TA 4BPMA 5KYXA 3B0VC 1TWHA 3ZQYA 3LUTB 2DB4A 3VF0A 2NUTB 4XQ1A 1I4YA 2A6EF 2R03A 3LESA 4DVZA 2XLWA 4XTKA 1FFTC 1VYKA 3C8GA 4O6MA 3UGPA 1G4WR 2R7VA 4GEHA 1V4AA 1Z63A 4C7OA 1NU7D 4PJLA 2J45A 2VCBA 3IQTA 3O6XA 4FESA 4NCQA 3M1CB 4I1MA 3WG7C 3ZIBA 4MVQA 3U9JA 4GYTA 3O55A 1MNDA 2BL2A 1NFOA 1A41A 2EILC 3L0IA 3LJBA 3LNMB 1A7DA 2HMZA 3KYIA 2Q4FA 3T4RA 2CW0F 3U0CA 3DI5A 3L34A 2G62A 5B1BC 2MWQA 1MMDA 2PX0A 2A1DD 4XLPF 3C18A 4O79A 2D4UA 4EIYA 1WOLA 3C62A 2OEXA 2AWYA 1L7CA 5E3AA 3E9VA 2XXAB 2UUHA 1EQ1A 3AG1C 3ZWIA 1RJ9A 4XEFA 5DVWA 1O3UA 2JM5A 4DRJB 2XL8A 4K0DA 1AUEA 4X0RA 3UNGC 2F22A 5L3VA 1IW7F 4E7SA 1RKCA 2Q9BA 5L0HA 4LERA 3RKOF 1VTMP 1D1BA 1ZHYA 2R7SA 1WASA 3G50A 1YDIA 1H9TA 1LVKA 1O87A 2B0HA 2EIMC 2IXMA 1FQJB 1NSGB 1ZHWA 4HEAJ 3JT1A 4KBLA 2Y3BA 3T6BA 1QKRA 3FMSA 4CS7A 2FAPB 1PD1A 2FGYA 4WGZA 1E83A 2R7RA 1C17M 4MVMA 5KYYA 3NYMA 4PK4A 3S9OA 1G8XA 2HS5A 1ZU4A 2DLVA 1JAFA 3FOPA 5KYUB 3CEXA 3MFNA 3FDQA 1FFHA 1M2VB 1ZVZA 3EFOB 4PJNA 3TK0A 2JNUA 4LDKA 3DXJF 2R9RB 4H54A 2J9VA 2OJQA 3B71A 3NKEA 3W2WA 4MK0A 2AU5A 4U5HA 5B1AC 1N1CA 3K6BA 2NPUA 2OU6A 3RQFA 3NYJA 3ZC4A 1AGRE 3DAGA 2VASA 3K66A 4G0HA 3X2QC 1D0YA 2L9JA 5L0DA 1M57C 5F5HA 1EMUA 2IXPA 4I44A 4O6NA 4I1OB 4JC7A 3X1OA 2P61A 4ULVA 4A2NB 2W4MA 3AG2C 3F47A 3LS1A 1YZAA 1J8YF 2NSFA 4KNVA 3T6GB 3UR3C 3S27A 1T5OA 3K7DA 3NDBB 1FTSA 3QVZA 5B3SC 3LLKA 2WZFA 3EGXA 3WHNA 2AF0A 2L6FA 2IHDA 3JCUQ 2XS8A 1CGNA 2BC5A 3M15A 1YARO 2NUTA 3EGDB 5BQHA 2LK4A 2KNHA 1A0BA 1QVXA 4CDAA 3KYJA 1C03A 2YKZA 4IAQA 4MNDA 1OMWA 3IHUA 2WVNA 1I4ZA 5DS5A 5B3IA 1LE2A 4E0HA 1T6IA 4KNWA 3A9CA 4YL3A 3VYWA 4G7OF 3MLGA 2YZSA 1UFBA 2CYDA 4HFKB 3ABMC 3QZCA 4L6RA 4PFOA 4D4XA 2P0NA 4FWVA 3V5XA 3Q7GA 3MYFA 2XLDA 3NYOA 3S29A 3U2LA 1K05A 3FAPB 4PFPA 2J0WA 3EH1A 4ER9A 1ST6A 1V74B 3U8PA 3AGTA 3DWWA 3GEEA 3G4XA 3NKDA 3B0UX 3RH3A 2YL1A 4MVOA 2XXAA 2ZXWC 4JTAB 4EWCA 4QI0A 1VOMA 5KYWA 4I3MA 3UMHA 3EJNA 3EZIA 2MYSA 4LDQA 2YLDA 2LP4A 1LS4A 4YK5A 3A11A 3DJNB 3K33A 1WATA 3RW0A 4DOZA 4MTGA 1CMZA 2XM4A 1E86A 2P1AA 3B9QA 3HNJA 3Q6MA 4F4BA 1DOVA 4IWBA 3BRJA 4YJWA 1G5ZA 4DXWA 3JZ0A 4JCZA 3F46A 1NU9C 2HJ3A 2XL4A 3U3FA 1H6GA 3ZTZA 1VYIA 2J8WA 3KKBA 1HE9A 3QTHA 3TD7A 5KYNA 1FR0A 3LLIA 2GFHA 4FX5A 4LLEA 3DD7A 4ZLDA 2GWWA 1BR2A 2EPMX 1A7EA 2Y39A 3UMIA 3HJCA 1U6HA 3CSKA 5KYUA 4U5EE 3O39A 3O10A 2A69F 4G78A 4DJ9A 1M2VA 3EFOA 3QW1A 3T9OA 5A69A 1GM5A 1Q0GA 2E87A 4WABA 1CPQA 3KRXA 2GA0A 3US6A 2LFFA 1M56C 3V5YA 1NZEA 3CIKA 3S0XA 2OQMA 1OXBA 2R7UA 2OJ4A 4N06A 3U2MA 2GAQA 1UG7A 2R25A 3JSZA 5CI8A 3AOUA 5JRAA 5A6BD 1CGME 1S7ZA 4IAOA 1NG1A 4N4WA 5HSWA 3R7CA 2AVKA 3TJ6A 3M4BA 4HTEA 3AG4C 3T6JA 3ZVRA 1O5HA 4AL1A 4JZAA 3SXZA 3U5SA 2JX0A 4BJ1A 2H8AA 1SR2A 5FCLA 4KC9A 3OEOA 5HE2A 3SP1A 3EGDA 2LD6A 3S28A 1U89A 5A6JA 4MQ9F 3ABKC 3WODF 4YL0A 3N2ZB 3POVA 4GQHA 2YL3A 1BR1A 2IM8A 1QSPA 3SZRA 2DYRC 2GDCA
chains in the Genus database with same CATH topology
2G3KA 2W45A 4JW1A 5KYWB 3EQLF 3FHDA 3JYHA 4JVSA 2VB6A 4HE8D 1WGWA 5T3WA 2R7WA 1ZU5A 1W2WA 4HFFB 5DS6A 3ASOC 2ZXPA 3DZAA 3EZHA 3DM5A 3DAFA 1OKKA 2H7BA 2WL8A 4CS9C 2OCCC 2JD3A 1Z6AA 2Q9AA 1ZHTA 3I5PA 2Q9CA 2Y3GA 1PCXA 2I8BA 4U5DE 4ANJA 3LAYA 4BJ5A 1Z5ZA 2XSEA 2R7OA 1D0ZA 1OCOC 4OIOF 5BUOA 2R7XA 3W2VA 1OKKD 4P6IC 4OD4A 4AE4B 5E3CA 4CS9A 4DVYP 4YT5A 2R7TA 3KH2A 3ASNC 4QI2A 2Y3DA 3GODA 1VMAA 1QZXA 2HV7A 3FVYA 2ZXOA 3VAYA 4CIHA 2J7PA 3ITFA 1LS1A 3EHNA 3MX3A 3K1IC 3V7OA 3EG9B 2VH3A 4AK9A 2EIKC 4AX2A 2QY9A 2PX3A 2ZXRA 4JJFA 3B0PA 3H65A 4YT8A 1J8MF 3SEOA 4XLNF 5DQZA 4U5BE 4U5CE 5L3QA 4OD5A 4YT4A 2FFHA 2M4EA 4DBQA 3OA1A 2J7PD 4IJJA 1QLEC 3CQZA 3DMDA 1D1CA 4CSAA 4OIRF 4JJGA 1ZHZA 2A6HF 1SMYF 3PHF2 1M2OA 4KI2A 2IXOA 4O6YA 2P7VA 3CZ6A 1Z3IX 4B6IA 4EBBA 2P6VA 3W8HA 2J46A 1D1AA 3OWTA 4PJMA 2EINC 2OG2A 2KQ9A 3UMKA 1TKNA 1D0XA 1OCRC 2IXNA 2J9WA 4BEJA 1V55C 4LLCA 1FMWA 1FMVA 4Q4ZF 3AQBA 4RBNA 1MMAA 2PF4E 1TWAA 4E7ZA 3SNHA 2DGJA 3N24A 4O7GA 1MMGA 4C3DA 4RDAA 2WZLA 4AE4A 1ZYRF 3NYLA 2NUPB 3Q6NA 4OIPF 2H7VC 2H7OA 3ZSUA 5DS4A 1IZMA 2A68F 4C3EA 3KMIA 5T3TA 2PFDA 3SYNA 2O9XA 4WJ0A 2DYSC 3LNRA 2WB7A 3N0TA 2W9YA 4DBRA 4JCHA 4RD9A 3NG1A 4H4KC 5E2QA 3EPVA 3EHMA 4W8KA 3EG9A 4BJ6A 2CNWD 4CS8A 4BJ5C 2B0JA 4YT2A 2G3VA 3RIPA 2EIJC 3E70C 1LKXA 4QDLA 4C3BA 3I4UA 4U5GA 4G7HF 5EGYA 1OCCC 2XRHA 2WVOA 4BJTA 5EHHA 2WVQA 2C03A 4YN0B 2KJGA 3AG3C 2D5RB 2IYLD 3QMKA 4ZLCA 4Q5SF 3I5QA 5CI9A 5T1DB 1V54C 3Q7LA 4M63A 5DLJA 5F5FA 2W4BA 5KYYB 5KYXB 4G7ZF 2YHSA 2X51A 2V26A 1SF8A 4CBEA 3NRHA 4J32B 1MNEA 3HLZA 2PP4A 5IY5C 2CGEA 3AQCA 4C7OB 1BR4A 3LS0A 4LACB 4CSAC 5E33A 3ECSA 2NUPA 2J0XA 2L81A 1OCZC 4K7BA 4IRUA 4XWJA 4J30B 1JPNA 1JPJA 5DQTA 4NY3A 1RJ9B 1PD0A 2KW3C 2HV6A 2YEVA 4OIQF 4OINF 3LEVA 3EH2A 3JRTA 2V3CC 2Y69C 4Q7CA 3ZG1A 2Y3HA 3W8IA 3DJUB 2KGOA 1TWCA 2R7QA 5D92A 2LSEA 3K1HA 3RFYA 3PMRA 2NG1A 2IOQA 1KU2A 1Z23A 1SZIA 4JURI 4PJJA 1VK5A 3GANA 1TR2A 3RYLA 3DM9B 3UGOA 3IEEA 2WZGA 4BG0A 4YWQA 2J9UA 1MMNA 2CDQA 1ZHXA 2QTVA 3ABLC 5D91A 2ZPAA 3HTKC 4U5FE 2C04A 1TWGA 4ULWA 4BJ6C 2CNWA 2BE5F 3FAJA 3KL4A 4CS8C 3EGXB 2Z15A 5KYYA 5KYXA 2Q3TA 3B0VC 1TWHA 2NUTB 2A6EF 3LESA 4DVZA 4XTKA 1FFTC 1VYKA 4O6MA 3UGPA 2R7VA 4GEHA 1Z63A 4C7OA 1NU7D 4PJLA 2J45A 3O6XA 4FESA 3M1CB 4I1MA 3WG7C 3ZIBA 4GYTA 1MNDA 3LJBA 2EILC 3L0IA 3T4RA 2CW0F 3L34A 2G62A 5B1BC 2MWQA 1MMDA 2PX0A 2A1DD 4XLPF 4O79A 5E3AA 3E9VA 2XXAB 3AG1C 1RJ9A 5DVWA 4K0DA 4X0RA 3UNGC 5L3VA 1IW7F 4E7SA 3NDBB 2Q9BA 4LERA 3RKOF 1D1BA 1ZHYA 2R7SA 1LVKA 1O87A 2EIMC 2IXMA 1ZHWA 4HEAJ 4KBLA 4CS7A 3JT1A 2Y3BA 3T6BA 1PD1A 2FGYA 2R7RA 3NYMA 4PK4A 1G8XA 1ZU4A 5KYUB 3FDQA 1FFHA 1M2VB 3EFOB 4PJNA 3DXJF 2J9VA 3NKEA 3W2WA 4U5HA 5B1AC 1N1CA 3K6BA 3NYJA 3ZC4A 3DAGA 2VASA 3K66A 4G0HA 3X2QC 1D0YA 2L9JA 1M57C 5F5HA 4A2NB 2IXPA 4I44A 4O6NA 4I1OB 3X1OA 2W4MA 3AG2C 3F47A 3LS1A 4KNVA 1J8YF 3UR3C 3S27A 3K7DA 1FTSA 5B3SC 3LLKA 2WZFA 3EGXA 3JCUQ 2NUTA 3EGDB 2KNHA 4MNDA 2WVNA 5DS5A 4KNWA 3VYWA 4G7OF 3MLGA 2YZSA 4HFKB 3ABMC 3QZCA 4PFOA 4FWVA 3Q7GA 3S29A 4PFPA 2J0WA 3EH1A 1ST6A 3NKDA 3B0UX 3RH3A 2XXAA 2ZXWC 4EWCA 4QI0A 1VOMA 5KYWA 4I3MA 3UMHA 3EJNA 3EZIA 2MYSA 3K33A 3DJNB 4DOZA 3B9QA 3Q6MA 4F4BA 4IWBA 4YJWA 3F46A 1NU9C 2XL4A 1VYIA 3KKBA 3TD7A 5KYNA 3LLIA 2GFHA 4FX5A 4LLEA 3DD7A 4ZLDA 1BR2A 3UMIA 2Y39A 3HJCA 3CSKA 5KYUA 4U5EE 3O39A 2A69F 1M2VA 3EFOA 2E87A 1M56C 1NZEA 3S0XA 2R7UA 4N06A 5CI8A 3JSZA 1S7ZA 4IAOA 1NG1A 5HSWA 4HTEA 3AG4C 3T6JA 3ZVRA 1O5HA 4JZAA 4BJ1A 5FCLA 4KC9A 3OEOA 3SP1A 3EGDA 3S28A 4MQ9F 3ABKC 3WODF 3N2ZB 3POVA 1BR1A 3SZRA 2DYRC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5Q A; 
#chains in the Genus database with same CATH topology
 1LPE A;  2G3K A;  1RXQ A;  1LM3 B;  4MW3 A;  2W45 A;  4JW1 A;  5TJ5 E;  5KYW B;  3EQL F;  4CS8 C;  3FHD A;  3JYH A;  3CAX A;  4JVS A;  4MW8 A;  4Z9J A;  4P9F A;  1Q0D A;  2VB6 A;  4NQF A;  1NLX A;  4XPX A;  4HE8 D;  2ETS A;  3H2V A;  1WGW A;  3JYY A;  3C8Z A;  3R2P A;  5T3W A;  2R7W A;  2HKV A;  1ZU5 A;  3HNL A;  2RD9 A;  1W2W A;  4XEK A;  1NBB A;  2XLM A;  1OXK A;  4HFF B;  2X0C A;  3ZDL A;  1XZP A;  5DS6 A;  2HZ8 A;  4MVZ A;  1M6T A;  1Y4C A;  5K0I A;  3ASO C;  2ZXP A;  3DZA A;  3EZH A;  1OR3 A;  3DM5 A;  4JIO A;  2J9B A;  3PVW A;  3IQ6 A;  3DAF A;  1OKK A;  3H2U A;  2H7B A;  2WL8 A;  3ATP A;  4JTD B;  3DE9 A;  3JTL O;  4FAP B;  2IHB B;  3IPM O;  4WGY A;  1ZZP A;  4CS9 C;  1DOW A;  2OCC C;  3V5W A;  1K04 A;  1Z6A A;  2JD3 A;  2Q9A A;  2YWA A;  3FOO A;  1U0B B;  3GOR A;  4CX9 A;  3LEO A;  4R32 A;  1JMW A;  1ZHT A;  3GM2 A;  2Q9C A;  2Y3G A;  2ICW G;  3I5P A;  3QVY A;  1PCX A;  2GTP C;  2I8B A;  4MVU A;  4U5D E;  4Z9H A;  4ANJ A;  3LAY A;  4BJ5 A;  4DRH B;  3TQO A;  1Z5Z A;  2XSE A;  3KPH A;  3MBG A;  2IK8 B;  2R7O A;  1D0Z A;  1OCO C;  4OIO F;  4BEM J;  5BUO A;  2YVK A;  1E85 A;  2R7X A;  4Z9I A;  1T9K A;  3W2V A;  3B29 A;  1OKK D;  4NC3 A;  4IAR A;  4P6I C;  1YVI A;  4PAC A;  4JKV A;  3GWN A;  4OD4 A;  4JEA A;  4XPY A;  4AE4 B;  1YYX A;  2DI3 A;  2XLO A;  2LIG A;  4P9T A;  4YT5 A;  5E3C A;  4CS9 A;  2HJM A;  4DVY P;  3KH2 A;  2R7T A;  3ASN C;  1APC A;  4EBJ A;  5CIV A;  3IQC A;  2Y3D A;  3GOD A;  4QI2 A;  2A0U A;  1RCP A;  1HY5 A;  2OEV A;  1YA7 O;  5AC4 A;  1VMA A;  1QZX A;  2HSQ A;  2QNL A;  5JT4 A;  2HV7 A;  3FVY A;  5JSL A;  1HW2 A;  2ZXO A;  5HV9 A;  3L8I A;  3VAY A;  3VRC A;  4CIH A;  2J7P A;  2HFI A;  3ITF A;  1LS1 A;  2CRP A;  3EHN A;  1AEP A;  1GGQ A;  1YJG A;  2KC3 A;  2M64 A;  3MX3 A;  3K1I C;  1DK8 A;  1HMO A;  1PV3 A;  3EG9 B;  3V7O A;  4XEV A;  2VH3 A;  3NMJ A;  1LI5 A;  4AK9 A;  1WWP A;  1HMD A;  2MHR A;  1EZT A;  2EIK C;  3JRM O;  3S84 A;  4AX2 A;  2LFD A;  2QY9 A;  1H9G A;  2PX3 A;  2ZXR A;  3M79 A;  4JJF A;  5L0C A;  3B0P A;  4K1O A;  2VC9 A;  3U9M A;  3H65 A;  4YT8 A;  3C7J A;  1J8M F;  3SEO A;  4XLN F;  5DQZ A;  1T01 A;  3G4Z A;  4U5B E;  3TOM A;  2QLA A;  4U5C E;  1GS9 A;  4OD5 A;  5L3Q A;  4YT4 A;  1YA9 A;  2FFH A;  2YLI A;  1Z7Q c;  1OW8 A;  2M4E A;  4J7Y A;  1WTY A;  2QUP A;  2PNO A;  3AJM A;  4EHP A;  4DBQ A;  3GWL A;  2EPO A;  5HE1 A;  2J7P D;  3OA1 A;  4IJJ A;  1QLE C;  2XLV A;  3CQZ A;  4PNK A;  1OW6 A;  1D1C A;  2ZD9 A;  3DMD A;  4N6H A;  1TFK B;  3K1I A;  5HE0 A;  4U9E A;  3NMI A;  4OIR F;  5A6B A;  4JJG A;  2EPK X;  1ZHZ A;  1LIH A;  4NTA A;  5FZT A;  5L0J A;  2A6H F;  1SMY F;  3PHF 2;  2L7A A;  1M2O A;  1Q0K A;  3TOL A;  2OKU A;  4KI2 A;  2IXO A;  4O6Y A;  2P7V A;  3SXY A;  3CZ6 A;  1Y6D A;  1Z3I X;  5BQG A;  4TNB A;  4B6I A;  4EBB A;  1KTM A;  1A7V A;  1GQA A;  1Q0M A;  5A6K A;  2P6V A;  2NSG A;  2XLE A;  4EKW A;  3BEH A;  2YRF A;  3W8H A;  2J46 A;  1D1A A;  3OWT A;  4PJM A;  2EIN C;  1TFO B;  3M4C A;  4JE9 A;  2OG2 A;  2KQ9 A;  2VCA A;  4MTO A;  3UMK A;  2OWI A;  4TND A;  4NTB A;  4CJG A;  1TKN A;  3GM3 A;  2JPU A;  1D0X A;  1OCR C;  2IXN A;  2J9W A;  4N6C A;  4BEJ A;  1V55 C;  4LLC A;  1FMW A;  1FMV A;  4PR9 A;  2Q7R A;  5L0F A;  3AQB A;  4Q4Z F;  4RBN A;  1MMA A;  2PF4 E;  1TWA A;  5JVE A;  3SXM A;  4MS2 A;  5F28 E;  4E7Z A;  1JR8 A;  1HE1 A;  2DGJ A;  1XWJ A;  3SNH A;  3N24 A;  3FXH A;  1MMG A;  4O7G A;  5JLI A;  1T6U A;  4RDA A;  4C3D A;  4CJO A;  2WZL A;  4AE4 A;  4E17 A;  5DO9 B;  1ZYR F;  1FQI A;  3L8J A;  3NYL A;  4DRI B;  2NUP B;  3Q6N A;  4OIP F;  1T6Q A;  2H7V C;  2H7O A;  3ZSU A;  5L0G A;  2YLG A;  5DS4 A;  1CPR A;  1Q0F A;  1I5N A;  1IZM A;  1JOG A;  4EBK A;  2A68 F;  4C3E A;  4JEB A;  3KMI A;  5T3T A;  2PFD A;  3SYN A;  2KYH A;  2R02 A;  4JTC B;  2O9X A;  4YL1 A;  2L6H A;  2LCH A;  4WJ0 A;  2TMV P;  2DYS C;  4CDY A;  2QE9 A;  2KSF A;  3WAQ A;  3LNR A;  2WB7 A;  3N0T A;  2W9Y A;  4DBR A;  1EZY A;  4JCH A;  3DE8 A;  4RD9 A;  4D4N A;  1ORJ A;  3NG1 A;  2A0B A;  4H4K C;  5E2Q A;  5AC5 A;  3PDM P;  3EPV A;  1YZC A;  3EHM A;  4W8K A;  3EG9 A;  3RVY A;  4BJ6 A;  2XM0 A;  2CNW D;  4CS8 A;  3NYN A;  1ZW3 A;  2OOC A;  4BJ5 C;  4MTF A;  4EUK B;  2B0J A;  3C63 A;  2LQG A;  1BZ4 A;  4YT2 A;  3HNK A;  5COG A;  1FAP B;  2HMQ A;  2G3V A;  2YL0 A;  2L6G A;  3RIP A;  1K40 A;  2EIJ C;  3QW0 A;  3E70 C;  1LKX A;  2ODE B;  2RSE B;  4QDL A;  2VCC A;  4CDV A;  5JUA A;  4C3B A;  3UZT A;  3I4U A;  4U5G A;  4G7H F;  3C8G D;  5JS5 A;  3DKA A;  2Q00 A;  3NMK A;  1B68 A;  2YQY A;  4MVS A;  2KK1 A;  4EKD B;  2XLH A;  1OCC C;  5EGY A;  2XRH A;  2WVO A;  3PSC A;  1YYJ A;  5GPG B;  4BJT A;  1C02 A;  5EHH A;  2WVQ A;  2XL6 A;  5COM A;  3VM6 A;  2C03 A;  4YN0 B;  3RVZ A;  2KJG A;  3AG3 C;  4U9D A;  2R05 A;  2D5R B;  2IYL D;  3W4Y A;  1LE4 A;  1YAU O;  1MQV A;  1LI7 A;  256B A;  3QMK A;  1E2X A;  2AWC A;  4ZLC A;  4Q5S F;  1BBH A;  3ZTM A;  3I5Q A;  4ONS A;  3SXK A;  2HUJ A;  3L1M A;  5CI9 A;  2ASR A;  5T1D B;  1V54 C;  1ORS C;  3Q7L A;  4M63 A;  5DLJ A;  1RKE B;  2W4B A;  5F5F A;  2IBF A;  5HE3 A;  1ZW2 A;  2UUI A;  5KYY B;  1VB5 A;  5KYX B;  4G7Z F;  2YHS A;  2X51 A;  3PCV A;  2V26 A;  1SF8 A;  4CBE A;  3RF3 A;  4E0I A;  5BQI A;  4UDV A;  3NRH A;  3U3B A;  2EBZ A;  4J32 B;  1MNE A;  4J7T A;  3HLZ A;  5AGF A;  2PP4 A;  1F1M A;  2AP3 A;  5IY5 C;  1R5I D;  3C8G B;  2CGE A;  3GM1 A;  3AQC A;  3HNI A;  1EA8 A;  2EPL X;  4C7O B;  1BR4 A;  1VLT A;  3LS0 A;  3JSE O;  3C7K B;  2BT2 A;  4LAC B;  4CSA C;  5E33 A;  3ECS A;  2NUP A;  2J0X A;  3ZQV A;  3J06 A;  2L81 A;  1EI7 A;  1HW1 A;  1OCZ C;  1R4T A;  4K7B A;  4IRU A;  5COF A;  3GEH A;  4J30 B;  4XWJ A;  3RQE A;  1JPN A;  4IGG A;  1FNT c;  1RMV A;  3HKK A;  5L0I A;  1JPJ A;  5DQT A;  2OJE D;  4NY3 A;  1WN0 A;  1E84 A;  2PBE A;  1RJ9 B;  1PD0 A;  2KW3 C;  2HV6 A;  2YEV A;  4LDR A;  2BCJ A;  1XZQ A;  2XS1 A;  4NTF A;  5EK0 A;  1G4U S;  1SYQ A;  4OIQ F;  4OIN F;  3LEV A;  3EH2 A;  1CGO A;  3JRT A;  2V3C C;  2BV1 A;  2Y69 C;  2D9J A;  4Q7C A;  4A4A A;  1OQC A;  2Y3H A;  3ZG1 A;  4CSA A;  2HSB A;  3DJU B;  3W8I A;  4AL0 A;  2KGO A;  1TWC A;  1KNY A;  2R7Q A;  5D92 A;  2LSE A;  3K1H A;  1QPU A;  3RFY A;  3PMR A;  1EKY A;  1FQK B;  1BDJ B;  3GEI A;  2NG1 A;  3TUL A;  2IOQ A;  1QQ3 A;  4W8P A;  1KU2 A;  1Z23 A;  1SZI A;  4XPW A;  4JUR I;  2EPN A;  3RQG A;  4E18 A;  4PJJ A;  1VK5 A;  3GAN A;  1TR2 A;  3RYL A;  3DM9 B;  3UGO A;  1VLS A;  1ORY A;  1NFN A;  1YLM A;  4IB4 A;  3IEE A;  3KRW A;  2WZG A;  3U8V A;  2I15 A;  4BG0 A;  4YWQ A;  1OW7 A;  2J9U A;  1MMN A;  1H7I A;  2CCY A;  2CDQ A;  1ZHX A;  3AGU A;  2QTV A;  3MYI A;  5JP7 A;  3ABL C;  1AVO B;  5A6A A;  1S05 A;  5D91 A;  2ZPA A;  3HTK C;  4U5F E;  4CIP A;  2C04 A;  2YL7 A;  3V5Z A;  2V4Z B;  3S90 A;  1TWG A;  4JRZ A;  1OR2 A;  4ULW A;  3IQ5 A;  1RKE A;  4MVR A;  4BJ6 C;  1TQG A;  2BE5 F;  2CNW A;  3FAJ A;  3C7L A;  1JRA A;  2Z15 A;  3EGX B;  3KL4 A;  1L3P A;  3TJ5 A;  3PVU A;  2Q3T A;  4BPM A;  5KYX A;  3B0V C;  1TWH A;  3ZQY A;  3LUT B;  2DB4 A;  3VF0 A;  2NUT B;  4XQ1 A;  1I4Y A;  2A6E F;  2R03 A;  3LES A;  4DVZ A;  2XLW A;  4XTK A;  1FFT C;  1VYK A;  3C8G A;  4O6M A;  3UGP A;  1G4W R;  2R7V A;  4GEH A;  1V4A A;  1Z63 A;  4C7O A;  1NU7 D;  4PJL A;  2J45 A;  2VCB A;  3IQT A;  3O6X A;  4FES A;  4NCQ A;  3M1C B;  4I1M A;  3WG7 C;  3ZIB A;  4MVQ A;  3U9J A;  4GYT A;  3O55 A;  1MND A;  2BL2 A;  1NFO A;  1A41 A;  2EIL C;  3L0I A;  3LJB A;  3LNM B;  1A7D A;  2HMZ A;  3KYI A;  2Q4F A;  3T4R A;  2CW0 F;  3U0C A;  3DI5 A;  3L34 A;  2G62 A;  5B1B C;  2MWQ A;  1MMD A;  2PX0 A;  2A1D D;  4XLP F;  3C18 A;  4O79 A;  2D4U A;  4EIY A;  1WOL A;  3C62 A;  2OEX A;  2AWY A;  1L7C A;  5E3A A;  3E9V A;  2XXA B;  2UUH A;  1EQ1 A;  3AG1 C;  3ZWI A;  1RJ9 A;  4XEF A;  5DVW A;  1O3U A;  2JM5 A;  4DRJ B;  2XL8 A;  4K0D A;  1AUE A;  4X0R A;  3UNG C;  2F22 A;  5L3V A;  1IW7 F;  4E7S A;  1RKC A;  2Q9B A;  5L0H A;  4LER A;  3RKO F;  1VTM P;  1D1B A;  1ZHY A;  2R7S A;  1WAS A;  3G50 A;  1YDI A;  1H9T A;  1LVK A;  1O87 A;  2B0H A;  2EIM C;  2IXM A;  1FQJ B;  1NSG B;  1ZHW A;  4HEA J;  3JT1 A;  4KBL A;  2Y3B A;  3T6B A;  1QKR A;  3FMS A;  4CS7 A;  2FAP B;  1PD1 A;  2FGY A;  4WGZ A;  1E83 A;  2R7R A;  1C17 M;  4MVM A;  5KYY A;  3NYM A;  4PK4 A;  3S9O A;  1G8X A;  2HS5 A;  1ZU4 A;  2DLV A;  1JAF A;  3FOP A;  5KYU B;  3CEX A;  3MFN A;  3FDQ A;  1FFH A;  1M2V B;  1ZVZ A;  3EFO B;  4PJN A;  3TK0 A;  2JNU A;  4LDK A;  3DXJ F;  2R9R B;  4H54 A;  2J9V A;  2OJQ A;  3B71 A;  3NKE A;  3W2W A;  4MK0 A;  2AU5 A;  4U5H A;  5B1A C;  1N1C A;  3K6B A;  2NPU A;  2OU6 A;  3RQF A;  3NYJ A;  3ZC4 A;  1AGR E;  3DAG A;  2VAS A;  3K66 A;  4G0H A;  3X2Q C;  1D0Y A;  2L9J A;  5L0D A;  1M57 C;  5F5H A;  1EMU A;  2IXP A;  4I44 A;  4O6N A;  4I1O B;  4JC7 A;  3X1O A;  2P61 A;  4ULV A;  4A2N B;  2W4M A;  3AG2 C;  3F47 A;  3LS1 A;  1YZA A;  1J8Y F;  2NSF A;  4KNV A;  3T6G B;  3UR3 C;  3S27 A;  1T5O A;  3K7D A;  3NDB B;  1FTS A;  3QVZ A;  5B3S C;  3LLK A;  2WZF A;  3EGX A;  3WHN A;  2AF0 A;  2L6F A;  2IHD A;  3JCU Q;  2XS8 A;  1CGN A;  2BC5 A;  3M15 A;  1YAR O;  2NUT A;  3EGD B;  5BQH A;  2LK4 A;  2KNH A;  1A0B A;  1QVX A;  4CDA A;  3KYJ A;  1C03 A;  2YKZ A;  4IAQ A;  4MND A;  1OMW A;  3IHU A;  2WVN A;  1I4Z A;  5DS5 A;  5B3I A;  1LE2 A;  4E0H A;  1T6I A;  4KNW A;  3A9C A;  4YL3 A;  3VYW A;  4G7O F;  3MLG A;  2YZS A;  1UFB A;  2CYD A;  4HFK B;  3ABM C;  3QZC A;  4L6R A;  4PFO A;  4D4X A;  2P0N A;  4FWV A;  3V5X A;  3Q7G A;  3MYF A;  2XLD A;  3NYO A;  3S29 A;  3U2L A;  1K05 A;  3FAP B;  4PFP A;  2J0W A;  3EH1 A;  4ER9 A;  1ST6 A;  1V74 B;  3U8P A;  3AGT A;  3DWW A;  3GEE A;  3G4X A;  3NKD A;  3B0U X;  3RH3 A;  2YL1 A;  4MVO A;  2XXA A;  2ZXW C;  4JTA B;  4EWC A;  4QI0 A;  1VOM A;  5KYW A;  4I3M A;  3UMH A;  3EJN A;  3EZI A;  2MYS A;  4LDQ A;  2YLD A;  2LP4 A;  1LS4 A;  4YK5 A;  3A11 A;  3DJN B;  3K33 A;  1WAT A;  3RW0 A;  4DOZ A;  4MTG A;  1CMZ A;  2XM4 A;  1E86 A;  2P1A A;  3B9Q A;  3HNJ A;  3Q6M A;  4F4B A;  1DOV A;  4IWB A;  3BRJ A;  4YJW A;  1G5Z A;  4DXW A;  3JZ0 A;  4JCZ A;  3F46 A;  1NU9 C;  2HJ3 A;  2XL4 A;  3U3F A;  1H6G A;  3ZTZ A;  1VYI A;  2J8W A;  3KKB A;  1HE9 A;  3QTH A;  3TD7 A;  5KYN A;  1FR0 A;  3LLI A;  2GFH A;  4FX5 A;  4LLE A;  3DD7 A;  4ZLD A;  2GWW A;  1BR2 A;  2EPM X;  1A7E A;  2Y39 A;  3UMI A;  3HJC A;  1U6H A;  3CSK A;  5KYU A;  4U5E E;  3O39 A;  3O10 A;  2A69 F;  4G78 A;  4DJ9 A;  1M2V A;  3EFO A;  3QW1 A;  3T9O A;  5A69 A;  1GM5 A;  1Q0G A;  2E87 A;  4WAB A;  1CPQ A;  3KRX A;  2GA0 A;  3US6 A;  2LFF A;  1M56 C;  3V5Y A;  1NZE A;  3CIK A;  3S0X A;  2OQM A;  1OXB A;  2R7U A;  2OJ4 A;  4N06 A;  3U2M A;  2GAQ A;  1UG7 A;  2R25 A;  3JSZ A;  5CI8 A;  3AOU A;  5JRA A;  5A6B D;  1CGM E;  1S7Z A;  4IAO A;  1NG1 A;  4N4W A;  5HSW A;  3R7C A;  2AVK A;  3TJ6 A;  3M4B A;  4HTE A;  3AG4 C;  3T6J A;  3ZVR A;  1O5H A;  4AL1 A;  4JZA A;  3SXZ A;  3U5S A;  2JX0 A;  4BJ1 A;  2H8A A;  1SR2 A;  5FCL A;  4KC9 A;  3OEO A;  5HE2 A;  3SP1 A;  3EGD A;  2LD6 A;  3S28 A;  1U89 A;  5A6J A;  4MQ9 F;  3ABK C;  3WOD F;  4YL0 A;  3N2Z B;  3POV A;  4GQH A;  2YL3 A;  1BR1 A;  2IM8 A;  1QSP A;  3SZR A;  2DYR C;  2GDC A; 
#chains in the Genus database with same CATH homology
 2G3K A;  2W45 A;  4JW1 A;  5KYW B;  3EQL F;  3FHD A;  3JYH A;  4JVS A;  2VB6 A;  4HE8 D;  1WGW A;  5T3W A;  2R7W A;  1ZU5 A;  1W2W A;  4HFF B;  5DS6 A;  3ASO C;  2ZXP A;  3DZA A;  3EZH A;  3DM5 A;  3DAF A;  1OKK A;  2H7B A;  2WL8 A;  4CS9 C;  2OCC C;  2JD3 A;  1Z6A A;  2Q9A A;  1ZHT A;  3I5P A;  2Q9C A;  2Y3G A;  1PCX A;  2I8B A;  4U5D E;  4ANJ A;  3LAY A;  4BJ5 A;  1Z5Z A;  2XSE A;  2R7O A;  1D0Z A;  1OCO C;  4OIO F;  5BUO A;  2R7X A;  3W2V A;  1OKK D;  4P6I C;  4OD4 A;  4AE4 B;  5E3C A;  4CS9 A;  4DVY P;  4YT5 A;  2R7T A;  3KH2 A;  3ASN C;  4QI2 A;  2Y3D A;  3GOD A;  1VMA A;  1QZX A;  2HV7 A;  3FVY A;  2ZXO A;  3VAY A;  4CIH A;  2J7P A;  3ITF A;  1LS1 A;  3EHN A;  3MX3 A;  3K1I C;  3V7O A;  3EG9 B;  2VH3 A;  4AK9 A;  2EIK C;  4AX2 A;  2QY9 A;  2PX3 A;  2ZXR A;  4JJF A;  3B0P A;  3H65 A;  4YT8 A;  1J8M F;  3SEO A;  4XLN F;  5DQZ A;  4U5B E;  4U5C E;  5L3Q A;  4OD5 A;  4YT4 A;  2FFH A;  2M4E A;  4DBQ A;  3OA1 A;  2J7P D;  4IJJ A;  1QLE C;  3CQZ A;  3DMD A;  1D1C A;  4CSA A;  4OIR F;  4JJG A;  1ZHZ A;  2A6H F;  1SMY F;  3PHF 2;  1M2O A;  4KI2 A;  2IXO A;  4O6Y A;  2P7V A;  3CZ6 A;  1Z3I X;  4B6I A;  4EBB A;  2P6V A;  3W8H A;  2J46 A;  1D1A A;  3OWT A;  4PJM A;  2EIN C;  2OG2 A;  2KQ9 A;  3UMK A;  1TKN A;  1D0X A;  1OCR C;  2IXN A;  2J9W A;  4BEJ A;  1V55 C;  4LLC A;  1FMW A;  1FMV A;  4Q4Z F;  3AQB A;  4RBN A;  1MMA A;  2PF4 E;  1TWA A;  4E7Z A;  3SNH A;  2DGJ A;  3N24 A;  4O7G A;  1MMG A;  4C3D A;  4RDA A;  2WZL A;  4AE4 A;  1ZYR F;  3NYL A;  2NUP B;  3Q6N A;  4OIP F;  2H7V C;  2H7O A;  3ZSU A;  5DS4 A;  1IZM A;  2A68 F;  4C3E A;  3KMI A;  5T3T A;  2PFD A;  3SYN A;  2O9X A;  4WJ0 A;  2DYS C;  3LNR A;  2WB7 A;  3N0T A;  2W9Y A;  4DBR A;  4JCH A;  4RD9 A;  3NG1 A;  4H4K C;  5E2Q A;  3EPV A;  3EHM A;  4W8K A;  3EG9 A;  4BJ6 A;  2CNW D;  4CS8 A;  4BJ5 C;  2B0J A;  4YT2 A;  2G3V A;  3RIP A;  2EIJ C;  3E70 C;  1LKX A;  4QDL A;  4C3B A;  3I4U A;  4U5G A;  4G7H F;  5EGY A;  1OCC C;  2XRH A;  2WVO A;  4BJT A;  5EHH A;  2WVQ A;  2C03 A;  4YN0 B;  2KJG A;  3AG3 C;  2D5R B;  2IYL D;  3QMK A;  4ZLC A;  4Q5S F;  3I5Q A;  5CI9 A;  5T1D B;  1V54 C;  3Q7L A;  4M63 A;  5DLJ A;  5F5F A;  2W4B A;  5KYY B;  5KYX B;  4G7Z F;  2YHS A;  2X51 A;  2V26 A;  1SF8 A;  4CBE A;  3NRH A;  4J32 B;  1MNE A;  3HLZ A;  2PP4 A;  5IY5 C;  2CGE A;  3AQC A;  4C7O B;  1BR4 A;  3LS0 A;  4LAC B;  4CSA C;  5E33 A;  3ECS A;  2NUP A;  2J0X A;  2L81 A;  1OCZ C;  4K7B A;  4IRU A;  4XWJ A;  4J30 B;  1JPN A;  1JPJ A;  5DQT A;  4NY3 A;  1RJ9 B;  1PD0 A;  2KW3 C;  2HV6 A;  2YEV A;  4OIQ F;  4OIN F;  3LEV A;  3EH2 A;  3JRT A;  2V3C C;  2Y69 C;  4Q7C A;  3ZG1 A;  2Y3H A;  3W8I A;  3DJU B;  2KGO A;  1TWC A;  2R7Q A;  5D92 A;  2LSE A;  3K1H A;  3RFY A;  3PMR A;  2NG1 A;  2IOQ A;  1KU2 A;  1Z23 A;  1SZI A;  4JUR I;  4PJJ A;  1VK5 A;  3GAN A;  1TR2 A;  3RYL A;  3DM9 B;  3UGO A;  3IEE A;  2WZG A;  4BG0 A;  4YWQ A;  2J9U A;  1MMN A;  2CDQ A;  1ZHX A;  2QTV A;  3ABL C;  5D91 A;  2ZPA A;  3HTK C;  4U5F E;  2C04 A;  1TWG A;  4ULW A;  4BJ6 C;  2CNW A;  2BE5 F;  3FAJ A;  3KL4 A;  4CS8 C;  3EGX B;  2Z15 A;  5KYY A;  5KYX A;  2Q3T A;  3B0V C;  1TWH A;  2NUT B;  2A6E F;  3LES A;  4DVZ A;  4XTK A;  1FFT C;  1VYK A;  4O6M A;  3UGP A;  2R7V A;  4GEH A;  1Z63 A;  4C7O A;  1NU7 D;  4PJL A;  2J45 A;  3O6X A;  4FES A;  3M1C B;  4I1M A;  3WG7 C;  3ZIB A;  4GYT A;  1MND A;  3LJB A;  2EIL C;  3L0I A;  3T4R A;  2CW0 F;  3L34 A;  2G62 A;  5B1B C;  2MWQ A;  1MMD A;  2PX0 A;  2A1D D;  4XLP F;  4O79 A;  5E3A A;  3E9V A;  2XXA B;  3AG1 C;  1RJ9 A;  5DVW A;  4K0D A;  4X0R A;  3UNG C;  5L3V A;  1IW7 F;  4E7S A;  3NDB B;  2Q9B A;  4LER A;  3RKO F;  1D1B A;  1ZHY A;  2R7S A;  1LVK A;  1O87 A;  2EIM C;  2IXM A;  1ZHW A;  4HEA J;  4KBL A;  4CS7 A;  3JT1 A;  2Y3B A;  3T6B A;  1PD1 A;  2FGY A;  2R7R A;  3NYM A;  4PK4 A;  1G8X A;  1ZU4 A;  5KYU B;  3FDQ A;  1FFH A;  1M2V B;  3EFO B;  4PJN A;  3DXJ F;  2J9V A;  3NKE A;  3W2W A;  4U5H A;  5B1A C;  1N1C A;  3K6B A;  3NYJ A;  3ZC4 A;  3DAG A;  2VAS A;  3K66 A;  4G0H A;  3X2Q C;  1D0Y A;  2L9J A;  1M57 C;  5F5H A;  4A2N B;  2IXP A;  4I44 A;  4O6N A;  4I1O B;  3X1O A;  2W4M A;  3AG2 C;  3F47 A;  3LS1 A;  4KNV A;  1J8Y F;  3UR3 C;  3S27 A;  3K7D A;  1FTS A;  5B3S C;  3LLK A;  2WZF A;  3EGX A;  3JCU Q;  2NUT A;  3EGD B;  2KNH A;  4MND A;  2WVN A;  5DS5 A;  4KNW A;  3VYW A;  4G7O F;  3MLG A;  2YZS A;  4HFK B;  3ABM C;  3QZC A;  4PFO A;  4FWV A;  3Q7G A;  3S29 A;  4PFP A;  2J0W A;  3EH1 A;  1ST6 A;  3NKD A;  3B0U X;  3RH3 A;  2XXA A;  2ZXW C;  4EWC A;  4QI0 A;  1VOM A;  5KYW A;  4I3M A;  3UMH A;  3EJN A;  3EZI A;  2MYS A;  3K33 A;  3DJN B;  4DOZ A;  3B9Q A;  3Q6M A;  4F4B A;  4IWB A;  4YJW A;  3F46 A;  1NU9 C;  2XL4 A;  1VYI A;  3KKB A;  3TD7 A;  5KYN A;  3LLI A;  2GFH A;  4FX5 A;  4LLE A;  3DD7 A;  4ZLD A;  1BR2 A;  3UMI A;  2Y39 A;  3HJC A;  3CSK A;  5KYU A;  4U5E E;  3O39 A;  2A69 F;  1M2V A;  3EFO A;  2E87 A;  1M56 C;  1NZE A;  3S0X A;  2R7U A;  4N06 A;  5CI8 A;  3JSZ A;  1S7Z A;  4IAO A;  1NG1 A;  5HSW A;  4HTE A;  3AG4 C;  3T6J A;  3ZVR A;  1O5H A;  4JZA A;  4BJ1 A;  5FCL A;  4KC9 A;  3OEO A;  3SP1 A;  3EGD A;  3S28 A;  4MQ9 F;  3ABK C;  3WOD F;  3N2Z B;  3POV A;  1BR1 A;  3SZR A;  2DYR C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...