3I5QA

Nup170(aa1253-1502) at 2.2 a, s.cerevisiae
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
248
structure length
248
Chain Sequence
IVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nucleoporin NUP170
publication title Architectural nucleoporins Nup157/170 and Nup133 are structurally related and descend from a second ancestral element.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 83
structure length 248
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-07-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.167.20 Mainly Alpha Orthogonal Bundle Regulator of G-protein Signalling 4; domain 2 Regulator of G-protein Signalling 4; domain 2 3i5qA02
1.20.120.1050 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 3i5qA01
3I5QA
chains in the Genus database with same CATH superfamily
4IAQA 4RBNA 3W2VA 4CX9A 1C02A 1FQIA 1YZAA 5F5FA 4UDVA 5TJ5E 1ZU5A 3ZWIA 4DRHB 5KYWA 4JKVA 1R5ID 4DXWA 1CPRA 4XTKA 3M79A 2A68F 2CNWA 3TQOA 1OCOC 1J8MF 2P61A 2GDCA 4CBEA 2XXAA 4G78A 5L0GA 2DYSC 1O87A 3JYHA 3VF0A 2KGOA 1YZCA 1ZVZA 1ZHTA 2V26A 1FR0A 1JPJA 5EGYA 1PD0A 5COGA 5L0DA 3HNLA 3RVZA 2YHSA 4N6CA 2OEXA 3G50A 3US6A 1GGQA 1OW7A 1Z5ZA 2FGYA 4G7OF 2M64A 3DXJF 3SXMA 256BA 2EIJC 4WGYA 3AQCA 3TK0A 2WZFA 1E83A 1NFNA 2H7VC 2LD6A 4Q4ZF 1T6IA 4QI2A 2EPMX 2I15A 4BJ5C 2P0NA 3SEOA 1TWGA 2H7BA 3PSCA 2R7QA 4LDQA 4U5BE 1L7CA 4CSAC 3EPVA 3JRMO 3K6BA 2GWWA 2H7OA 5B3IA 4AL1A 1WATA 2E87A 2YL0A 3JRTA 3NYLA 4MS2A 1BDJB 3B71A 3S28A 3ITFA 2Q4FA 4EBBA 2IHDA 1YYXA 2Q9BA 1IZMA 2XL6A 2YEVA 5BUOA 5DO9B 5L0IA 2BCJA 4D4XA 2WL8A 2IOQA 2RSEB 1APCA 3A11A 4J7YA 4XPYA 3TD7A 2HFIA 2IHBB 4K1OA 3WG7C 4CIHA 4W8PA 3V5YA 2KSFA 2ZXPA 4NQFA 1RMVA 1KNYA 2P7VA 4CIPA 2J9BA 3CIKA 2HSBA 3ECSA 3GM1A 4L6RA 2HJ3A 3C8GD 3NKEA 2EPLX 3TJ6A 1HMDA 2YLDA 5L0FA 2EINC 2XLHA 2WZLA 2ZXWC 5DS6A 1YVIA 4JURI 1B68A 3WHNA 2A1DD 2NPUA 1J8YF 2IXMA 4LDRA 3OWTA 1W2WA 4IGGA 5B1AC 5CI9A 1D1AA 5B1BC 4JE9A 4MNDA 4U9EA 4MVSA 2ASRA 3TULA 3GM2A 3QW0A 4XEFA 2OWIA 1LIHA 1U89A 2YKZA 4EIYA 4E17A 3S84A 4KNVA 1ORJA 2HJMA 4NTBA 4BJ5A 1PCXA 3NMIA 2J0WA 3QMKA 4LDKA 4CSAA 2KQ9A 2JPUA 4GYTA 2B0HA 2NUPB 2Y69C 2VCCA 3T6JA 3U2LA 2KW3C 3I4UA 2YRFA 2CW0F 4IWBA 1R4TA 1FFTC 2EPNA 4YL1A 5HE2A 1MNEA 1LE2A 3LNMB 2KJGA 2R7SA 4MW3A 2R03A 1T6UA 3L8JA 2YL3A 2G3VA 2YWAA 3H65A 4DOZA 1VOMA 3EG9A 1I5NA 2PNOA 2QE9A 3FAPB 3KYIA 3SZRA 5CI8A 3B0VC 4CDVA 5L3QA 2OJ4A 1F1MA 3UMKA 2AVKA 3EG9B 4PJLA 1RKCA 4AL0A 4H54A 4NTFA 5A6BA 4ZLCA 1D0YA 1VYIA 4HE8D 1H6GA 1Z23A 4MVRA 4JTDB 2KC3A 1DK8A 4DBQA 4OIPF 1D0XA 2GFHA 2PX0A 3POVA 3EH1A 1T5OA 3DM5A 3M1CB 1U6HA 2VCBA 3L34A 5KYXA 4G7ZF 2A0BA 1OQCA 3ABKC 2R7RA 2IXNA 3KYJA 4K0DA 5KYXB 1OR2A 2BL2A 5DS4A 4JC7A 4XPWA 3KRWA 2KYHA 5COFA 2YLGA 5JRAA 5A6JA 4BJTA 4BEJA 3RH3A 1NSGB 3JYYA 3GWNA 3FDQA 4BEMJ 2J9WA 3CSKA 1ZHYA 3NMJA 3W8IA 3IQCA 4AX2A 4FX5A 3DE9A 2OQMA 4YT2A 2XLOA 2XLWA 3FMSA 4TNDA 1VYKA 4U9DA 2L6GA 3FVYA 1DOWA 1C17M 1EI7A 2LCHA 3GEEA 4I1OB 2LQGA 3EZIA 4WJ0A 1K05A 1OCRC 4YK5A 4EKDB 4E0IA 4DVYP 4E7ZA 3V7OA 2XLEA 3LUTB 4IAOA 4QI0A 2LP4A 3TOLA 2CCYA 2L7AA 5COMA 3FAJA 1AGRE 3UGOA 2ETSA 3H2VA 3ASOC 5JUAA 3QTHA 3PDMP 2CDQA 1ZHWA 2AU5A 3HTKC 3K1HA 2J8WA 4GEHA 1QKRA 3Q6MA 1UFBA 3ABMC 2QUPA 2WVNA 4JCHA 4Q7CA 4CS9C 5CIVA 5F28E 3LNRA 3NYOA 1Q0DA 5E3CA 3QW1A 4YT8A 2AWCA 1O5HA 2Y3DA 4HFFB 3TOMA 4MW8A 2PFDA 1HE9A 4MTOA 4CS8C 3B0PA 5E33A 3U2MA 3UNGC 4MVMA 3LS1A 2GTPC 4MVQA 1TQGA 4ULWA 1VLTA 5KYUA 1YA7O 2VB6A 1BR4A 3B9QA 3HNIA 3C7KB 3RW0A 1AEPA 1CGOA 2J7PD 4RD9A 1E84A 4HTEA 1MQVA 2PX3A 3SXKA 2AF0A 5KYUB 1A0BA 2C03A 4DVZA 4DBRA 3T6GB 1G4US 2OU6A 1VMAA 2XRHA 1MNDA 3TJ5A 4IARA 3EJNA 1JMWA 1M6TA 2D5RB 4PK4A 3DD7A 1EZYA 3C7JA 2D9JA 5E3AA 5T3WA 1AVOB 3KMIA 1DOVA 1LS4A 4JTAB 3ZTMA 1NZEA 2A6HF 1G4WR 2EILC 3ZIBA 3K1IA 1OR3A 5JP7A 1ST6A 1EZTA 2R05A 2EPOA 4N4WA 4O6YA 2YVKA 1WWPA 1FMWA 3NMKA 4KBLA 4XEVA 3W4YA 4EBKA 3GODA 3HKKA 3JZ0A 1YDIA 3GORA 4PFPA 5FZTA 3C62A 5E2QA 4DJ9A 3L0IA 3AG1C 1D1BA 1FQKB 4OD4A 1QZXA 2W4MA 4MTFA 4BJ1A 4EBJA 2HUJA 3UMHA 4JRZA 4FAPB 1SZIA 1Z3IX 1EMUA 1O3UA 3AG4C 2IK8B 3EZHA 1E85A 3I5QA 2J46A 1QQ3A 1HY5A 2Q9AA 3K33A 2Q9CA 2ZD9A 5KYNA 1S05A 2V4ZB 1NU9C 2O9XA 4F4BA 3DAGA 4J32B 2EBZA 4CS8A 3NDBB 3QZCA 3S29A 2EPKX 1K40A 5BQGA 5EHHA 1NU7D 1T9KA 3JTLO 4YJWA 2ZPAA 5JLIA 1ORYA 2YL1A 4AE4B 4B6IA 3W2WA 4OIRF 1Z63A 2ODEB 4MK0A 4G0HA 1CGME 2HV7A 1HW1A 1VTMP 5K0IA 4IJJA 4P9FA 1JOGA 2QTVA 3HNKA 3C8GA 3BRJA 3HNJA 3I5PA 3NG1A 5AC5A 2W4BA 2BV1A 4PJJA 1OCCC 3EGDB 2NUPA 2CRPA 1OKKD 3A9CA 3FHDA 2IXPA 2YL7A 3B29A 3C8GB 3EHNA 3FOPA 4J30B 4LERA 1LI5A 4FESA 4QDLA 4E0HA 4KI2A 1EKYA 3Q7GA 3VRCA 3V5WA 1FQJB 2XLMA 3DE8A 3LESA 1LKXA 1TFOB 2HZ8A 1YLMA 2VASA 1GM5A 1OCZC 2NUTA 1QLEC 4N6HA 2MYSA 4U5CE 3CQZA 2JX0A 1XZPA 3RFYA 3T9OA 4A4AA 2JNUA 3EFOB 4C3DA 3NRHA 2BT2A 3U9MA 2NUTB 3AJMA 3ASNC 5A69A 3GM3A 1OKKA 3RKOF 4HFKB 2TMVP 4RDAA 1KU2A 5JVEA 4ULVA 3RVYA 4Q5SF 3W8HA 1WASA 3LJBA 5FCLA 1WGWA 2X51A 2D4UA 3ZSUA 2Q3TA 4JCZA 1EQ1A 5L3VA 2EIMC 2UUIA 2KK1A 3O55A 1OW6A 1IW7F 2DYRC 4LACB 2Z15A 2HMZA 4AK9A 1MMNA 5DQTA 4PJNA 1RJ9B 1RKEB 1Q0KA 3T6BA 3MX3A 1YARO 4CS7A 5HE3A 1D0ZA 3C8ZA 2PBEA 2X0CA 5HE1A 3SP1A 3U3FA 2HMQA 1UG7A 3CEXA 3DI5A 2OCCC 3F46A 3ATPA 4EWCA 2FFHA 4NC3A 2BE5F 3LEVA 4EKWA 1FTSA 3R7CA 3JSEO 4DRIB 1XWJA 2WB7A 2DLVA 4TNBA 1Q0FA 3N24A 3RYLA 4PNKA 1CPQA 1JPNA 3U8VA 4EUKB 2R7UA 2R7OA 1H7IA 1M2VB 3UR3C 5DLJA 5BQHA 1VLSA 2I8BA 4M63A 1OMWA 3C63A 2DGJA 2L81A 2M4EA 2XM4A 1BR1A 2F22A 1JR8A 4MTGA 2OEVA 3E9VA 1H9TA 3JCUQ 3MYIA 2ICWG 1K04A 1ZW2A 2PF4E 3AOUA 1ZW3A 4Z9IA 3WODF 1T01A 3RF3A 4BPMA 2QY9A 3EQLF 3V5ZA 4E7SA 4O6MA 2HV6A 2C04A 3FXHA 3O39A 5L0JA 2PP4A 3DMDA 1E86A 2R02A 2LFDA 2QLAA 1LE4A 3MBGA 3U3BA 1T6QA 2W9YA 1PD1A 1M56C 4CDAA 2R7TA 2WVQA 1ORSC 5HV9A 4XLNF 2LFFA 1FAPB 3V5XA 4Z9JA 3NYJA 3Q7LA 4OINF 3C7LA 1LPEA 2A6EF 3ZQVA 2J9UA 2IBFA 4BJ6C 4ZLDA 1XZQA 2ZXRA 1ZZPA 4WGZA 2Q00A 2CNWD 2R7XA 2L6FA 3AG2C 3M15A 1A7DA 3KH2A 3IQ5A 5D91A 3PVUA 3SYNA 3UMIA 2P1AA 1G8XA 3UZTA 2LIGA 3U0CA 1PV3A 3NYNA 2OJQA 4PACA 3IPMO 3LLIA 4MVZA 2DB4A 1TFKB 3AGUA 4CJGA 2EIKC 2ZXOA 3QVYA 1YYJA 3N0TA 4U5DE 3LS0A 3AGTA 3ZC4A 1LM3B 2Y3HA 4JJFA 3C18A 2FAPB 2DI3A 3PVWA 4I44A 2GAQA 5KYWB 1CGNA 3DJNB 1YJGA 1AUEA 1FMVA 3ZDLA 1NG1A 2HKVA 3GANA 1JAFA 4PJMA 5B3SC 4U5FE 3O10A 2WZGA 4XWJA 1RCPA 3VM6A 2XXAB 4LLCA 1S7ZA 4KC9A 4G7HF 1OW8A 2IYLD 1U0BB 1Y4CA 2Y3GA 2J7PA 2QNLA 2XM0A 2A69F 4U5HA 2R7WA 2Y3BA 3SXYA 2VCAA 3S90A 4CJOA 3IEEA 1NBBA 4W8KA 2Y39A 4EHPA 2CGEA 5AGFA 5JT4A 1SMYF 3UGPA 2RD9A 2XL8A 4JIOA 4MVOA 4CS9A 1CMZA 1V54C 4JJGA 4XEKA 2J45A 2Q7RA 4PR9A 3VYWA 4ER9A 4XPXA 2R25A 1QSPA 2CYDA 4BJ6A 3HLZA 1ZYRF 1Y6DA 1WN0A 3F47A 2MWQA 3M4BA 3ZTZA 4E18A 1A7VA 1E2XA 4U5GA 4O7GA 5JS5A 1ZU4A 1OXKA 2NG1A 2NSFA 2VH3A 2YZSA 2AWYA 3L1MA 4JEAA 2XLVA 4U5EE 4I3MA 3T4RA 3ZVRA 3B0UX 1LI7A 2HSQA 3OA1A 4N06A 2AP3A 4GQHA 3RQGA 3DWWA 2A0UA 3JSZA 3X2QC 3X1OA 1L3PA 3FOOA 5L0CA 1Z7Qc 3EGDA 3VAYA 3AG3C 2XLDA 3GEHA 4P6IC 5L0HA 3KL4A 2LSEA 3MYFA 2L9JA 4JEBA 4MVUA 4OIQF 1SF8A 1I4YA 3EH2A 3KPHA 1BR2A 2L6HA 1C03A 1GQAA 2OKUA 3EGXA 3K7DA 3LLKA 5A6KA 2G62A 1TWCA 3S9OA 3K66A 3EGXB 3EFOA 1HW2A 4X0RA 3MFNA 4FWVA 4JW1A 2H8AA 2VC9A 1Z6AA 3U8PA 1HE1A 3N2ZB 4O79A 4NTAA 2WVOA 4OD5A 1YA9A 4KNWA 5DVWA 3ZG1A 4YL3A 4AE4A 5HSWA 3M4CA 2OG2A 3O6XA 1D1CA 1M2OA 2XSEA 4JVSA 5JSLA 1NLXA 5T1DB 4A2NB 2W45A 1BZ4A 3QVZA 2KNHA 4HEAJ 4IRUA 1QPUA 4XLPF 2NSGA 1SR2A 1TWHA 4O6NA 4DRJB 2IM8A 1G5ZA 2GA0A 1A41A 2OJED 2R9RB 3DZAA 3J06A 1RJ9A 1RKEA 1V74B 3BEHA 3DM9B 3DJUB 2YLIA 3LEOA 1WTYA 4LLEA 4Z9HA 3U5SA 4D4NA 1GS9A 1FFHA 3AQBA 3S0XA 5BQIA 3ZQYA 5A6BD 2J9VA 1JRAA 4NY3A 4JZAA 4ONSA 2XS1A 3L8IA 1YAUO 4J7TA 4BG0A 1V55C 1VB5A 5GPGB 2YQYA 3SXZA 3MLGA 4YL0A 1M57C 2UUHA 1A7EA 5HE0A 3RQEA 1NFOA 3CAXA 3NYMA 5KYYA 3GEIA 4YWQA 3RIPA 4IB4A 5D92A 3U9JA 3LAYA 4YT4A 2JM5A 3CZ6A 5AC4A 3R2PA 1M2VA 4ANJA 5EK0A 5KYYB 1BBHA 2OOCA 1SYQA 3H2UA 1N1CA 2V3CC 3KRXA 2MHRA 3IQTA 3OEOA 4C7OA 5F5HA 2IXOA 3EHMA 1ZHZA 3G4ZA 5DQZA 3HJCA 4YN0B 1EA8A 2XS8A 2B0JA 1TR2A 3PMRA 4YT5A 4C7OB 4I1MA 3PHF2 4C3BA 4CDYA 2JD3A 3WAQA 2P6VA 2XL4A 4JTCB 2J0XA 3S27A 3DAFA 1TWAA 3G4XA 1I4ZA 3RQFA 4NCQA 4XQ1A 2HS5A 3DKAA 3E70C 1WOLA 1HMOA 1H9GA 1TKNA 3IHUA 2G3KA 2LK4A 4WABA 4MQ9F 5A6AA 1LVKA 4K7BA 4P9TA 5T3TA 3KKBA 2R7VA 3JT1A 4H4KC 1MMDA 3GWLA 3NKDA 1RXQA 4PFOA 3SNHA 3ABLC 1Q0MA 1FNTc 1V4AA 1KTMA 1MMGA 1QVXA 4R32A 1LS1A 5DS5A 3PCVA 4C3EA 4OIOF 5IY5C 3K1IC 3Q6NA 1OXBA 2BC5A 1ZHXA 1VK5A 3IQ6A 1Q0GA 1MMAA
chains in the Genus database with same CATH topology
4RBNA 3W2VA 5F5FA 1ZU5A 5KYWA 4XTKA 2A68F 2CNWA 1OCOC 1J8MF 2XXAA 4CBEA 2DYSC 1O87A 3JYHA 2KGOA 1ZHTA 2V26A 1JPJA 5EGYA 1PD0A 2YHSA 1Z5ZA 2FGYA 4G7OF 3DXJF 2EIJC 3AQCA 2WZFA 2H7VC 4QI2A 4BJ5C 3SEOA 1TWGA 2H7BA 2R7QA 4U5BE 4CSAC 3EPVA 3K6BA 2H7OA 2E87A 3JRTA 3S28A 3NYLA 3ITFA 2Q9BA 1IZMA 2YEVA 5BUOA 2WL8A 2IOQA 3TD7A 4CIHA 3WG7C 2ZXPA 2P7VA 3ECSA 3NKEA 2EINC 2WZLA 2ZXWC 5DS6A 4JURI 2A1DD 1J8YF 2IXMA 3OWTA 1W2WA 5B1AC 5CI9A 1D1AA 5B1BC 4MNDA 4KNVA 4BJ5A 1PCXA 2J0WA 3QMKA 4CSAA 2KQ9A 4GYTA 2NUPB 2Y69C 3T6JA 2KW3C 3I4UA 4IWBA 2CW0F 1FFTC 1MNEA 2KJGA 2R7SA 2G3VA 3H65A 4DOZA 1VOMA 3EG9A 3B0VC 3SZRA 5CI8A 5L3QA 3UMKA 3EG9B 4PJLA 4ZLCA 1D0YA 1VYIA 4HE8D 1Z23A 4OIPF 4DBQA 1D0XA 2GFHA 2PX0A 3POVA 3EH1A 3DM5A 3M1CB 5KYXA 3L34A 4G7ZF 3ABKC 2R7RA 2IXNA 4K0DA 5KYXB 5DS4A 4BJTA 4BEJA 3RH3A 3FDQA 2J9WA 3CSKA 1ZHYA 3W8IA 4AX2A 4FX5A 4YT2A 1VYKA 3FVYA 4I1OB 4Q4ZF 3EZIA 4WJ0A 4DVYP 1OCRC 4E7ZA 3V7OA 4IAOA 4QI0A 3FAJA 3UGOA 3ASOC 2CDQA 1ZHWA 3HTKC 3K1HA 4GEHA 4CS9C 3Q6MA 3ABMC 2WVNA 4JCHA 4Q7CA 3LNRA 5E3CA 4YT8A 1O5HA 2Y3DA 4HFFB 2PFDA 4CS8C 3B0PA 5E33A 3UNGC 3LS1A 4ULWA 5KYUA 2VB6A 1BR4A 3B9QA 4RD9A 2J7PD 4HTEA 2PX3A 5KYUB 2C03A 4DVZA 4DBRA 2XRHA 1VMAA 1MNDA 3EJNA 2D5RB 4PK4A 3DD7A 5E3AA 5T3WA 3KMIA 1NZEA 2A6HF 2EILC 3ZIBA 1ST6A 4O6YA 1FMWA 4KBLA 3GODA 4PFPA 5E2QA 3L0IA 3AG1C 1D1BA 4OD4A 1QZXA 2W4MA 3UMHA 1SZIA 1Z3IX 3AG4C 3EZHA 3I5QA 2J46A 2Q9AA 3K33A 2Q9CA 5KYNA 1NU9C 2O9XA 4F4BA 3DAGA 4J32B 4CS8A 3NDBB 3QZCA 3S29A 5EHHA 1NU7D 4YJWA 2ZPAA 4B6IA 3W2WA 4OIRF 1Z63A 4G0HA 2HV7A 4IJJA 2QTVA 3I5PA 3NG1A 2W4BA 4PJJA 1OCCC 3EGDB 2NUPA 1OKKD 3FHDA 2IXPA 4LERA 3EHNA 4J30B 4QDLA 4KI2A 4FESA 3Q7GA 3LESA 1LKXA 2VASA 1OCZC 2NUTA 1QLEC 4U5CE 2MYSA 3RFYA 3CQZA 3EFOB 4C3DA 3NRHA 2NUTB 3ASNC 1OKKA 3RKOF 4HFKB 4RDAA 1KU2A 4Q5SF 3W8HA 3LJBA 5FCLA 1WGWA 2X51A 3ZSUA 2Q3TA 5L3VA 2EIMC 1IW7F 2DYRC 4LACB 2Z15A 4AK9A 1MMNA 5DQTA 4PJNA 1RJ9B 3T6BA 3MX3A 4CS7A 1D0ZA 3SP1A 3F46A 2OCCC 4EWCA 2FFHA 2BE5F 3LEVA 1FTSA 2WB7A 3N24A 3RYLA 1JPNA 2R7UA 2R7OA 1M2VB 3UR3C 5DLJA 2I8BA 4M63A 2DGJA 2L81A 2M4EA 1BR1A 3E9VA 3JCUQ 2PF4E 3WODF 4E7SA 2QY9A 3EQLF 4O6MA 2HV6A 2C04A 3O39A 2PP4A 3DMDA 2W9YA 1PD1A 1M56C 2R7TA 2WVQA 4XLNF 3NYJA 3Q7LA 4OINF 2A6EF 2J9UA 4BJ6C 4ZLDA 2ZXRA 2CNWD 2R7XA 3AG2C 3KH2A 5D91A 3SYNA 3UMIA 1G8XA 3LLIA 2EIKC 2ZXOA 3N0TA 4U5DE 3LS0A 3ZC4A 2Y3HA 4JJFA 4I44A 5KYWB 3DJNB 1FMVA 1NG1A 3GANA 4PJMA 4U5FE 2WZGA 4XWJA 2XXAB 4LLCA 1S7ZA 4KC9A 4G7HF 2IYLD 2Y3GA 2J7PA 4U5HA 2A69F 2R7WA 2Y3BA 3IEEA 4W8KA 2Y39A 2CGEA 1SMYF 3UGPA 4CS9A 1V54C 4JJGA 2J45A 3VYWA 4BJ6A 3HLZA 1ZYRF 3F47A 2MWQA 4U5GA 4O7GA 1ZU4A 2NG1A 2VH3A 4U5EE 2YZSA 4I3MA 3T4RA 3ZVRA 3B0UX 3OA1A 4N06A 3JSZA 3X2QC 3X1OA 3EGDA 3VAYA 3AG3C 4P6IC 3KL4A 2LSEA 2L9JA 4OIQF 1SF8A 3EH2A 1BR2A 3EGXA 3K7DA 3LLKA 2G62A 1TWCA 3K66A 3EGXB 3EFOA 4X0RA 4FWVA 4JW1A 1Z6AA 3N2ZB 5DVWA 4O79A 3ZG1A 2WVOA 4OD5A 4AE4A 4KNWA 4EBBA 5HSWA 2OG2A 3O6XA 1D1CA 1M2OA 2XSEA 4JVSA 5T1DB 4A2NB 4AE4B 4XLPF 2W45A 4HEAJ 2KNHA 4IRUA 1TWHA 4O6NA 3DZAA 1RJ9A 3DM9B 4LLEA 4BJ1A 5B3SC 3DJUB 3S0XA 1FFHA 3AQBA 2J9VA 4NY3A 4JZAA 4BG0A 1V55C 3MLGA 1M57C 3NYMA 5KYYA 4YWQA 3RIPA 5D92A 3LAYA 4YT4A 3CZ6A 1M2VA 4ANJA 5KYYB 1N1CA 2V3CC 3OEOA 4C7OA 5F5HA 2IXOA 3EHMA 1ZHZA 5DQZA 3HJCA 4YN0B 4YT5A 2B0JA 1TR2A 3PMRA 4C7OB 4I1MA 3PHF2 4C3BA 2JD3A 2P6VA 2XL4A 2J0XA 3S27A 3DAFA 1TWAA 3E70C 1TKNA 2G3KA 4MQ9F 1LVKA 4K7BA 5T3TA 3KKBA 2R7VA 3JT1A 4H4KC 1MMDA 3NKDA 4PFOA 3SNHA 3ABLC 1MMGA 5DS5A 1LS1A 4C3EA 4OIOF 5IY5C 3K1IC 3Q6NA 1ZHXA 1VK5A 1MMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I5Q A; 
#chains in the Genus database with same CATH topology
 4IAQ A;  4RBN A;  3W2V A;  4CX9 A;  1C02 A;  1FQI A;  1YZA A;  5F5F A;  4UDV A;  5TJ5 E;  1ZU5 A;  3ZWI A;  4DRH B;  5KYW A;  4JKV A;  1R5I D;  4DXW A;  1CPR A;  4XTK A;  3M79 A;  2A68 F;  2CNW A;  3TQO A;  1OCO C;  1J8M F;  2P61 A;  2GDC A;  4CBE A;  2XXA A;  4G78 A;  5L0G A;  2DYS C;  1O87 A;  3JYH A;  3VF0 A;  2KGO A;  1YZC A;  1ZVZ A;  1ZHT A;  2V26 A;  1FR0 A;  1JPJ A;  5EGY A;  1PD0 A;  5COG A;  5L0D A;  3HNL A;  3RVZ A;  2YHS A;  4N6C A;  2OEX A;  3G50 A;  3US6 A;  1GGQ A;  1OW7 A;  1Z5Z A;  2FGY A;  4G7O F;  2M64 A;  3DXJ F;  3SXM A;  256B A;  2EIJ C;  4WGY A;  3AQC A;  3TK0 A;  2WZF A;  1E83 A;  1NFN A;  2H7V C;  2LD6 A;  4Q4Z F;  1T6I A;  4QI2 A;  2EPM X;  2I15 A;  4BJ5 C;  2P0N A;  3SEO A;  1TWG A;  2H7B A;  3PSC A;  2R7Q A;  4LDQ A;  4U5B E;  1L7C A;  4CSA C;  3EPV A;  3JRM O;  3K6B A;  2GWW A;  2H7O A;  5B3I A;  4AL1 A;  1WAT A;  2E87 A;  2YL0 A;  3JRT A;  3NYL A;  4MS2 A;  1BDJ B;  3B71 A;  3S28 A;  3ITF A;  2Q4F A;  4EBB A;  2IHD A;  1YYX A;  2Q9B A;  1IZM A;  2XL6 A;  2YEV A;  5BUO A;  5DO9 B;  5L0I A;  2BCJ A;  4D4X A;  2WL8 A;  2IOQ A;  2RSE B;  1APC A;  3A11 A;  4J7Y A;  4XPY A;  3TD7 A;  2HFI A;  2IHB B;  4K1O A;  3WG7 C;  4CIH A;  4W8P A;  3V5Y A;  2KSF A;  2ZXP A;  4NQF A;  1RMV A;  1KNY A;  2P7V A;  4CIP A;  2J9B A;  3CIK A;  2HSB A;  3ECS A;  3GM1 A;  4L6R A;  2HJ3 A;  3C8G D;  3NKE A;  2EPL X;  3TJ6 A;  1HMD A;  2YLD A;  5L0F A;  2EIN C;  2XLH A;  2WZL A;  2ZXW C;  5DS6 A;  1YVI A;  4JUR I;  1B68 A;  3WHN A;  2A1D D;  2NPU A;  1J8Y F;  2IXM A;  4LDR A;  3OWT A;  1W2W A;  4IGG A;  5B1A C;  5CI9 A;  1D1A A;  5B1B C;  4JE9 A;  4MND A;  4U9E A;  4MVS A;  2ASR A;  3TUL A;  3GM2 A;  3QW0 A;  4XEF A;  2OWI A;  1LIH A;  1U89 A;  2YKZ A;  4EIY A;  4E17 A;  3S84 A;  4KNV A;  1ORJ A;  2HJM A;  4NTB A;  4BJ5 A;  1PCX A;  3NMI A;  2J0W A;  3QMK A;  4LDK A;  4CSA A;  2KQ9 A;  2JPU A;  4GYT A;  2B0H A;  2NUP B;  2Y69 C;  2VCC A;  3T6J A;  3U2L A;  2KW3 C;  3I4U A;  2YRF A;  2CW0 F;  4IWB A;  1R4T A;  1FFT C;  2EPN A;  4YL1 A;  5HE2 A;  1MNE A;  1LE2 A;  3LNM B;  2KJG A;  2R7S A;  4MW3 A;  2R03 A;  1T6U A;  3L8J A;  2YL3 A;  2G3V A;  2YWA A;  3H65 A;  4DOZ A;  1VOM A;  3EG9 A;  1I5N A;  2PNO A;  2QE9 A;  3FAP B;  3KYI A;  3SZR A;  5CI8 A;  3B0V C;  4CDV A;  5L3Q A;  2OJ4 A;  1F1M A;  3UMK A;  2AVK A;  3EG9 B;  4PJL A;  1RKC A;  4AL0 A;  4H54 A;  4NTF A;  5A6B A;  4ZLC A;  1D0Y A;  1VYI A;  4HE8 D;  1H6G A;  1Z23 A;  4MVR A;  4JTD B;  2KC3 A;  1DK8 A;  4DBQ A;  4OIP F;  1D0X A;  2GFH A;  2PX0 A;  3POV A;  3EH1 A;  1T5O A;  3DM5 A;  3M1C B;  1U6H A;  2VCB A;  3L34 A;  5KYX A;  4G7Z F;  2A0B A;  1OQC A;  3ABK C;  2R7R A;  2IXN A;  3KYJ A;  4K0D A;  5KYX B;  1OR2 A;  2BL2 A;  5DS4 A;  4JC7 A;  4XPW A;  3KRW A;  2KYH A;  5COF A;  2YLG A;  5JRA A;  5A6J A;  4BJT A;  4BEJ A;  3RH3 A;  1NSG B;  3JYY A;  3GWN A;  3FDQ A;  4BEM J;  2J9W A;  3CSK A;  1ZHY A;  3NMJ A;  3W8I A;  3IQC A;  4AX2 A;  4FX5 A;  3DE9 A;  2OQM A;  4YT2 A;  2XLO A;  2XLW A;  3FMS A;  4TND A;  1VYK A;  4U9D A;  2L6G A;  3FVY A;  1DOW A;  1C17 M;  1EI7 A;  2LCH A;  3GEE A;  4I1O B;  2LQG A;  3EZI A;  4WJ0 A;  1K05 A;  1OCR C;  4YK5 A;  4EKD B;  4E0I A;  4DVY P;  4E7Z A;  3V7O A;  2XLE A;  3LUT B;  4IAO A;  4QI0 A;  2LP4 A;  3TOL A;  2CCY A;  2L7A A;  5COM A;  3FAJ A;  1AGR E;  3UGO A;  2ETS A;  3H2V A;  3ASO C;  5JUA A;  3QTH A;  3PDM P;  2CDQ A;  1ZHW A;  2AU5 A;  3HTK C;  3K1H A;  2J8W A;  4GEH A;  1QKR A;  3Q6M A;  1UFB A;  3ABM C;  2QUP A;  2WVN A;  4JCH A;  4Q7C A;  4CS9 C;  5CIV A;  5F28 E;  3LNR A;  3NYO A;  1Q0D A;  5E3C A;  3QW1 A;  4YT8 A;  2AWC A;  1O5H A;  2Y3D A;  4HFF B;  3TOM A;  4MW8 A;  2PFD A;  1HE9 A;  4MTO A;  4CS8 C;  3B0P A;  5E33 A;  3U2M A;  3UNG C;  4MVM A;  3LS1 A;  2GTP C;  4MVQ A;  1TQG A;  4ULW A;  1VLT A;  5KYU A;  1YA7 O;  2VB6 A;  1BR4 A;  3B9Q A;  3HNI A;  3C7K B;  3RW0 A;  1AEP A;  1CGO A;  2J7P D;  4RD9 A;  1E84 A;  4HTE A;  1MQV A;  2PX3 A;  3SXK A;  2AF0 A;  5KYU B;  1A0B A;  2C03 A;  4DVZ A;  4DBR A;  3T6G B;  1G4U S;  2OU6 A;  1VMA A;  2XRH A;  1MND A;  3TJ5 A;  4IAR A;  3EJN A;  1JMW A;  1M6T A;  2D5R B;  4PK4 A;  3DD7 A;  1EZY A;  3C7J A;  2D9J A;  5E3A A;  5T3W A;  1AVO B;  3KMI A;  1DOV A;  1LS4 A;  4JTA B;  3ZTM A;  1NZE A;  2A6H F;  1G4W R;  2EIL C;  3ZIB A;  3K1I A;  1OR3 A;  5JP7 A;  1ST6 A;  1EZT A;  2R05 A;  2EPO A;  4N4W A;  4O6Y A;  2YVK A;  1WWP A;  1FMW A;  3NMK A;  4KBL A;  4XEV A;  3W4Y A;  4EBK A;  3GOD A;  3HKK A;  3JZ0 A;  1YDI A;  3GOR A;  4PFP A;  5FZT A;  3C62 A;  5E2Q A;  4DJ9 A;  3L0I A;  3AG1 C;  1D1B A;  1FQK B;  4OD4 A;  1QZX A;  2W4M A;  4MTF A;  4BJ1 A;  4EBJ A;  2HUJ A;  3UMH A;  4JRZ A;  4FAP B;  1SZI A;  1Z3I X;  1EMU A;  1O3U A;  3AG4 C;  2IK8 B;  3EZH A;  1E85 A;  3I5Q A;  2J46 A;  1QQ3 A;  1HY5 A;  2Q9A A;  3K33 A;  2Q9C A;  2ZD9 A;  5KYN A;  1S05 A;  2V4Z B;  1NU9 C;  2O9X A;  4F4B A;  3DAG A;  4J32 B;  2EBZ A;  4CS8 A;  3NDB B;  3QZC A;  3S29 A;  2EPK X;  1K40 A;  5BQG A;  5EHH A;  1NU7 D;  1T9K A;  3JTL O;  4YJW A;  2ZPA A;  5JLI A;  1ORY A;  2YL1 A;  4AE4 B;  4B6I A;  3W2W A;  4OIR F;  1Z63 A;  2ODE B;  4MK0 A;  4G0H A;  1CGM E;  2HV7 A;  1HW1 A;  1VTM P;  5K0I A;  4IJJ A;  4P9F A;  1JOG A;  2QTV A;  3HNK A;  3C8G A;  3BRJ A;  3HNJ A;  3I5P A;  3NG1 A;  5AC5 A;  2W4B A;  2BV1 A;  4PJJ A;  1OCC C;  3EGD B;  2NUP A;  2CRP A;  1OKK D;  3A9C A;  3FHD A;  2IXP A;  2YL7 A;  3B29 A;  3C8G B;  3EHN A;  3FOP A;  4J30 B;  4LER A;  1LI5 A;  4FES A;  4QDL A;  4E0H A;  4KI2 A;  1EKY A;  3Q7G A;  3VRC A;  3V5W A;  1FQJ B;  2XLM A;  3DE8 A;  3LES A;  1LKX A;  1TFO B;  2HZ8 A;  1YLM A;  2VAS A;  1GM5 A;  1OCZ C;  2NUT A;  1QLE C;  4N6H A;  2MYS A;  4U5C E;  3CQZ A;  2JX0 A;  1XZP A;  3RFY A;  3T9O A;  4A4A A;  2JNU A;  3EFO B;  4C3D A;  3NRH A;  2BT2 A;  3U9M A;  2NUT B;  3AJM A;  3ASN C;  5A69 A;  3GM3 A;  1OKK A;  3RKO F;  4HFK B;  2TMV P;  4RDA A;  1KU2 A;  5JVE A;  4ULV A;  3RVY A;  4Q5S F;  3W8H A;  1WAS A;  3LJB A;  5FCL A;  1WGW A;  2X51 A;  2D4U A;  3ZSU A;  2Q3T A;  4JCZ A;  1EQ1 A;  5L3V A;  2EIM C;  2UUI A;  2KK1 A;  3O55 A;  1OW6 A;  1IW7 F;  2DYR C;  4LAC B;  2Z15 A;  2HMZ A;  4AK9 A;  1MMN A;  5DQT A;  4PJN A;  1RJ9 B;  1RKE B;  1Q0K A;  3T6B A;  3MX3 A;  1YAR O;  4CS7 A;  5HE3 A;  1D0Z A;  3C8Z A;  2PBE A;  2X0C A;  5HE1 A;  3SP1 A;  3U3F A;  2HMQ A;  1UG7 A;  3CEX A;  3DI5 A;  2OCC C;  3F46 A;  3ATP A;  4EWC A;  2FFH A;  4NC3 A;  2BE5 F;  3LEV A;  4EKW A;  1FTS A;  3R7C A;  3JSE O;  4DRI B;  1XWJ A;  2WB7 A;  2DLV A;  4TNB A;  1Q0F A;  3N24 A;  3RYL A;  4PNK A;  1CPQ A;  1JPN A;  3U8V A;  4EUK B;  2R7U A;  2R7O A;  1H7I A;  1M2V B;  3UR3 C;  5DLJ A;  5BQH A;  1VLS A;  2I8B A;  4M63 A;  1OMW A;  3C63 A;  2DGJ A;  2L81 A;  2M4E A;  2XM4 A;  1BR1 A;  2F22 A;  1JR8 A;  4MTG A;  2OEV A;  3E9V A;  1H9T A;  3JCU Q;  3MYI A;  2ICW G;  1K04 A;  1ZW2 A;  2PF4 E;  3AOU A;  1ZW3 A;  4Z9I A;  3WOD F;  1T01 A;  3RF3 A;  4BPM A;  2QY9 A;  3EQL F;  3V5Z A;  4E7S A;  4O6M A;  2HV6 A;  2C04 A;  3FXH A;  3O39 A;  5L0J A;  2PP4 A;  3DMD A;  1E86 A;  2R02 A;  2LFD A;  2QLA A;  1LE4 A;  3MBG A;  3U3B A;  1T6Q A;  2W9Y A;  1PD1 A;  1M56 C;  4CDA A;  2R7T A;  2WVQ A;  1ORS C;  5HV9 A;  4XLN F;  2LFF A;  1FAP B;  3V5X A;  4Z9J A;  3NYJ A;  3Q7L A;  4OIN F;  3C7L A;  1LPE A;  2A6E F;  3ZQV A;  2J9U A;  2IBF A;  4BJ6 C;  4ZLD A;  1XZQ A;  2ZXR A;  1ZZP A;  4WGZ A;  2Q00 A;  2CNW D;  2R7X A;  2L6F A;  3AG2 C;  3M15 A;  1A7D A;  3KH2 A;  3IQ5 A;  5D91 A;  3PVU A;  3SYN A;  3UMI A;  2P1A A;  1G8X A;  3UZT A;  2LIG A;  3U0C A;  1PV3 A;  3NYN A;  2OJQ A;  4PAC A;  3IPM O;  3LLI A;  4MVZ A;  2DB4 A;  1TFK B;  3AGU A;  4CJG A;  2EIK C;  2ZXO A;  3QVY A;  1YYJ A;  3N0T A;  4U5D E;  3LS0 A;  3AGT A;  3ZC4 A;  1LM3 B;  2Y3H A;  4JJF A;  3C18 A;  2FAP B;  2DI3 A;  3PVW A;  4I44 A;  2GAQ A;  5KYW B;  1CGN A;  3DJN B;  1YJG A;  1AUE A;  1FMV A;  3ZDL A;  1NG1 A;  2HKV A;  3GAN A;  1JAF A;  4PJM A;  5B3S C;  4U5F E;  3O10 A;  2WZG A;  4XWJ A;  1RCP A;  3VM6 A;  2XXA B;  4LLC A;  1S7Z A;  4KC9 A;  4G7H F;  1OW8 A;  2IYL D;  1U0B B;  1Y4C A;  2Y3G A;  2J7P A;  2QNL A;  2XM0 A;  2A69 F;  4U5H A;  2R7W A;  2Y3B A;  3SXY A;  2VCA A;  3S90 A;  4CJO A;  3IEE A;  1NBB A;  4W8K A;  2Y39 A;  4EHP A;  2CGE A;  5AGF A;  5JT4 A;  1SMY F;  3UGP A;  2RD9 A;  2XL8 A;  4JIO A;  4MVO A;  4CS9 A;  1CMZ A;  1V54 C;  4JJG A;  4XEK A;  2J45 A;  2Q7R A;  4PR9 A;  3VYW A;  4ER9 A;  4XPX A;  2R25 A;  1QSP A;  2CYD A;  4BJ6 A;  3HLZ A;  1ZYR F;  1Y6D A;  1WN0 A;  3F47 A;  2MWQ A;  3M4B A;  3ZTZ A;  4E18 A;  1A7V A;  1E2X A;  4U5G A;  4O7G A;  5JS5 A;  1ZU4 A;  1OXK A;  2NG1 A;  2NSF A;  2VH3 A;  2YZS A;  2AWY A;  3L1M A;  4JEA A;  2XLV A;  4U5E E;  4I3M A;  3T4R A;  3ZVR A;  3B0U X;  1LI7 A;  2HSQ A;  3OA1 A;  4N06 A;  2AP3 A;  4GQH A;  3RQG A;  3DWW A;  2A0U A;  3JSZ A;  3X2Q C;  3X1O A;  1L3P A;  3FOO A;  5L0C A;  1Z7Q c;  3EGD A;  3VAY A;  3AG3 C;  2XLD A;  3GEH A;  4P6I C;  5L0H A;  3KL4 A;  2LSE A;  3MYF A;  2L9J A;  4JEB A;  4MVU A;  4OIQ F;  1SF8 A;  1I4Y A;  3EH2 A;  3KPH A;  1BR2 A;  2L6H A;  1C03 A;  1GQA A;  2OKU A;  3EGX A;  3K7D A;  3LLK A;  5A6K A;  2G62 A;  1TWC A;  3S9O A;  3K66 A;  3EGX B;  3EFO A;  1HW2 A;  4X0R A;  3MFN A;  4FWV A;  4JW1 A;  2H8A A;  2VC9 A;  1Z6A A;  3U8P A;  1HE1 A;  3N2Z B;  4O79 A;  4NTA A;  2WVO A;  4OD5 A;  1YA9 A;  4KNW A;  5DVW A;  3ZG1 A;  4YL3 A;  4AE4 A;  5HSW A;  3M4C A;  2OG2 A;  3O6X A;  1D1C A;  1M2O A;  2XSE A;  4JVS A;  5JSL A;  1NLX A;  5T1D B;  4A2N B;  2W45 A;  1BZ4 A;  3QVZ A;  2KNH A;  4HEA J;  4IRU A;  1QPU A;  4XLP F;  2NSG A;  1SR2 A;  1TWH A;  4O6N A;  4DRJ B;  2IM8 A;  1G5Z A;  2GA0 A;  1A41 A;  2OJE D;  2R9R B;  3DZA A;  3J06 A;  1RJ9 A;  1RKE A;  1V74 B;  3BEH A;  3DM9 B;  3DJU B;  2YLI A;  3LEO A;  1WTY A;  4LLE A;  4Z9H A;  3U5S A;  4D4N A;  1GS9 A;  1FFH A;  3AQB A;  3S0X A;  5BQI A;  3ZQY A;  5A6B D;  2J9V A;  1JRA A;  4NY3 A;  4JZA A;  4ONS A;  2XS1 A;  3L8I A;  1YAU O;  4J7T A;  4BG0 A;  1V55 C;  1VB5 A;  5GPG B;  2YQY A;  3SXZ A;  3MLG A;  4YL0 A;  1M57 C;  2UUH A;  1A7E A;  5HE0 A;  3RQE A;  1NFO A;  3CAX A;  3NYM A;  5KYY A;  3GEI A;  4YWQ A;  3RIP A;  4IB4 A;  5D92 A;  3U9J A;  3LAY A;  4YT4 A;  2JM5 A;  3CZ6 A;  5AC4 A;  3R2P A;  1M2V A;  4ANJ A;  5EK0 A;  5KYY B;  1BBH A;  2OOC A;  1SYQ A;  3H2U A;  1N1C A;  2V3C C;  3KRX A;  2MHR A;  3IQT A;  3OEO A;  4C7O A;  5F5H A;  2IXO A;  3EHM A;  1ZHZ A;  3G4Z A;  5DQZ A;  3HJC A;  4YN0 B;  1EA8 A;  2XS8 A;  2B0J A;  1TR2 A;  3PMR A;  4YT5 A;  4C7O B;  4I1M A;  3PHF 2;  4C3B A;  4CDY A;  2JD3 A;  3WAQ A;  2P6V A;  2XL4 A;  4JTC B;  2J0X A;  3S27 A;  3DAF A;  1TWA A;  3G4X A;  1I4Z A;  3RQF A;  4NCQ A;  4XQ1 A;  2HS5 A;  3DKA A;  3E70 C;  1WOL A;  1HMO A;  1H9G A;  1TKN A;  3IHU A;  2G3K A;  2LK4 A;  4WAB A;  4MQ9 F;  5A6A A;  1LVK A;  4K7B A;  4P9T A;  5T3T A;  3KKB A;  2R7V A;  3JT1 A;  4H4K C;  1MMD A;  3GWL A;  3NKD A;  1RXQ A;  4PFO A;  3SNH A;  3ABL C;  1Q0M A;  1FNT c;  1V4A A;  1KTM A;  1MMG A;  1QVX A;  4R32 A;  1LS1 A;  5DS5 A;  3PCV A;  4C3E A;  4OIO F;  5IY5 C;  3K1I C;  3Q6N A;  1OXB A;  2BC5 A;  1ZHX A;  1VK5 A;  3IQ6 A;  1Q0G A;  1MMA A; 
#chains in the Genus database with same CATH homology
 4RBN A;  3W2V A;  5F5F A;  1ZU5 A;  5KYW A;  4XTK A;  2A68 F;  2CNW A;  1OCO C;  1J8M F;  2XXA A;  4CBE A;  2DYS C;  1O87 A;  3JYH A;  2KGO A;  1ZHT A;  2V26 A;  1JPJ A;  5EGY A;  1PD0 A;  2YHS A;  1Z5Z A;  2FGY A;  4G7O F;  3DXJ F;  2EIJ C;  3AQC A;  2WZF A;  2H7V C;  4QI2 A;  4BJ5 C;  3SEO A;  1TWG A;  2H7B A;  2R7Q A;  4U5B E;  4CSA C;  3EPV A;  3K6B A;  2H7O A;  2E87 A;  3JRT A;  3S28 A;  3NYL A;  3ITF A;  2Q9B A;  1IZM A;  2YEV A;  5BUO A;  2WL8 A;  2IOQ A;  3TD7 A;  4CIH A;  3WG7 C;  2ZXP A;  2P7V A;  3ECS A;  3NKE A;  2EIN C;  2WZL A;  2ZXW C;  5DS6 A;  4JUR I;  2A1D D;  1J8Y F;  2IXM A;  3OWT A;  1W2W A;  5B1A C;  5CI9 A;  1D1A A;  5B1B C;  4MND A;  4KNV A;  4BJ5 A;  1PCX A;  2J0W A;  3QMK A;  4CSA A;  2KQ9 A;  4GYT A;  2NUP B;  2Y69 C;  3T6J A;  2KW3 C;  3I4U A;  4IWB A;  2CW0 F;  1FFT C;  1MNE A;  2KJG A;  2R7S A;  2G3V A;  3H65 A;  4DOZ A;  1VOM A;  3EG9 A;  3B0V C;  3SZR A;  5CI8 A;  5L3Q A;  3UMK A;  3EG9 B;  4PJL A;  4ZLC A;  1D0Y A;  1VYI A;  4HE8 D;  1Z23 A;  4OIP F;  4DBQ A;  1D0X A;  2GFH A;  2PX0 A;  3POV A;  3EH1 A;  3DM5 A;  3M1C B;  5KYX A;  3L34 A;  4G7Z F;  3ABK C;  2R7R A;  2IXN A;  4K0D A;  5KYX B;  5DS4 A;  4BJT A;  4BEJ A;  3RH3 A;  3FDQ A;  2J9W A;  3CSK A;  1ZHY A;  3W8I A;  4AX2 A;  4FX5 A;  4YT2 A;  1VYK A;  3FVY A;  4I1O B;  4Q4Z F;  3EZI A;  4WJ0 A;  4DVY P;  1OCR C;  4E7Z A;  3V7O A;  4IAO A;  4QI0 A;  3FAJ A;  3UGO A;  3ASO C;  2CDQ A;  1ZHW A;  3HTK C;  3K1H A;  4GEH A;  4CS9 C;  3Q6M A;  3ABM C;  2WVN A;  4JCH A;  4Q7C A;  3LNR A;  5E3C A;  4YT8 A;  1O5H A;  2Y3D A;  4HFF B;  2PFD A;  4CS8 C;  3B0P A;  5E33 A;  3UNG C;  3LS1 A;  4ULW A;  5KYU A;  2VB6 A;  1BR4 A;  3B9Q A;  4RD9 A;  2J7P D;  4HTE A;  2PX3 A;  5KYU B;  2C03 A;  4DVZ A;  4DBR A;  2XRH A;  1VMA A;  1MND A;  3EJN A;  2D5R B;  4PK4 A;  3DD7 A;  5E3A A;  5T3W A;  3KMI A;  1NZE A;  2A6H F;  2EIL C;  3ZIB A;  1ST6 A;  4O6Y A;  1FMW A;  4KBL A;  3GOD A;  4PFP A;  5E2Q A;  3L0I A;  3AG1 C;  1D1B A;  4OD4 A;  1QZX A;  2W4M A;  3UMH A;  1SZI A;  1Z3I X;  3AG4 C;  3EZH A;  3I5Q A;  2J46 A;  2Q9A A;  3K33 A;  2Q9C A;  5KYN A;  1NU9 C;  2O9X A;  4F4B A;  3DAG A;  4J32 B;  4CS8 A;  3NDB B;  3QZC A;  3S29 A;  5EHH A;  1NU7 D;  4YJW A;  2ZPA A;  4B6I A;  3W2W A;  4OIR F;  1Z63 A;  4G0H A;  2HV7 A;  4IJJ A;  2QTV A;  3I5P A;  3NG1 A;  2W4B A;  4PJJ A;  1OCC C;  3EGD B;  2NUP A;  1OKK D;  3FHD A;  2IXP A;  4LER A;  3EHN A;  4J30 B;  4QDL A;  4KI2 A;  4FES A;  3Q7G A;  3LES A;  1LKX A;  2VAS A;  1OCZ C;  2NUT A;  1QLE C;  4U5C E;  2MYS A;  3RFY A;  3CQZ A;  3EFO B;  4C3D A;  3NRH A;  2NUT B;  3ASN C;  1OKK A;  3RKO F;  4HFK B;  4RDA A;  1KU2 A;  4Q5S F;  3W8H A;  3LJB A;  5FCL A;  1WGW A;  2X51 A;  3ZSU A;  2Q3T A;  5L3V A;  2EIM C;  1IW7 F;  2DYR C;  4LAC B;  2Z15 A;  4AK9 A;  1MMN A;  5DQT A;  4PJN A;  1RJ9 B;  3T6B A;  3MX3 A;  4CS7 A;  1D0Z A;  3SP1 A;  3F46 A;  2OCC C;  4EWC A;  2FFH A;  2BE5 F;  3LEV A;  1FTS A;  2WB7 A;  3N24 A;  3RYL A;  1JPN A;  2R7U A;  2R7O A;  1M2V B;  3UR3 C;  5DLJ A;  2I8B A;  4M63 A;  2DGJ A;  2L81 A;  2M4E A;  1BR1 A;  3E9V A;  3JCU Q;  2PF4 E;  3WOD F;  4E7S A;  2QY9 A;  3EQL F;  4O6M A;  2HV6 A;  2C04 A;  3O39 A;  2PP4 A;  3DMD A;  2W9Y A;  1PD1 A;  1M56 C;  2R7T A;  2WVQ A;  4XLN F;  3NYJ A;  3Q7L A;  4OIN F;  2A6E F;  2J9U A;  4BJ6 C;  4ZLD A;  2ZXR A;  2CNW D;  2R7X A;  3AG2 C;  3KH2 A;  5D91 A;  3SYN A;  3UMI A;  1G8X A;  3LLI A;  2EIK C;  2ZXO A;  3N0T A;  4U5D E;  3LS0 A;  3ZC4 A;  2Y3H A;  4JJF A;  4I44 A;  5KYW B;  3DJN B;  1FMV A;  1NG1 A;  3GAN A;  4PJM A;  4U5F E;  2WZG A;  4XWJ A;  2XXA B;  4LLC A;  1S7Z A;  4KC9 A;  4G7H F;  2IYL D;  2Y3G A;  2J7P A;  4U5H A;  2A69 F;  2R7W A;  2Y3B A;  3IEE A;  4W8K A;  2Y39 A;  2CGE A;  1SMY F;  3UGP A;  4CS9 A;  1V54 C;  4JJG A;  2J45 A;  3VYW A;  4BJ6 A;  3HLZ A;  1ZYR F;  3F47 A;  2MWQ A;  4U5G A;  4O7G A;  1ZU4 A;  2NG1 A;  2VH3 A;  4U5E E;  2YZS A;  4I3M A;  3T4R A;  3ZVR A;  3B0U X;  3OA1 A;  4N06 A;  3JSZ A;  3X2Q C;  3X1O A;  3EGD A;  3VAY A;  3AG3 C;  4P6I C;  3KL4 A;  2LSE A;  2L9J A;  4OIQ F;  1SF8 A;  3EH2 A;  1BR2 A;  3EGX A;  3K7D A;  3LLK A;  2G62 A;  1TWC A;  3K66 A;  3EGX B;  3EFO A;  4X0R A;  4FWV A;  4JW1 A;  1Z6A A;  3N2Z B;  5DVW A;  4O79 A;  3ZG1 A;  2WVO A;  4OD5 A;  4AE4 A;  4KNW A;  4EBB A;  5HSW A;  2OG2 A;  3O6X A;  1D1C A;  1M2O A;  2XSE A;  4JVS A;  5T1D B;  4A2N B;  4AE4 B;  4XLP F;  2W45 A;  4HEA J;  2KNH A;  4IRU A;  1TWH A;  4O6N A;  3DZA A;  1RJ9 A;  3DM9 B;  4LLE A;  4BJ1 A;  5B3S C;  3DJU B;  3S0X A;  1FFH A;  3AQB A;  2J9V A;  4NY3 A;  4JZA A;  4BG0 A;  1V55 C;  3MLG A;  1M57 C;  3NYM A;  5KYY A;  4YWQ A;  3RIP A;  5D92 A;  3LAY A;  4YT4 A;  3CZ6 A;  1M2V A;  4ANJ A;  5KYY B;  1N1C A;  2V3C C;  3OEO A;  4C7O A;  5F5H A;  2IXO A;  3EHM A;  1ZHZ A;  5DQZ A;  3HJC A;  4YN0 B;  4YT5 A;  2B0J A;  1TR2 A;  3PMR A;  4C7O B;  4I1M A;  3PHF 2;  4C3B A;  2JD3 A;  2P6V A;  2XL4 A;  2J0X A;  3S27 A;  3DAF A;  1TWA A;  3E70 C;  1TKN A;  2G3K A;  4MQ9 F;  1LVK A;  4K7B A;  5T3T A;  3KKB A;  2R7V A;  3JT1 A;  4H4K C;  1MMD A;  3NKD A;  4PFO A;  3SNH A;  3ABL C;  1MMG A;  5DS5 A;  1LS1 A;  4C3E A;  4OIO F;  5IY5 C;  3K1I C;  3Q6N A;  1ZHX A;  1VK5 A;  1MMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...