The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
35
|
sequence length |
128
|
structure length |
128
|
Chain Sequence |
PSPEEVQSWAQSFDKLMHSPAGRSVFRAFLRTEYSEENMLFWLACEELKAEANQHVVDEKARLIYEDYVSILSPKEVSLDSRVREGINKKMQEPSAHTFDDAQLQIYTLMHRDSYPRFLSSPTYRALL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Signaling protein regulation
|
source organism |
Homo sapiens
|
publication title |
Solution structure of human GAIP (Galpha interacting protein): a regulator of G protein signaling.
pubmed doi rcsb |
molecule keywords |
PROTEIN (GAIP (G-ALPHA INTERACTING) PROTEIN)
|
total genus |
35
|
structure length |
128
|
sequence length |
128
|
ec nomenclature | |
pdb deposition date | 1999-05-12 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00615 | RGS | Regulator of G protein signaling domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 2 | Regulator of G-protein Signalling 4, domain 2 | ||
Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 1 | Regulator of G-protein Signalling 4; domain 1 |
#chains in the Genus database with same CATH superfamily 1EZY A; 2JM5 A; 2ODE B; 5HE0 A; 2AF0 A; 5HE1 A; 1FQI A; 4EKD B; 1FQK B; 2EBZ A; 1CMZ A; 2D9J A; 3NYO A; 2V4Z B; 3KRX A; 5DO9 B; 1DK8 A; 5HE2 A; 1FQJ B; 2GTP C; 2IK8 B; 3CIK A; 5HE3 A; 4MK0 A; 4PNK A; 2BT2 A; 1AGR E; 2OJ4 A; 3C7L A; 3PVU A; 4TND A; 3C7K B; 1EZT A; 2BCJ A; 1EMU A; 3PVW A; 2OWI A; 2JNU A; 2IHB B; 2CRP A; 1OMW A; 3PSC A; 3NYN A; 3UZT A; 3V5W A; 3KRW A; 2DLV A; 4TNB A; 2IHD A; 2BV1 A; #chains in the Genus database with same CATH topology 1EZY A; 2JM5 A; 2ODE B; 5HE0 A; 2AF0 A; 5HE1 A; 1FQI A; 4EKD B; 1FQK B; 2EBZ A; 1CMZ A; 2D9J A; 3NYO A; 2V4Z B; 3KRX A; 5DO9 B; 1DK8 A; 5HE2 A; 1FQJ B; 2GTP C; 2IK8 B; 5REQ B; 3CIK A; 5HE3 A; 4MK0 A; 4PNK A; 2BT2 A; 1AGR E; 2OJ4 A; 3C7L A; 3PVU A; 4TND A; 4HTE A; 3C7K B; 1EZT A; 2BCJ A; 1EMU A; 3PVW A; 3I5Q A; 2OWI A; 2JNU A; 2IHB B; 2CRP A; 1OMW A; 3PSC A; 3NYN A; 3UZT A; 3V5W A; 3KRW A; 2DLV A; 4TNB A; 2IHD A; 3QYF A; 2BV1 A; #chains in the Genus database with same CATH homology 1EZY A; 2JM5 A; 2ODE B; 5HE0 A; 2AF0 A; 5HE1 A; 1FQI A; 4EKD B; 1FQK B; 2EBZ A; 1CMZ A; 2D9J A; 3NYO A; 2V4Z B; 3KRX A; 5DO9 B; 1DK8 A; 5HE2 A; 1FQJ B; 2GTP C; 2IK8 B; 5REQ B; 3CIK A; 5HE3 A; 4MK0 A; 4PNK A; 2BT2 A; 1AGR E; 2OJ4 A; 3C7L A; 3PVU A; 4TND A; 3C7K B; 1EZT A; 2BCJ A; 1EMU A; 3PVW A; 2OWI A; 2JNU A; 2IHB B; 2CRP A; 1OMW A; 3PSC A; 3NYN A; 3UZT A; 3V5W A; 3KRW A; 2DLV A; 4TNB A; 2IHD A; 3QYF A; 2BV1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...