The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
144
|
structure length |
144
|
Chain Sequence |
YKKPSDAELKRTLTEEQYQVTQNSATEYAFSHEYDHLFKPGIYVDVVSGEPLFSSADKYDSGCGWPSFTRPIDAKSVTEHDDFSFNMRRTEVRSRAADSHLGHVFPDGPRDKGGLRYCINGASLKFIPLEQMDAAGYGALKGEV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxidoreductase
|
molecule keywords |
peptide methionine sulfoxide reductase
|
publication title |
The mirrored methionine sulfoxide reductases of Neisseria gonorrhoeae pilB.
pubmed rcsb |
source organism |
Neisseria gonorrhoeae
|
total genus |
39
|
structure length |
144
|
sequence length |
144
|
chains with identical sequence |
B
|
ec nomenclature |
ec
1.8.4.11: Peptide-methionine (S)-S-oxide reductase. |
pdb deposition date | 2002-02-15 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01641 | SelR | SelR domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Peptide methionine sulfoxide reductase. |
#chains in the Genus database with same CATH superfamily 3CXK A; 4TZC A; 4CI3 B; 4TZU A; 3HCI A; 4V30 A; 4V2Y A; 3HCJ A; 3HCH A; 4V2Z A; 3WX2 A; 3WX1 A; 4V31 A; 3E0M A; 1L1D A; 4TZ4 C; 5AMH A; 3HCG A; 4CI1 B; 2KZN A; 2K8D A; 2KV1 A; 3E0O A; 3MAO A; 4CI2 B; 3CEZ A; #chains in the Genus database with same CATH topology 1HXR A; 3CXK A; 4TZC A; 4CI3 B; 4TZU A; 2RMJ A; 2W4R A; 3GA3 A; 3HCI A; 3P3K A; 4V30 A; 5E3H A; 3EQT A; 4AY2 A; 1H7Y A; 4V2Y A; 4BPB A; 3NCU A; 3ZD7 A; 2KWB A; 2HR9 A; 3HCJ A; 3OG8 A; 3HCH A; 3ZD6 A; 4A2X A; 2LOY A; 2RQB A; 2YKG A; 4V2Z A; 3DJM A; 2QFB A; 3WX2 A; 3WX1 A; 2FU5 A; 5F98 A; 4V31 A; 1TXJ A; 3FAC A; 3E0M A; 2QFD A; 1L1D A; 4TZ4 C; 5F9H A; 1FWQ A; 2RQA A; 3LRN A; 1H6Q A; 5AMH A; 3HCG A; 4CI1 B; 3LRR A; 5F9F A; 2KZN A; 2K8D A; 2KV1 A; 2LVL A; 3E0O A; 3MAO A; 4CI2 B; 1YZ1 A; 3EBM A; 4A2V A; 3CEZ A; #chains in the Genus database with same CATH homology 3CXK A; 4TZC A; 4CI3 B; 4TZU A; 3HCI A; 4V30 A; 4V2Y A; 3HCJ A; 3HCH A; 4V2Z A; 3WX2 A; 3WX1 A; 4V31 A; 3E0M A; 1L1D A; 4TZ4 C; 5AMH A; 3HCG A; 4CI1 B; 2KZN A; 2K8D A; 2KV1 A; 3E0O A; 3MAO A; 4CI2 B; 3CEZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...