3GA3A

Crystal structure of the c-terminal domain of human mda5
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
133
structure length
133
Chain Sequence
b'AKHYKNNPSLITFLCKNCSVLACSGEDIHVIEKMHHVNMTPEFKELYIVRENKALQKKCADYQINGEIICKCGQAWGTMMVHKGLDLPCLKIRNFVVVFKNNSTKKQYKKWVELPITFPNLDYSELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Interferon-induced helicase C domain-containing protein 1, M
publication title Crystal structure of the C-terminal domain of human MDA5
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 28
structure length 133
sequence length 133
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2009-02-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.150.30 Mainly Beta Beta Complex Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A 3ga3A00
4A2XA 5E3HA 5F9FA 2RQAA 2W4RA 2YKGA 3LRRA 3OG8A 5F98A 3ZD7A 3GA3A 4A2VA 4AY2A 3NCUA 2RQBA 4BPBA 5F9HA 2RMJA 2QFBA 3ZD6A 3EQTA 2QFDA 3LRNA
chains in the Genus database with same CATH superfamily
4TZ4C 4TZCA 1FWQA 2KV1A 2K8DA 4A2XA 3HCGA 5E3HA 5F9FA 1H7YA 3ZD6A 1H6QA 2RQAA 3FACA 3CEZA 4V2YA 3MAOA 3HCIA 4V30A 2W4RA 3E0OA 4V2ZA 2YKGA 1TXJA 3LRRA 3HCHA 3OG8A 1L1DA 3LRNA 5AMHA 4TZUA 3EBMA 5F98A 3ZD7A 1YZ1A 2KWBA 3E0MA 1HXRA 3GA3A 3WX1A 4A2VA 4V31A 4CI1B 3DJMA 3WX2A 4AY2A 3NCUA 3HCJA 2HR9A 3CXKA 2RQBA 4BPBA 5F9HA 2LOYA 2RMJA 2LVLA 2QFBA 2KZNA 3P3KA 3EQTA 2QFDA 4CI2B 4CI3B 2FU5A
chains in the Genus database with same CATH topology
1FWQA 4A2XA 5E3HA 5F9FA 1H7YA 3ZD6A 1H6QA 2RQAA 3FACA 2W4RA 2YKGA 1TXJA 3LRRA 3OG8A 3EBMA 5F98A 3ZD7A 1YZ1A 2KWBA 1HXRA 3GA3A 4A2VA 3DJMA 4AY2A 3NCUA 2HR9A 2RQBA 4BPBA 5F9HA 2LOYA 2RMJA 2LVLA 2QFBA 3P3KA 3EQTA 2QFDA 3LRNA 2FU5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A2X A;  5E3H A;  5F9F A;  2RQA A;  2W4R A;  2YKG A;  3LRR A;  3OG8 A;  5F98 A;  3ZD7 A;  3GA3 A;  4A2V A;  4AY2 A;  3NCU A;  2RQB A;  4BPB A;  5F9H A;  2RMJ A;  2QFB A;  3ZD6 A;  3EQT A;  2QFD A;  3LRN A; 
#chains in the Genus database with same CATH topology
 4TZ4 C;  4TZC A;  1FWQ A;  2KV1 A;  2K8D A;  4A2X A;  3HCG A;  5E3H A;  5F9F A;  1H7Y A;  3ZD6 A;  1H6Q A;  2RQA A;  3FAC A;  3CEZ A;  4V2Y A;  3MAO A;  3HCI A;  4V30 A;  2W4R A;  3E0O A;  4V2Z A;  2YKG A;  1TXJ A;  3LRR A;  3HCH A;  3OG8 A;  1L1D A;  3LRN A;  5AMH A;  4TZU A;  3EBM A;  5F98 A;  3ZD7 A;  1YZ1 A;  2KWB A;  3E0M A;  1HXR A;  3GA3 A;  3WX1 A;  4A2V A;  4V31 A;  4CI1 B;  3DJM A;  3WX2 A;  4AY2 A;  3NCU A;  3HCJ A;  2HR9 A;  3CXK A;  2RQB A;  4BPB A;  5F9H A;  2LOY A;  2RMJ A;  2LVL A;  2QFB A;  2KZN A;  3P3K A;  3EQT A;  2QFD A;  4CI2 B;  4CI3 B;  2FU5 A; 
#chains in the Genus database with same CATH homology
 1FWQ A;  4A2X A;  5E3H A;  5F9F A;  1H7Y A;  3ZD6 A;  1H6Q A;  2RQA A;  3FAC A;  2W4R A;  2YKG A;  1TXJ A;  3LRR A;  3OG8 A;  3EBM A;  5F98 A;  3ZD7 A;  1YZ1 A;  2KWB A;  1HXR A;  3GA3 A;  4A2V A;  3DJM A;  4AY2 A;  3NCU A;  2HR9 A;  2RQB A;  4BPB A;  5F9H A;  2LOY A;  2RMJ A;  2LVL A;  2QFB A;  3P3K A;  3EQT A;  2QFD A;  3LRN A;  2FU5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...