The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
49
|
sequence length |
142
|
structure length |
142
|
Chain Sequence |
AREGIIGHYIHHNQRVGVLVELNCETDFVARNELFQNLAKDLAMHIAMMNPRYVSAEEIPAEELEKERQIYIQAALNEGKPQQIAEKIAEGRLKKYLEEVVLLEQPFVKDDKVKVKELIQQAIAKIGENIVVRRFCRFELGA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Elongation factor
|
source organism |
Thermus thermophilus
|
publication title |
Structure and importance of the dimerization domain in elongation factor Ts from Thermus thermophilus.
pubmed doi rcsb |
molecule keywords |
ELONGATION FACTOR TS
|
total genus |
49
|
structure length |
142
|
sequence length |
142
|
ec nomenclature | |
pdb deposition date | 1996-04-16 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | GTP Cyclohydrolase I; Chain A, domain 1 | GTP Cyclohydrolase I; Chain A, domain 1 | ||
Alpha Beta | 2-Layer Sandwich | Tetrahydropterin Synthase; Chain A | Elongation factor Ts, dimerisation domain |
#chains in the Genus database with same CATH superfamily 1XB2 B; 3BMB A; 4Q7J A; 1AIP C; 1EFU B; 1TFE A; 2PN0 A; #chains in the Genus database with same CATH topology 2KR1 A; 1FBX A; 4NE5 B; 1GTQ A; 3LZE A; 2P11 A; 4R8Q A; 1WUR A; 3LW5 K; 2WSE K; 3M0N A; 4DRB J; 1IS8 A; 2WSC K; 2WSF G; 4QPM A; 1B6Z A; 1EFU B; 2DTT A; 3QNA A; 3JYG A; 3LX3 A; 1Y13 A; 1XB2 B; 2OBA A; 4NTM A; 4JA3 A; 4DU6 A; 2RPB A; 4Q7J A; 3D7J A; 1N3S A; 1A8R A; 3BK6 A; 1WUQ A; 2G64 A; 1EL6 A; 1N3T A; 4NTK A; 3I2B A; 2WSF K; 4FVG A; 2LO0 A; 2O01 G; 2PN0 A; 4DRA E; 4FVF A; 1WIN A; 4E45 B; 2DJ6 A; 3B0B C; 1AIP C; 1FB1 A; 5DMZ A; 4E44 B; 4NE6 B; 4NTN A; 4FVJ A; 3BMB A; 3QN9 A; 3LW5 G; 2WSE G; 2WSC G; 1B66 A; 4NE3 B; 2A0S A; 3QN0 A; 1IS7 A; 1N3R A; 3VEJ A; 1GTP A; 1A9C A; 1WM9 A; 1TFE A; 2LNZ A; 1WPL A; #chains in the Genus database with same CATH homology 2KR1 A; 1FBX A; 4NE5 B; 2P11 A; 4R8Q A; 1WUR A; 4DRB J; 1IS8 A; 4QPM A; 1EFU B; 1XB2 B; 4JA3 A; 4DU6 A; 4Q7J A; 1N3S A; 1A8R A; 1WUQ A; 1EL6 A; 1N3T A; 2LO0 A; 2PN0 A; 4DRA E; 4E45 B; 3B0B C; 1AIP C; 1FB1 A; 5DMZ A; 4E44 B; 4NE6 B; 3BMB A; 4NE3 B; 1IS7 A; 1N3R A; 3VEJ A; 1GTP A; 1A9C A; 1WM9 A; 1TFE A; 2LNZ A; 1WPL A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...