The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
88
|
sequence length |
212
|
structure length |
212
|
Chain Sequence |
QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLT
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
CO-trapping site in heme oxygenase revealed by photolysis of its co-bound heme complex: mechanism of escaping from product inhibition
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Rattus norvegicus
|
molecule keywords |
Heme oxygenase 1
|
total genus |
88
|
structure length |
212
|
sequence length |
212
|
ec nomenclature |
ec
1.14.14.18: Heme oxygenase (biliverdin-producing). |
pdb deposition date | 2003-09-16 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01126 | Heme_oxygenase | Heme oxygenase |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Heme Oxygenase; Chain A | Heme oxygenase-like |
#chains in the Genus database with same CATH superfamily 1WZD A; 2F2G A; 1OZW A; 1WE1 A; 1XK1 A; 1UDD A; 1T5P A; 1XK0 A; 4WMH A; 2RD3 A; 1S13 A; 1UBB A; 4FN6 A; 4GOH A; 1IW1 A; 3NO6 A; 1XK3 A; 4G8W A; 1WOX A; 3DDE A; 1OYL A; 1TYH A; 1J2C A; 1J02 A; 2QZC A; 1S8C A; 1SK7 A; 2A2O A; 1N45 A; 1P3T A; 1DVE A; 2Q4X A; 2Q32 A; 3HOK A; 2QCX A; 4MEC A; 5BTQ A; 3MOO A; 1OTW A; 1VGI A; 1ULX A; 4NY7 A; 1RCW A; 1P3U A; 1OYK A; 1TO9 B; 1TWR A; 2ZVU A; 3I8R A; 4G7P A; 1OZR A; 2GM8 A; 1IX4 A; 1WOW A; 3I9T A; 3HML A; 1IW0 A; 2A2M A; 1RTW A; 1OTV A; 3OQL A; 1OZE A; 1WWM A; 1WZF A; 4GPH A; 2GM7 A; 4G98 A; 1WNX A; 2RGZ A; 4GPC A; 4GPF A; 4G99 A; 3B5P A; 1XK2 A; 1YAF A; 3TGM A; 1J77 A; 4WX0 A; 3B5O A; 1DVG A; 1XJZ A; 3HNH A; 3CZY A; 4RAJ A; 1YAK A; 3IBX A; 1NI6 A; 3RM5 A; 3K4F A; 4G8U A; 3I9U A; 3MVU A; 4G8P A; 4G7T A; 2A6B A; 2E7E A; 3BJD A; 1WZG A; 1TO9 A; 4G7U A; 1OZL A; 1N3U A; 3HLX A; 1TWN A; 4LQX A; 4WWJ A; 1IRM A; 1Z72 A; 4WD4 A; 4WWZ A; 2Z68 A; 2QPP A; 2DY5 A; 1WNV A; 1IX3 A; 4G7L A; 1P3V A; 1V8X A; 1WOV A; 1WNW A; 1IVJ A; #chains in the Genus database with same CATH topology 1WZD A; 2F2G A; 1OZW A; 1WE1 A; 1XK1 A; 1UDD A; 1T5P A; 1XK0 A; 4WMH A; 2RD3 A; 1S13 A; 1UBB A; 4FN6 A; 4GOH A; 1IW1 A; 3NO6 A; 1XK3 A; 4G8W A; 1WOX A; 3DDE A; 1OYL A; 1TYH A; 1J2C A; 1J02 A; 2QZC A; 1S8C A; 1SK7 A; 2A2O A; 1N45 A; 1P3T A; 1DVE A; 2Q4X A; 2Q32 A; 3HOK A; 2QCX A; 4MEC A; 5BTQ A; 3MOO A; 1OTW A; 1VGI A; 1ULX A; 4NY7 A; 1RCW A; 1P3U A; 1OYK A; 1TO9 B; 1TWR A; 2ZVU A; 3I8R A; 4G7P A; 1OZR A; 2GM8 A; 1IX4 A; 1WOW A; 3I9T A; 3HML A; 1IW0 A; 2A2M A; 1RTW A; 1OTV A; 3OQL A; 1OZE A; 1WWM A; 1WZF A; 4GPH A; 2GM7 A; 4G98 A; 1WNX A; 2RGZ A; 4GPC A; 4GPF A; 4G99 A; 3B5P A; 1XK2 A; 1YAF A; 3TGM A; 1J77 A; 4WX0 A; 3B5O A; 1DVG A; 1XJZ A; 2LCU A; 3HNH A; 3CZY A; 4RAJ A; 1YAK A; 3IBX A; 1NI6 A; 3RM5 A; 3K4F A; 4G8U A; 3I9U A; 3MVU A; 4G8P A; 4G7T A; 2A6B A; 2E7E A; 3BJD A; 1WZG A; 1TO9 A; 4G7U A; 1OZL A; 1N3U A; 3HLX A; 1TWN A; 4LQX A; 4WWJ A; 1IRM A; 1Z72 A; 4WD4 A; 4WWZ A; 2Z68 A; 2QPP A; 2DY5 A; 1WNV A; 1IX3 A; 4G7L A; 1P3V A; 1V8X A; 1WOV A; 1WNW A; 1IVJ A; #chains in the Genus database with same CATH homology 1WZD A; 2F2G A; 1OZW A; 1WE1 A; 1XK1 A; 1UDD A; 1T5P A; 1XK0 A; 4WMH A; 2RD3 A; 1S13 A; 1UBB A; 4FN6 A; 4GOH A; 1IW1 A; 3NO6 A; 1XK3 A; 4G8W A; 1WOX A; 3DDE A; 1OYL A; 1TYH A; 1J2C A; 1J02 A; 2QZC A; 1S8C A; 1SK7 A; 2A2O A; 1N45 A; 1P3T A; 1DVE A; 2Q4X A; 2Q32 A; 3HOK A; 2QCX A; 4MEC A; 5BTQ A; 3MOO A; 1OTW A; 1VGI A; 1ULX A; 4NY7 A; 1RCW A; 1P3U A; 1OYK A; 1TO9 B; 1TWR A; 2ZVU A; 3I8R A; 4G7P A; 1OZR A; 2GM8 A; 1IX4 A; 1WOW A; 3I9T A; 3HML A; 1IW0 A; 2A2M A; 1RTW A; 1OTV A; 3OQL A; 1OZE A; 1WWM A; 1WZF A; 4GPH A; 2GM7 A; 4G98 A; 1WNX A; 2RGZ A; 4GPC A; 4GPF A; 4G99 A; 3B5P A; 1XK2 A; 1YAF A; 3TGM A; 1J77 A; 4WX0 A; 3B5O A; 1DVG A; 1XJZ A; 3HNH A; 3CZY A; 4RAJ A; 1YAK A; 3IBX A; 1NI6 A; 3RM5 A; 3K4F A; 4G8U A; 3I9U A; 3MVU A; 4G8P A; 4G7T A; 2A6B A; 2E7E A; 3BJD A; 1WZG A; 1TO9 A; 4G7U A; 1OZL A; 1N3U A; 3HLX A; 1TWN A; 4LQX A; 4WWJ A; 1IRM A; 1Z72 A; 4WD4 A; 4WWZ A; 2Z68 A; 2QPP A; 2DY5 A; 1WNV A; 1IX3 A; 4G7L A; 1P3V A; 1V8X A; 1WOV A; 1WNW A; 1IVJ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...