The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
180
|
structure length |
180
|
Chain Sequence |
EVPGLLEEIKALPLRLDEERFRFWLQQDYPFVEALYRYQVGLLLEAPQAHRAPLVQALMATVEELDWLLLQGASPSAPVHPVRAGYIALLEEMGRLPYAYRVVFFYFLNGLFLEAWAHHVPEEGPWAELSQHWFAPEFQAVLYDLEVLARGLWEDLDPEVVRTYLRRILEAEKATWSLLL
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Crystal Structure of TT2028 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8
rcsb |
molecule tags |
Transcription
|
source organism |
Thermus thermophilus
|
molecule keywords |
hypothetical protein TT2028
|
total genus |
63
|
structure length |
180
|
sequence length |
180
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2005-01-07 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Up-down Bundle | Heme Oxygenase; Chain A | Heme oxygenase-like |
#chains in the Genus database with same CATH superfamily 2E7E A; 1OZL A; 1VGI A; 1P3T A; 4G7L A; 3CZY A; 3MOO A; 2RD3 A; 4G8W A; 1WZD A; 4WX0 A; 1T5P A; 4GPH A; 1WE1 A; 2F2G A; 1OZR A; 1TO9 B; 2GM7 A; 4G8U A; 4WD4 A; 3TGM A; 5BTQ A; 1WNX A; 1IW1 A; 1IVJ A; 2RGZ A; 4MEC A; 4FN6 A; 1WOX A; 1ULX A; 3IBX A; 1N3U A; 1J77 A; 3MVU A; 1YAK A; 2DY5 A; 3I8R A; 1TWR A; 1XJZ A; 4GOH A; 1P3V A; 3HLX A; 1WNW A; 1J2C A; 3B5P A; 3NO6 A; 1RCW A; 1IX3 A; 1OZE A; 4G7T A; 1OTW A; 1WWM A; 2ZVU A; 2QCX A; 1RTW A; 2Q4X A; 1XK0 A; 3K4F A; 1DVE A; 3HML A; 4G99 A; 1IX4 A; 1UDD A; 1TYH A; 3OQL A; 1Z72 A; 4LQX A; 1WZG A; 1N45 A; 1SK7 A; 1V8X A; 3I9T A; 1S13 A; 2Q32 A; 2A2O A; 4RAJ A; 1WZF A; 2QZC A; 4G7U A; 1TO9 A; 4GPF A; 1XK3 A; 3HNH A; 2QPP A; 1UBB A; 4G7P A; 2A2M A; 1S8C A; 2GM8 A; 3BJD A; 1OYL A; 4WMH A; 1YAF A; 4GPC A; 1DVG A; 1XK1 A; 3DDE A; 3HOK A; 4G98 A; 1WOW A; 1IW0 A; 1WOV A; 1J02 A; 1OZW A; 1WNV A; 1P3U A; 1IRM A; 3B5O A; 1TWN A; 4G8P A; 4WWZ A; 3I9U A; 1OTV A; 2A6B A; 3RM5 A; 4NY7 A; 1OYK A; 4WWJ A; 2Z68 A; 1NI6 A; 1XK2 A; #chains in the Genus database with same CATH topology 2E7E A; 1OZL A; 1VGI A; 1P3T A; 4G7L A; 3CZY A; 3MOO A; 2RD3 A; 4G8W A; 1WZD A; 4WX0 A; 1T5P A; 4GPH A; 1WE1 A; 2F2G A; 1OZR A; 1TO9 B; 2GM7 A; 4G8U A; 4WD4 A; 3TGM A; 5BTQ A; 1WNX A; 1IW1 A; 1IVJ A; 2RGZ A; 4MEC A; 4FN6 A; 1WOX A; 1ULX A; 3IBX A; 1N3U A; 1J77 A; 3MVU A; 1YAK A; 2DY5 A; 3I8R A; 1TWR A; 1XJZ A; 4GOH A; 1P3V A; 3HLX A; 1WNW A; 1J2C A; 3B5P A; 3NO6 A; 1RCW A; 1IX3 A; 1OZE A; 4G7T A; 1OTW A; 1WWM A; 2ZVU A; 2QCX A; 1RTW A; 2Q4X A; 1XK0 A; 3K4F A; 1DVE A; 3HML A; 4G99 A; 1IX4 A; 1UDD A; 1TYH A; 3OQL A; 1Z72 A; 4LQX A; 1WZG A; 1N45 A; 1SK7 A; 1V8X A; 3I9T A; 1S13 A; 2Q32 A; 2A2O A; 4RAJ A; 1WZF A; 2QZC A; 4G7U A; 1TO9 A; 2LCU A; 4GPF A; 1XK3 A; 3HNH A; 2QPP A; 1UBB A; 4G7P A; 2A2M A; 1S8C A; 2GM8 A; 3BJD A; 1OYL A; 4WMH A; 1YAF A; 4GPC A; 1DVG A; 1XK1 A; 3DDE A; 3HOK A; 4G98 A; 1WOW A; 1IW0 A; 1WOV A; 1J02 A; 1OZW A; 1WNV A; 1P3U A; 1IRM A; 3B5O A; 1TWN A; 4G8P A; 4WWZ A; 3I9U A; 1OTV A; 2A6B A; 3RM5 A; 4NY7 A; 1OYK A; 4WWJ A; 2Z68 A; 1NI6 A; 1XK2 A; #chains in the Genus database with same CATH homology 2E7E A; 1OZL A; 1VGI A; 1P3T A; 4G7L A; 3CZY A; 3MOO A; 2RD3 A; 4G8W A; 1WZD A; 4WX0 A; 1T5P A; 4GPH A; 1WE1 A; 2F2G A; 1OZR A; 1TO9 B; 2GM7 A; 4G8U A; 4WD4 A; 3TGM A; 5BTQ A; 1WNX A; 1IW1 A; 1IVJ A; 2RGZ A; 4MEC A; 4FN6 A; 1WOX A; 1ULX A; 3IBX A; 1N3U A; 1J77 A; 3MVU A; 1YAK A; 2DY5 A; 3I8R A; 1TWR A; 1XJZ A; 4GOH A; 1P3V A; 3HLX A; 1WNW A; 1J2C A; 3B5P A; 3NO6 A; 1RCW A; 1IX3 A; 1OZE A; 4G7T A; 1OTW A; 1WWM A; 2ZVU A; 2QCX A; 1RTW A; 2Q4X A; 1XK0 A; 3K4F A; 1DVE A; 3HML A; 4G99 A; 1IX4 A; 1UDD A; 1TYH A; 3OQL A; 1Z72 A; 4LQX A; 1WZG A; 1N45 A; 1SK7 A; 1V8X A; 3I9T A; 1S13 A; 2Q32 A; 2A2O A; 4RAJ A; 1WZF A; 2QZC A; 4G7U A; 1TO9 A; 4GPF A; 1XK3 A; 3HNH A; 2QPP A; 1UBB A; 4G7P A; 2A2M A; 1S8C A; 2GM8 A; 3BJD A; 1OYL A; 4WMH A; 1YAF A; 4GPC A; 1DVG A; 1XK1 A; 3DDE A; 3HOK A; 4G98 A; 1WOW A; 1IW0 A; 1WOV A; 1J02 A; 1OZW A; 1WNV A; 1P3U A; 1IRM A; 3B5O A; 1TWN A; 4G8P A; 4WWZ A; 3I9U A; 1OTV A; 2A6B A; 3RM5 A; 4NY7 A; 1OYK A; 4WWJ A; 2Z68 A; 1NI6 A; 1XK2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...