The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
151
|
structure length |
151
|
Chain Sequence |
MKDRIPIFSVAKNRVEMVERIELSDDEWREILDPEAFRVARKAGTEPPFTGKYHDLHDDGIYRCICCGTDLFDSETKFDSGTGWPSFYDVVSEHNIKLREDRSLGMVRCEVLCARCDAHLGHVFDDGPRPTGKRYCMNSAALKFIPRDQIG
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structure-function relationship in an archaebacterial methionine sulphoxide reductase B.
pubmed doi rcsb |
| molecule tags |
Oxidoreductase
|
| source organism |
Methanothermobacter thermautotrophicus
|
| molecule keywords |
Peptide methionine sulfoxide reductase msrB
|
| total genus |
33
|
| structure length |
151
|
| sequence length |
151
|
| ec nomenclature |
ec
1.8.4.12: Peptide-methionine (R)-S-oxide reductase. |
| pdb deposition date | 2008-09-05 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01641 | SelR | SelR domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Peptide methionine sulfoxide reductase. |
#chains in the Genus database with same CATH superfamily 4V2Y A; 3CEZ A; 3HCH A; 3HCJ A; 4CI3 B; 4V30 A; 4V2Z A; 4CI1 B; 1L1D A; 4CI2 B; 2KZN A; 3E0M A; 4TZ4 C; 2KV1 A; 3E0O A; 5AMH A; 3WX1 A; 4TZC A; 2K8D A; 3WX2 A; 3MAO A; 4TZU A; 3HCG A; 4V31 A; 3HCI A; 3CXK A; #chains in the Genus database with same CATH topology 3LRR A; 2RQA A; 4V2Y A; 2RMJ A; 3NCU A; 2LVL A; 3CEZ A; 3DJM A; 3HCH A; 3HCJ A; 4CI3 B; 2FU5 A; 4V30 A; 4V2Z A; 4BPB A; 4CI1 B; 5F9H A; 2LOY A; 1L1D A; 1FWQ A; 4CI2 B; 1TXJ A; 3EQT A; 2KZN A; 3LRN A; 3E0M A; 2QFB A; 1H6Q A; 2KV1 A; 4TZ4 C; 2W4R A; 3E0O A; 2RQB A; 3FAC A; 3P3K A; 5F98 A; 5AMH A; 3ZD6 A; 3WX1 A; 1H7Y A; 4TZC A; 2K8D A; 4A2X A; 2HR9 A; 3WX2 A; 3MAO A; 5E3H A; 1YZ1 A; 3EBM A; 4AY2 A; 2KWB A; 4TZU A; 3ZD7 A; 3HCG A; 4A2V A; 2YKG A; 5F9F A; 2QFD A; 4V31 A; 3HCI A; 3GA3 A; 1HXR A; 3CXK A; 3OG8 A; #chains in the Genus database with same CATH homology 4V2Y A; 3CEZ A; 3HCH A; 3HCJ A; 4CI3 B; 4V30 A; 4V2Z A; 4CI1 B; 1L1D A; 4CI2 B; 2KZN A; 3E0M A; 4TZ4 C; 2KV1 A; 3E0O A; 5AMH A; 3WX1 A; 4TZC A; 2K8D A; 3WX2 A; 3MAO A; 4TZU A; 3HCG A; 4V31 A; 3HCI A; 3CXK A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
