The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
10
|
sequence length |
124
|
structure length |
124
|
Chain Sequence |
MSFCSFFGGEVFQNHFEPGVYVCAKCSYELFSSHSKYAHSSPWPAFTETIHPDSVTKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRFCIFSSSLKFVPKGKEAAASQGHLEHHHHHH
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Insights into function, catalytic mechanism, and fold evolution of selenoprotein methionine sulfoxide reductase B1 through structural analysis
pubmed doi rcsb |
| molecule keywords |
Methionine-R-sulfoxide reductase B1
|
| molecule tags |
Oxidoreductase
|
| source organism |
Mus musculus
|
| total genus |
10
|
| structure length |
124
|
| sequence length |
124
|
| ec nomenclature |
ec
1.8.4.12: Peptide-methionine (R)-S-oxide reductase. |
| pdb deposition date | 2010-03-04 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01641 | SelR | SelR domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Peptide methionine sulfoxide reductase. |
#chains in the Genus database with same CATH superfamily 5AMH A; 3MAO A; 3E0M A; 3WX1 A; 3HCG A; 4V2Z A; 2KV1 A; 2KZN A; 4CI1 B; 4TZC A; 3HCJ A; 4TZU A; 3HCH A; 4V2Y A; 4V31 A; 3HCI A; 4CI3 B; 4TZ4 C; 1L1D A; 4CI2 B; 3WX2 A; 4V30 A; 3CXK A; 3E0O A; 2K8D A; 3CEZ A; #chains in the Genus database with same CATH topology 3LRR A; 2QFB A; 3DJM A; 4AY2 A; 3ZD6 A; 5AMH A; 3MAO A; 5F9H A; 3E0M A; 3WX1 A; 2YKG A; 5F9F A; 2HR9 A; 3GA3 A; 4A2V A; 3HCG A; 4V2Z A; 3NCU A; 2KV1 A; 4A2X A; 2KZN A; 4CI1 B; 4TZC A; 1HXR A; 1FWQ A; 2LOY A; 1H6Q A; 3HCJ A; 1H7Y A; 4TZU A; 3OG8 A; 3HCH A; 2QFD A; 3EBM A; 2LVL A; 3LRN A; 4V2Y A; 4V31 A; 3FAC A; 3HCI A; 4TZ4 C; 1L1D A; 4CI3 B; 2W4R A; 2RMJ A; 4CI2 B; 3EQT A; 2FU5 A; 3P3K A; 2KWB A; 4BPB A; 3WX2 A; 5F98 A; 5E3H A; 3ZD7 A; 4V30 A; 2RQB A; 1TXJ A; 3CXK A; 3E0O A; 2K8D A; 3CEZ A; 2RQA A; 1YZ1 A; #chains in the Genus database with same CATH homology 5AMH A; 3MAO A; 3E0M A; 3WX1 A; 3HCG A; 4V2Z A; 2KV1 A; 2KZN A; 4CI1 B; 4TZC A; 3HCJ A; 4TZU A; 3HCH A; 4V2Y A; 4V31 A; 3HCI A; 4CI3 B; 4TZ4 C; 1L1D A; 4CI2 B; 3WX2 A; 4V30 A; 3CXK A; 3E0O A; 2K8D A; 3CEZ A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...