The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
47
|
sequence length |
183
|
structure length |
183
|
Chain Sequence |
MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKCLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Minimal Constraint Solution NMR Structure of Translationally-controlled tumor protein (TCTP) from C.elegans, Northeast Structural Genomics Consortium Target WR73
rcsb |
| molecule keywords |
Translationally-controlled tumor protein homolog
|
| molecule tags |
Metal binding protein
|
| source organism |
Caenorhabditis elegans
|
| total genus |
47
|
| structure length |
183
|
| sequence length |
183
|
| ec nomenclature | |
| pdb deposition date | 2010-04-02 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00838 | TCTP | Translationally controlled tumour protein |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 2HR9 A; 1TXJ A; 3EBM A; 2FU5 A; 1FWQ A; 1YZ1 A; 1HXR A; 2KWB A; 3P3K A; 2LOY A; 1H7Y A; 1H6Q A; #chains in the Genus database with same CATH topology 4V30 A; 3CXK A; 5E3H A; 2FU5 A; 2KV1 A; 2QFD A; 3WX1 A; 2RQA A; 2LOY A; 4TZC A; 5F9H A; 4V2Y A; 3DJM A; 4A2X A; 1TXJ A; 5F98 A; 2RMJ A; 3HCH A; 3EBM A; 3HCJ A; 3MAO A; 3LRN A; 3GA3 A; 4BPB A; 1YZ1 A; 3E0O A; 1HXR A; 3P3K A; 4V2Z A; 4TZ4 C; 4A2V A; 5F9F A; 2KZN A; 1H6Q A; 4CI1 B; 3CEZ A; 2YKG A; 2LVL A; 3HCI A; 2HR9 A; 4CI3 B; 5AMH A; 3NCU A; 2W4R A; 4V31 A; 3LRR A; 1FWQ A; 2KWB A; 3E0M A; 3FAC A; 2RQB A; 3ZD7 A; 4AY2 A; 1H7Y A; 2QFB A; 3EQT A; 4CI2 B; 3HCG A; 4TZU A; 3ZD6 A; 3WX2 A; 3OG8 A; 2K8D A; 1L1D A; #chains in the Genus database with same CATH homology 5E3H A; 2FU5 A; 2QFD A; 2RQA A; 2LOY A; 5F9H A; 3DJM A; 4A2X A; 1TXJ A; 5F98 A; 2RMJ A; 3LRN A; 3EBM A; 3GA3 A; 4BPB A; 1YZ1 A; 3P3K A; 1HXR A; 5F9F A; 4A2V A; 1H6Q A; 2YKG A; 2LVL A; 2HR9 A; 3NCU A; 2W4R A; 3LRR A; 1FWQ A; 2KWB A; 3FAC A; 3ZD7 A; 2RQB A; 4AY2 A; 1H7Y A; 2QFB A; 3EQT A; 3ZD6 A; 3OG8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
