The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
40
|
sequence length |
183
|
structure length |
183
|
Chain Sequence |
MLIYKDIFTDDELSSDSFPMKLVDDLVYEFKGKHVVRKEGEIVLAGSNPSAEEGAEDDGSDEHVERGIDIVLNHKLVEMNCYEDASMFKAYIKKFMKNVIDHMEKNNRDKADVDAFKKKIQGWVVSLLAKDRFKNLAFFIGERAAEGAENGQVAIIEYRDVDGTEVPTLMLVKEAIIEEKCLE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Metal binding protein
|
source organism |
Caenorhabditis elegans
|
publication title |
Determination of solution structures of proteins up to 40 kDa using CS-Rosetta with sparse NMR data from deuterated samples.
pubmed doi rcsb |
molecule keywords |
Translationally-controlled tumor protein homolog
|
total genus |
40
|
structure length |
183
|
sequence length |
183
|
ec nomenclature | |
pdb deposition date | 2012-01-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF00838 | TCTP | Translationally controlled tumour protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 1TXJ A; 1H6Q A; 2FU5 A; 3P3K A; 2HR9 A; 1FWQ A; 1YZ1 A; 2LOY A; 1H7Y A; 2KWB A; 3EBM A; 1HXR A; #chains in the Genus database with same CATH topology 3LRN A; 2K8D A; 4CI1 B; 4BPB A; 3GA3 A; 3CEZ A; 3MAO A; 3LRR A; 3HCG A; 4A2V A; 3ZD7 A; 1H7Y A; 4V31 A; 1HXR A; 1L1D A; 2W4R A; 4TZ4 C; 5E3H A; 3P3K A; 3HCI A; 2HR9 A; 3WX1 A; 4TZC A; 4AY2 A; 2LOY A; 2YKG A; 2QFB A; 4TZU A; 3CXK A; 5F9H A; 4V2Y A; 2QFD A; 3HCH A; 4CI2 B; 2RMJ A; 2LVL A; 3EBM A; 4V30 A; 2RQA A; 2RQB A; 1TXJ A; 1H6Q A; 3DJM A; 3NCU A; 1FWQ A; 3EQT A; 5AMH A; 3OG8 A; 4A2X A; 3E0M A; 2FU5 A; 2KZN A; 3WX2 A; 3ZD6 A; 3HCJ A; 5F98 A; 3FAC A; 1YZ1 A; 4V2Z A; 2KV1 A; 4CI3 B; 3E0O A; 5F9F A; 2KWB A; #chains in the Genus database with same CATH homology 3LRN A; 4BPB A; 3GA3 A; 3LRR A; 4A2V A; 3ZD7 A; 1H7Y A; 2W4R A; 1HXR A; 5E3H A; 4AY2 A; 3P3K A; 2HR9 A; 2LOY A; 2YKG A; 2QFB A; 5F9H A; 2QFD A; 2RMJ A; 2LVL A; 3EBM A; 2RQA A; 2RQB A; 1TXJ A; 1H6Q A; 3DJM A; 3NCU A; 1FWQ A; 3EQT A; 3OG8 A; 4A2X A; 2FU5 A; 3ZD6 A; 5F98 A; 3FAC A; 1YZ1 A; 5F9F A; 2KWB A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...