The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
16
|
sequence length |
128
|
structure length |
128
|
Chain Sequence |
GSTMHFTDDNENDTSETMESLIDKGKLDQVVYDDQLYHLKEKVDEDKKGKVIGAIGQTFFVDGDGKRWSEEELKEPYISNNPDEIREKKPLRYGKVYSTNEDSDAKDEIIVEFNREYYRAVLIKNEKE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The First Structure of a Lantibiotic Immunity Protein, SpaI from Bacillus subtilis, Reveals a Novel Fold.
pubmed doi rcsb |
| molecule tags |
Lantibiotic-binding-protein
|
| source organism |
Bacillus subtilis
|
| molecule keywords |
SpaI
|
| total genus |
16
|
| structure length |
128
|
| sequence length |
128
|
| ec nomenclature | |
| pdb deposition date | 2012-07-06 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF18218 | Spa1_C | Lantibiotic immunity protein Spa1 C-terminal domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 2LVL A; #chains in the Genus database with same CATH topology 4V2Z A; 4V30 A; 4TZ4 C; 3GA3 A; 2KZN A; 4BPB A; 5F9F A; 2LVL A; 2KV1 A; 2RMJ A; 3ZD7 A; 3CEZ A; 4V31 A; 2W4R A; 4CI1 B; 5F98 A; 1FWQ A; 3CXK A; 1H6Q A; 3E0M A; 4A2X A; 1HXR A; 3WX1 A; 4CI2 B; 3NCU A; 3HCG A; 2QFD A; 4CI3 B; 2YKG A; 1YZ1 A; 3ZD6 A; 3HCI A; 3HCJ A; 2FU5 A; 4TZU A; 2RQB A; 3E0O A; 2QFB A; 3EBM A; 3HCH A; 3MAO A; 4V2Y A; 4TZC A; 3FAC A; 4A2V A; 2LOY A; 2K8D A; 1L1D A; 1TXJ A; 5E3H A; 3LRN A; 5F9H A; 2RQA A; 4AY2 A; 1H7Y A; 3LRR A; 2KWB A; 3P3K A; 3DJM A; 3WX2 A; 5AMH A; 3EQT A; 2HR9 A; 3OG8 A; #chains in the Genus database with same CATH homology 3GA3 A; 4BPB A; 5F9F A; 2LVL A; 2RMJ A; 3ZD7 A; 5F98 A; 2W4R A; 1FWQ A; 1H6Q A; 4A2X A; 1HXR A; 3NCU A; 2QFD A; 2YKG A; 1YZ1 A; 3ZD6 A; 2FU5 A; 2RQB A; 2QFB A; 3EBM A; 3FAC A; 4A2V A; 2LOY A; 1TXJ A; 5F9H A; 5E3H A; 3LRN A; 4AY2 A; 2RQA A; 1H7Y A; 3LRR A; 2KWB A; 3P3K A; 3DJM A; 3EQT A; 2HR9 A; 3OG8 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
