The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
121
|
structure length |
121
|
Chain Sequence |
KENKKLLCRKCKALACYTADVRVIEECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIHVKYKTFEIPVIKIESFVVEDIATGVQTLYSKWKDFHFEKIPFDPAEM
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
The C-Terminal Regulatory Domain Is the RNA 5'-Triphosphate Sensor of RIG-I.
pubmed doi rcsb |
| molecule keywords |
Probable ATP-dependent RNA helicase DDX58
|
| molecule tags |
Hydrolase
|
| source organism |
Homo sapiens
|
| total genus |
23
|
| structure length |
121
|
| sequence length |
121
|
| chains with identical sequence |
B, C, D, E, F, G, H, I, J
|
| ec nomenclature |
ec
3.6.4.13: RNA helicase. |
| pdb deposition date | 2007-06-27 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF11648 | RIG-I_C-RD | C-terminal domain of RIG-I |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 3ZD7 A; 5E3H A; 4A2V A; 2RQA A; 2QFD A; 4BPB A; 3OG8 A; 3EQT A; 4A2X A; 3LRN A; 3LRR A; 2RMJ A; 3NCU A; 4AY2 A; 2W4R A; 2RQB A; 5F9F A; 5F9H A; 2YKG A; 3GA3 A; 2QFB A; 3ZD6 A; 5F98 A; #chains in the Genus database with same CATH topology 1HXR A; 2HR9 A; 2KZN A; 3CXK A; 5E3H A; 3ZD7 A; 1TXJ A; 2K8D A; 4A2V A; 1H7Y A; 2RQA A; 3E0M A; 1H6Q A; 2QFD A; 3EBM A; 2KWB A; 4BPB A; 3FAC A; 3OG8 A; 3WX1 A; 3HCH A; 3E0O A; 1FWQ A; 3WX2 A; 3MAO A; 3EQT A; 4A2X A; 3ZD6 A; 3DJM A; 4TZ4 C; 1L1D A; 3LRN A; 3LRR A; 2RMJ A; 3NCU A; 3P3K A; 4TZC A; 4CI1 B; 4AY2 A; 2W4R A; 4V30 A; 4CI3 B; 4V31 A; 3CEZ A; 3HCJ A; 4TZU A; 2RQB A; 4V2Z A; 5F9H A; 2LOY A; 2LVL A; 3HCG A; 5AMH A; 2YKG A; 5F9F A; 3GA3 A; 2QFB A; 2FU5 A; 2KV1 A; 3HCI A; 4V2Y A; 1YZ1 A; 5F98 A; 4CI2 B; #chains in the Genus database with same CATH homology 1HXR A; 2HR9 A; 3ZD7 A; 5E3H A; 1TXJ A; 4A2V A; 1H7Y A; 2RQA A; 1H6Q A; 3EBM A; 2QFD A; 2KWB A; 4BPB A; 3FAC A; 3OG8 A; 1FWQ A; 3EQT A; 4A2X A; 3DJM A; 3LRN A; 3LRR A; 2RMJ A; 3NCU A; 3P3K A; 4AY2 A; 2W4R A; 2RQB A; 5F9F A; 5F9H A; 2LOY A; 2LVL A; 2YKG A; 3GA3 A; 2QFB A; 2FU5 A; 3ZD6 A; 1YZ1 A; 5F98 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...