The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
14
|
sequence length |
137
|
structure length |
137
|
Chain Sequence |
GPHMQFPVEHVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKVFKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAKKWSRVPFSVPDFDFLQHCAENLSDLSLD
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Solution Structures of Cytosolic RNA Sensor MDA5 and LGP2 C-terminal Domains: IDENTIFICATION OF THE RNA RECOGNITION LOOP IN RIG-I-LIKE RECEPTORS
pubmed doi rcsb |
molecule tags |
Hydrolase
|
source organism |
Homo sapiens
|
molecule keywords |
ATP-dependent RNA helicase DHX58
|
total genus |
14
|
structure length |
137
|
sequence length |
137
|
ec nomenclature |
ec
3.6.4.13: RNA helicase. |
pdb deposition date | 2009-03-17 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF11648 | RIG-I_C-RD | C-terminal domain of RIG-I |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 2RMJ A; 5E3H A; 5F9H A; 3NCU A; 2W4R A; 4BPB A; 3LRN A; 3OG8 A; 2RQB A; 4AY2 A; 4A2X A; 3ZD6 A; 3GA3 A; 3LRR A; 2QFB A; 3EQT A; 5F9F A; 2YKG A; 2QFD A; 3ZD7 A; 4A2V A; 2RQA A; 5F98 A; #chains in the Genus database with same CATH topology 3P3K A; 1H7Y A; 2RMJ A; 2KV1 A; 1TXJ A; 5E3H A; 3WX1 A; 5F9H A; 3HCI A; 3WX2 A; 3NCU A; 4TZC A; 2KZN A; 3HCJ A; 4TZ4 C; 2W4R A; 3HCH A; 4BPB A; 1YZ1 A; 3LRN A; 1FWQ A; 1HXR A; 2K8D A; 4V2Y A; 3OG8 A; 2RQB A; 4AY2 A; 3FAC A; 4A2X A; 3ZD6 A; 4V30 A; 4CI3 B; 2HR9 A; 3GA3 A; 2LVL A; 3HCG A; 4CI1 B; 3E0O A; 3CEZ A; 3EBM A; 3LRR A; 2QFB A; 4V31 A; 3EQT A; 5F9F A; 2KWB A; 4TZU A; 4V2Z A; 5AMH A; 2LOY A; 2QFD A; 4CI2 B; 2YKG A; 3E0M A; 3DJM A; 1L1D A; 3ZD7 A; 1H6Q A; 3CXK A; 4A2V A; 2RQA A; 2FU5 A; 5F98 A; 3MAO A; #chains in the Genus database with same CATH homology 3P3K A; 1H7Y A; 2RMJ A; 5E3H A; 1TXJ A; 5F9H A; 3NCU A; 2W4R A; 4BPB A; 1YZ1 A; 3LRN A; 1FWQ A; 1HXR A; 3OG8 A; 2RQB A; 4AY2 A; 3FAC A; 4A2X A; 3ZD6 A; 2HR9 A; 3GA3 A; 2LVL A; 3EBM A; 3LRR A; 2QFB A; 3EQT A; 5F9F A; 2KWB A; 2YKG A; 2LOY A; 2QFD A; 3ZD7 A; 3DJM A; 1H6Q A; 4A2V A; 2RQA A; 2FU5 A; 5F98 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...