2YYBA

Crystal structure of ttha1606 from thermus thermophilus hb8
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
242
structure length
242
Chain Sequence
MDRDELVRYLDAYLRIQDFPQDPSLNGLQVEGKRTVRKVGAAVDAGEAIFRKALEEEVDFLIVHHGLFWGKPFPIVGHHKRRLETLFQGGINLYAAHLPLDAHEEVGNNFVLARELGLVDLTPWDVGVKGRFPQPTPLLQVADRLGQLTGMQPLVHQGGLDHVETVILVSGSGTGLLPKVDADLFVTGEPKHSVFHETFERGLNVIYAGHYDTETFGVKALAAHLEARFGLPWVFLDHPTGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein TTHA1606
publication title Crystal structure of the conserved hypothetical protein TTHA1606 from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Structural genomics, unknown function
total genus 71
structure length 242
sequence length 242
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 2yybA02
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 2yybA01
3WSIA 3WSGA 3WSFA 3WSEA 3WSHA 4IWGA 3WSDA 1NMPA 4IWMA 2FYWA 2YYBA 1NMOA
chains in the Genus database with same CATH superfamily
1KNXA 3WSFA 4IHHA 4CVLA 4QDIA 4CVMA 2IOJA 4E79A 3EEQA 3EH0A 4QF5A 4C13A 2WTZA 4C12A 3WSHA 2IUAA 3ZM6A 2FYWA 2XJAA 3PMOA 3ZM5A 1NMOA 1KO7A 1GG4A 2AM1A 3WSIA 3WSGA 2IU9A 4IHGA 3L31A 1NMPA 4IWMA 3ZL8A 2IU8A 1E8CA 4E75A 3L2BA 4BUBA 2AM2A 3WSEA 4IWGA 4ZIYA 4CVKA 4IHFA 3WSDA 2YYBA
chains in the Genus database with same CATH topology
3WSIA 3WSGA 3WSFA 3WSEA 3WSHA 4IWGA 3WSDA 1NMPA 4IWMA 2FYWA 2YYBA 1NMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WSI A;  3WSG A;  3WSF A;  3WSE A;  3WSH A;  4IWG A;  3WSD A;  1NMP A;  4IWM A;  2FYW A;  2YYB A;  1NMO A; 
#chains in the Genus database with same CATH topology
 1KNX A;  3WSF A;  4IHH A;  4CVL A;  4QDI A;  4CVM A;  2IOJ A;  4E79 A;  3EEQ A;  3EH0 A;  4QF5 A;  4C13 A;  2WTZ A;  4C12 A;  3WSH A;  2IUA A;  3ZM6 A;  2FYW A;  2XJA A;  3PMO A;  3ZM5 A;  1NMO A;  1KO7 A;  1GG4 A;  2AM1 A;  3WSI A;  3WSG A;  2IU9 A;  4IHG A;  3L31 A;  1NMP A;  4IWM A;  3ZL8 A;  2IU8 A;  1E8C A;  4E75 A;  3L2B A;  4BUB A;  2AM2 A;  3WSE A;  4IWG A;  4ZIY A;  4CVK A;  4IHF A;  3WSD A;  2YYB A; 
#chains in the Genus database with same CATH homology
 3WSI A;  3WSG A;  3WSF A;  3WSE A;  3WSH A;  4IWG A;  3WSD A;  1NMP A;  4IWM A;  2FYW A;  2YYB A;  1NMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...