2IU8A

Chlamydia trachomatis lpxd with 25mm udpglcnac (complex i)
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
346
structure length
346
Chain Sequence
MSQSTYSLEQLADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE
publication title Structure and Reactivity of Lpxd, the N-Acyltransferase of Lipid a Biosynthesis
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transferase
total genus 115
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2iu8A02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 2iu8A01
1YP4A 2WLGA 3IXCA 3MQHA 3FWWA 4HCQA 2AM2A 3OW5A 1YP3A 3C8VA 4N27A 2QIAA 2OI5A 3FSCA 5DG3A 2Q4JA 1KGTA 3HJJA 1KRUA 1Z90A 4C12A 3EH0A 3CJ8A 3KWCA 3BFPA 1YP2A 4ISXA 4J09A 3JQYA 2WLDA 4IHFA 3BSYA 1TDTA 1MR9A 4QDIA 4AC3A 1E8CA 2GGOA 3KWEA 5AFUU 4KQLA 1FXJA 4K6RA 3D8VA 4M2AA 4C13A 4CVKA 4G3PA 3I3XA 3TDTA 3R0SA 3R5AA 3DK5A 3T57A 3DJ4A 3OTMA 3ZM6A 1J2ZA 3R5BA 4G87A 3PMOA 3VBMA 1MRLA 3BSSA 4HUSA 1KHRA 1KRVA 3IGJA 4EA7A 1G95A 3VNPA 2WLCA 1HV9A 3DHOA 3VBPA 3R5DA 4HZCA 1MR7A 1GG4A 4E75A 1KQAA 1KK4A 3R5CA 3OTZA 3SPTA 1QRFA 1SSMA 4R7PA 4CVMA 4AA7A 4E1KA 2JF2A 1S80A 4HURA 2TDTA 3VBLA 4N6BA 3R1WA 3V4EA 2V0HA 3FSYA 3P1BA 2RIJA 4M28A 1QQ0A 2ICXA 2VHEA 5E3RA 2GGQA 4EA8A 3FSXA 3R2WA 2ICYA 2JF3A 1XATA 2OI6A 3R3RA 5F42A 4E6UA 1QREA 2WLEA 2WLFA 4M99A 4FCEA 3GOSA 2V0IA 1OCXA 4R37A 3VBIA 4BUBA 2V0KA 2IC7A 2QIVX 2IU9A 3ECTA 3GUEA 3FSBA 3HSQA 4M9CA 4EGGA 1QRLA 3FOQA 1HM0A 1HM9A 2W0WA 3TK8A 5ADXV 2OI7A 3EEVA 1HM8A 4IHGA 1FWYA 4J18A 1QRMA 3TISA 4DCLA 3OU9A 4KPZA 3FS8A 3ZL8A 2IUAA 5DEPA 4ZIYA 3KWDA 4KPXA 3D98A 3ZM5A 3Q1XA 4MYOA 3MC4A 4MFGA 2P2OA 4E6TA 2W0VA 5L6VA 3P47A 3VBJA 2AQ9A 4EA9A 4QF5A 4KNXA 2OEGA 2XJAA 1KK5A 2V0JA 2FKOA 4EABA 1V3WA 4N6AA 3FTTA 3I3AA 3BRKX 1THJA 4M2BA 1KK6A 3TV0A 2VD4A 5ADXU 4HZDA 2AM1A 2WTZA 4G3SA 4R36A 2I5KA 4KNRA 4AAWA 2QKXA 1G97A 1V67A 1SSQA 5E3PA 3NZ2A 1T3DA 2NPOA 3BXYA 4IHHA 3TWDA 1QRGA 1SSTA 1XHDA 2V0LA 3TIOA 2OEFA 3BSWA 4G3QA 3SRTA 2IU8A 3VBNA 3EG4A 2XATA 4EQYA 4CVLA 3OUPA 3R3IA 1KRRA 1LXAA 3VBKA 4E79A 3GVDA 1KGQA 3ST8A 5U2KA 4N69A 5AFUV 4EAAA 5E3QA 4M98A 3F1XA 3R8YA 5L6SA 3MQGA 4MZUA 4H7OA 5DEMA
chains in the Genus database with same CATH superfamily
4IWGA 1YP4A 2WLGA 3IXCA 3MQHA 3FWWA 4HCQA 3EEQA 2AM2A 3OW5A 1YP3A 3C8VA 4N27A 2QIAA 2OI5A 3FSCA 5DG3A 2Q4JA 1KGTA 3HJJA 1KRUA 1Z90A 4C12A 3EH0A 1N4IA 1NMPA 3CJ8A 3KWCA 3BFPA 1YP2A 4ISXA 4J09A 3JQYA 2WLDA 4IHFA 3BSYA 1TDTA 1MR9A 4QDIA 4AC3A 1E8CA 2GGOA 3KWEA 5AFUU 4KQLA 1FXJA 4K6RA 3D8VA 4M2AA 4C13A 4CVKA 1M8NA 3L2BA 4G3PA 3I3XA 3TDTA 3R0SA 3R5AA 3DK5A 3T57A 3DJ4A 3OTMA 3ZM6A 1J2ZA 3R5BA 4G87A 3PMOA 3VBMA 1MRLA 3BSSA 4HUSA 3WSFA 1KHRA 1KRVA 3IGJA 4EA7A 3WSGA 1G95A 3OH4A 3VNPA 2WLCA 1HV9A 3DHOA 3VBPA 3WSDA 3R5DA 4HZCA 1MR7A 1GG4A 4E75A 1KQAA 1KK4A 4IWMA 3R5CA 3OTZA 3SPTA 3OH1A 1QRFA 1SSMA 4R7PA 4CVMA 4AA7A 4E1KA 2JF2A 1S80A 4HURA 2TDTA 3VBLA 4N6BA 3R1WA 3V4EA 3GQ7A 2V0HA 3FSYA 3P1BA 2RIJA 4M28A 1QQ0A 2ICXA 2VHEA 5E3RA 2GGQA 4EA8A 3FSXA 3OGZA 3R2WA 2ICYA 2JF3A 1XATA 2OI6A 3R3RA 3SUCA 5F42A 4E6UA 1QREA 2WLEA 2WLFA 4M99A 4FCEA 3GOSA 2V0IA 1OCXA 4R37A 3VBIA 4BUBA 2V0KA 2IC7A 2QIVX 2IU9A 3ECTA 3GUEA 3FSBA 3HSQA 4M9CA 4EGGA 1QRLA 3FOQA 1HM0A 1HM9A 2W0WA 3OH3A 3TK8A 5ADXV 2OI7A 1EWWA 3EEVA 1HM8A 3WSIA 4IHGA 1FWYA 4J18A 1QRMA 3TISA 4DCLA 3OU9A 4KPZA 3FS8A 3ZL8A 2IUAA 1KNXA 5DEPA 2YYBA 1L0SA 3KWDA 4KPXA 3D98A 4ZIYA 3Q1XA 3ZM5A 2FYWA 4MYOA 3MC4A 4MFGA 2P2OA 4E6TA 2W0VA 5L6VA 3P47A 3VBJA 2AQ9A 4EA9A 4QF5A 4KNXA 1Z2FA 2OEGA 2XJAA 1KK5A 2V0JA 2FKOA 4EABA 1V3WA 4N6AA 3FTTA 3I3AA 3BRKX 1THJA 3OH0A 4M2BA 1KK6A 3TV0A 2VD4A 5ADXU 4HZDA 2AM1A 2WTZA 4G3SA 4R36A 2I5KA 4KNRA 4AAWA 2QKXA 1G97A 1V67A 1NMOA 3WSEA 1SSQA 5E3PA 3NZ2A 3L31A 1T3DA 2NPOA 3BXYA 4IHHA 3TWDA 1QRGA 1SSTA 2IOJA 1XHDA 2V0LA 3GQ8A 3GQAA 1KO7A 3TIOA 2OEFA 3BSWA 4G3QA 3SRTA 2IU8A 3VBNA 3EG4A 2XATA 4EQYA 4CVLA 3OUPA 3R3IA 1KRRA 1LXAA 3OH2A 3VBKA 4E79A 3GVDA 1KGQA 3ST8A 5U2KA 4N69A 5AFUV 4EAAA 5E3QA 3GQ9A 4M98A 3F1XA 3WSHA 3R8YA 5L6SA 3MQGA 4MZUA 4H7OA 5DEMA
chains in the Genus database with same CATH topology
1YP4A 2WLGA 3IXCA 3MQHA 3FWWA 4HCQA 2AM2A 3OW5A 1YP3A 3C8VA 4N27A 2QIAA 2OI5A 3FSCA 5DG3A 2Q4JA 1KGTA 3HJJA 1KRUA 1Z90A 4C12A 3EH0A 3CJ8A 3KWCA 3BFPA 1YP2A 4ISXA 4J09A 3JQYA 2WLDA 4IHFA 3BSYA 1TDTA 1MR9A 4QDIA 4AC3A 1E8CA 2GGOA 3KWEA 5AFUU 4KQLA 1FXJA 4K6RA 3D8VA 4M2AA 4C13A 4CVKA 4G3PA 3I3XA 3TDTA 3R0SA 3R5AA 3DK5A 3T57A 3DJ4A 3OTMA 3ZM6A 1J2ZA 3R5BA 4G87A 3PMOA 3VBMA 1MRLA 3BSSA 4HUSA 1KHRA 1KRVA 3IGJA 4EA7A 1G95A 3VNPA 2WLCA 1HV9A 3DHOA 3VBPA 3R5DA 4HZCA 1MR7A 1GG4A 4E75A 1KQAA 1KK4A 3R5CA 3OTZA 3SPTA 1QRFA 1SSMA 4R7PA 4CVMA 4AA7A 4E1KA 2JF2A 1S80A 4HURA 2TDTA 3VBLA 4N6BA 3R1WA 3V4EA 2V0HA 3FSYA 3P1BA 2RIJA 4M28A 1QQ0A 2ICXA 2VHEA 5E3RA 2GGQA 4EA8A 3FSXA 3R2WA 2ICYA 2JF3A 1XATA 2OI6A 3R3RA 5F42A 4E6UA 1QREA 2WLEA 2WLFA 4M99A 4FCEA 3GOSA 2V0IA 1OCXA 4R37A 3VBIA 4BUBA 2V0KA 2IC7A 2QIVX 2IU9A 3ECTA 3GUEA 3FSBA 3HSQA 4M9CA 4EGGA 1QRLA 3FOQA 1HM0A 1HM9A 2W0WA 3TK8A 5ADXV 2OI7A 3EEVA 1HM8A 4IHGA 1FWYA 4J18A 1QRMA 3TISA 4DCLA 3OU9A 4KPZA 3FS8A 3ZL8A 2IUAA 5DEPA 4ZIYA 3KWDA 4KPXA 3D98A 3ZM5A 3Q1XA 4MYOA 3MC4A 4MFGA 2P2OA 4E6TA 2W0VA 5L6VA 3P47A 3VBJA 2AQ9A 4EA9A 4QF5A 4KNXA 2OEGA 2XJAA 1KK5A 2V0JA 2FKOA 4EABA 1V3WA 4N6AA 3FTTA 3I3AA 3BRKX 1THJA 4M2BA 1KK6A 3TV0A 2VD4A 5ADXU 4HZDA 2AM1A 2WTZA 4G3SA 4R36A 2I5KA 4KNRA 4AAWA 2QKXA 1G97A 1V67A 1SSQA 5E3PA 3NZ2A 1T3DA 2NPOA 3BXYA 4IHHA 3TWDA 1QRGA 1SSTA 1XHDA 2V0LA 3TIOA 2OEFA 3BSWA 4G3QA 3SRTA 2IU8A 3VBNA 3EG4A 2XATA 4EQYA 4CVLA 3OUPA 3R3IA 1KRRA 1LXAA 3VBKA 4E79A 3GVDA 1KGQA 3ST8A 5U2KA 4N69A 5AFUV 4EAAA 5E3QA 4M98A 3F1XA 3R8YA 5L6SA 3MQGA 4MZUA 4H7OA 5DEMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YP4 A;  2WLG A;  3IXC A;  3MQH A;  3FWW A;  4HCQ A;  2AM2 A;  3OW5 A;  1YP3 A;  3C8V A;  4N27 A;  2QIA A;  2OI5 A;  3FSC A;  5DG3 A;  2Q4J A;  1KGT A;  3HJJ A;  1KRU A;  1Z90 A;  4C12 A;  3EH0 A;  3CJ8 A;  3KWC A;  3BFP A;  1YP2 A;  4ISX A;  4J09 A;  3JQY A;  2WLD A;  4IHF A;  3BSY A;  1TDT A;  1MR9 A;  4QDI A;  4AC3 A;  1E8C A;  2GGO A;  3KWE A;  5AFU U;  4KQL A;  1FXJ A;  4K6R A;  3D8V A;  4M2A A;  4C13 A;  4CVK A;  4G3P A;  3I3X A;  3TDT A;  3R0S A;  3R5A A;  3DK5 A;  3T57 A;  3DJ4 A;  3OTM A;  3ZM6 A;  1J2Z A;  3R5B A;  4G87 A;  3PMO A;  3VBM A;  1MRL A;  3BSS A;  4HUS A;  1KHR A;  1KRV A;  3IGJ A;  4EA7 A;  1G95 A;  3VNP A;  2WLC A;  1HV9 A;  3DHO A;  3VBP A;  3R5D A;  4HZC A;  1MR7 A;  1GG4 A;  4E75 A;  1KQA A;  1KK4 A;  3R5C A;  3OTZ A;  3SPT A;  1QRF A;  1SSM A;  4R7P A;  4CVM A;  4AA7 A;  4E1K A;  2JF2 A;  1S80 A;  4HUR A;  2TDT A;  3VBL A;  4N6B A;  3R1W A;  3V4E A;  2V0H A;  3FSY A;  3P1B A;  2RIJ A;  4M28 A;  1QQ0 A;  2ICX A;  2VHE A;  5E3R A;  2GGQ A;  4EA8 A;  3FSX A;  3R2W A;  2ICY A;  2JF3 A;  1XAT A;  2OI6 A;  3R3R A;  5F42 A;  4E6U A;  1QRE A;  2WLE A;  2WLF A;  4M99 A;  4FCE A;  3GOS A;  2V0I A;  1OCX A;  4R37 A;  3VBI A;  4BUB A;  2V0K A;  2IC7 A;  2QIV X;  2IU9 A;  3ECT A;  3GUE A;  3FSB A;  3HSQ A;  4M9C A;  4EGG A;  1QRL A;  3FOQ A;  1HM0 A;  1HM9 A;  2W0W A;  3TK8 A;  5ADX V;  2OI7 A;  3EEV A;  1HM8 A;  4IHG A;  1FWY A;  4J18 A;  1QRM A;  3TIS A;  4DCL A;  3OU9 A;  4KPZ A;  3FS8 A;  3ZL8 A;  2IUA A;  5DEP A;  4ZIY A;  3KWD A;  4KPX A;  3D98 A;  3ZM5 A;  3Q1X A;  4MYO A;  3MC4 A;  4MFG A;  2P2O A;  4E6T A;  2W0V A;  5L6V A;  3P47 A;  3VBJ A;  2AQ9 A;  4EA9 A;  4QF5 A;  4KNX A;  2OEG A;  2XJA A;  1KK5 A;  2V0J A;  2FKO A;  4EAB A;  1V3W A;  4N6A A;  3FTT A;  3I3A A;  3BRK X;  1THJ A;  4M2B A;  1KK6 A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  2AM1 A;  2WTZ A;  4G3S A;  4R36 A;  2I5K A;  4KNR A;  4AAW A;  2QKX A;  1G97 A;  1V67 A;  1SSQ A;  5E3P A;  3NZ2 A;  1T3D A;  2NPO A;  3BXY A;  4IHH A;  3TWD A;  1QRG A;  1SST A;  1XHD A;  2V0L A;  3TIO A;  2OEF A;  3BSW A;  4G3Q A;  3SRT A;  2IU8 A;  3VBN A;  3EG4 A;  2XAT A;  4EQY A;  4CVL A;  3OUP A;  3R3I A;  1KRR A;  1LXA A;  3VBK A;  4E79 A;  3GVD A;  1KGQ A;  3ST8 A;  5U2K A;  4N69 A;  5AFU V;  4EAA A;  5E3Q A;  4M98 A;  3F1X A;  3R8Y A;  5L6S A;  3MQG A;  4MZU A;  4H7O A;  5DEM A; 
#chains in the Genus database with same CATH topology
 4IWG A;  1YP4 A;  2WLG A;  3IXC A;  3MQH A;  3FWW A;  4HCQ A;  3EEQ A;  2AM2 A;  3OW5 A;  1YP3 A;  3C8V A;  4N27 A;  2QIA A;  2OI5 A;  3FSC A;  5DG3 A;  2Q4J A;  1KGT A;  3HJJ A;  1KRU A;  1Z90 A;  4C12 A;  3EH0 A;  1N4I A;  1NMP A;  3CJ8 A;  3KWC A;  3BFP A;  1YP2 A;  4ISX A;  4J09 A;  3JQY A;  2WLD A;  4IHF A;  3BSY A;  1TDT A;  1MR9 A;  4QDI A;  4AC3 A;  1E8C A;  2GGO A;  3KWE A;  5AFU U;  4KQL A;  1FXJ A;  4K6R A;  3D8V A;  4M2A A;  4C13 A;  4CVK A;  1M8N A;  3L2B A;  4G3P A;  3I3X A;  3TDT A;  3R0S A;  3R5A A;  3DK5 A;  3T57 A;  3DJ4 A;  3OTM A;  3ZM6 A;  1J2Z A;  3R5B A;  4G87 A;  3PMO A;  3VBM A;  1MRL A;  3BSS A;  4HUS A;  3WSF A;  1KHR A;  1KRV A;  3IGJ A;  4EA7 A;  3WSG A;  1G95 A;  3OH4 A;  3VNP A;  2WLC A;  1HV9 A;  3DHO A;  3VBP A;  3WSD A;  3R5D A;  4HZC A;  1MR7 A;  1GG4 A;  4E75 A;  1KQA A;  1KK4 A;  4IWM A;  3R5C A;  3OTZ A;  3SPT A;  3OH1 A;  1QRF A;  1SSM A;  4R7P A;  4CVM A;  4AA7 A;  4E1K A;  2JF2 A;  1S80 A;  4HUR A;  2TDT A;  3VBL A;  4N6B A;  3R1W A;  3V4E A;  3GQ7 A;  2V0H A;  3FSY A;  3P1B A;  2RIJ A;  4M28 A;  1QQ0 A;  2ICX A;  2VHE A;  5E3R A;  2GGQ A;  4EA8 A;  3FSX A;  3OGZ A;  3R2W A;  2ICY A;  2JF3 A;  1XAT A;  2OI6 A;  3R3R A;  3SUC A;  5F42 A;  4E6U A;  1QRE A;  2WLE A;  2WLF A;  4M99 A;  4FCE A;  3GOS A;  2V0I A;  1OCX A;  4R37 A;  3VBI A;  4BUB A;  2V0K A;  2IC7 A;  2QIV X;  2IU9 A;  3ECT A;  3GUE A;  3FSB A;  3HSQ A;  4M9C A;  4EGG A;  1QRL A;  3FOQ A;  1HM0 A;  1HM9 A;  2W0W A;  3OH3 A;  3TK8 A;  5ADX V;  2OI7 A;  1EWW A;  3EEV A;  1HM8 A;  3WSI A;  4IHG A;  1FWY A;  4J18 A;  1QRM A;  3TIS A;  4DCL A;  3OU9 A;  4KPZ A;  3FS8 A;  3ZL8 A;  2IUA A;  1KNX A;  5DEP A;  2YYB A;  1L0S A;  3KWD A;  4KPX A;  3D98 A;  4ZIY A;  3Q1X A;  3ZM5 A;  2FYW A;  4MYO A;  3MC4 A;  4MFG A;  2P2O A;  4E6T A;  2W0V A;  5L6V A;  3P47 A;  3VBJ A;  2AQ9 A;  4EA9 A;  4QF5 A;  4KNX A;  1Z2F A;  2OEG A;  2XJA A;  1KK5 A;  2V0J A;  2FKO A;  4EAB A;  1V3W A;  4N6A A;  3FTT A;  3I3A A;  3BRK X;  1THJ A;  3OH0 A;  4M2B A;  1KK6 A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  2AM1 A;  2WTZ A;  4G3S A;  4R36 A;  2I5K A;  4KNR A;  4AAW A;  2QKX A;  1G97 A;  1V67 A;  1NMO A;  3WSE A;  1SSQ A;  5E3P A;  3NZ2 A;  3L31 A;  1T3D A;  2NPO A;  3BXY A;  4IHH A;  3TWD A;  1QRG A;  1SST A;  2IOJ A;  1XHD A;  2V0L A;  3GQ8 A;  3GQA A;  1KO7 A;  3TIO A;  2OEF A;  3BSW A;  4G3Q A;  3SRT A;  2IU8 A;  3VBN A;  3EG4 A;  2XAT A;  4EQY A;  4CVL A;  3OUP A;  3R3I A;  1KRR A;  1LXA A;  3OH2 A;  3VBK A;  4E79 A;  3GVD A;  1KGQ A;  3ST8 A;  5U2K A;  4N69 A;  5AFU V;  4EAA A;  5E3Q A;  3GQ9 A;  4M98 A;  3F1X A;  3WSH A;  3R8Y A;  5L6S A;  3MQG A;  4MZU A;  4H7O A;  5DEM A; 
#chains in the Genus database with same CATH homology
 1YP4 A;  2WLG A;  3IXC A;  3MQH A;  3FWW A;  4HCQ A;  2AM2 A;  3OW5 A;  1YP3 A;  3C8V A;  4N27 A;  2QIA A;  2OI5 A;  3FSC A;  5DG3 A;  2Q4J A;  1KGT A;  3HJJ A;  1KRU A;  1Z90 A;  4C12 A;  3EH0 A;  3CJ8 A;  3KWC A;  3BFP A;  1YP2 A;  4ISX A;  4J09 A;  3JQY A;  2WLD A;  4IHF A;  3BSY A;  1TDT A;  1MR9 A;  4QDI A;  4AC3 A;  1E8C A;  2GGO A;  3KWE A;  5AFU U;  4KQL A;  1FXJ A;  4K6R A;  3D8V A;  4M2A A;  4C13 A;  4CVK A;  4G3P A;  3I3X A;  3TDT A;  3R0S A;  3R5A A;  3DK5 A;  3T57 A;  3DJ4 A;  3OTM A;  3ZM6 A;  1J2Z A;  3R5B A;  4G87 A;  3PMO A;  3VBM A;  1MRL A;  3BSS A;  4HUS A;  1KHR A;  1KRV A;  3IGJ A;  4EA7 A;  1G95 A;  3VNP A;  2WLC A;  1HV9 A;  3DHO A;  3VBP A;  3R5D A;  4HZC A;  1MR7 A;  1GG4 A;  4E75 A;  1KQA A;  1KK4 A;  3R5C A;  3OTZ A;  3SPT A;  1QRF A;  1SSM A;  4R7P A;  4CVM A;  4AA7 A;  4E1K A;  2JF2 A;  1S80 A;  4HUR A;  2TDT A;  3VBL A;  4N6B A;  3R1W A;  3V4E A;  2V0H A;  3FSY A;  3P1B A;  2RIJ A;  4M28 A;  1QQ0 A;  2ICX A;  2VHE A;  5E3R A;  2GGQ A;  4EA8 A;  3FSX A;  3R2W A;  2ICY A;  2JF3 A;  1XAT A;  2OI6 A;  3R3R A;  5F42 A;  4E6U A;  1QRE A;  2WLE A;  2WLF A;  4M99 A;  4FCE A;  3GOS A;  2V0I A;  1OCX A;  4R37 A;  3VBI A;  4BUB A;  2V0K A;  2IC7 A;  2QIV X;  2IU9 A;  3ECT A;  3GUE A;  3FSB A;  3HSQ A;  4M9C A;  4EGG A;  1QRL A;  3FOQ A;  1HM0 A;  1HM9 A;  2W0W A;  3TK8 A;  5ADX V;  2OI7 A;  3EEV A;  1HM8 A;  4IHG A;  1FWY A;  4J18 A;  1QRM A;  3TIS A;  4DCL A;  3OU9 A;  4KPZ A;  3FS8 A;  3ZL8 A;  2IUA A;  5DEP A;  4ZIY A;  3KWD A;  4KPX A;  3D98 A;  3ZM5 A;  3Q1X A;  4MYO A;  3MC4 A;  4MFG A;  2P2O A;  4E6T A;  2W0V A;  5L6V A;  3P47 A;  3VBJ A;  2AQ9 A;  4EA9 A;  4QF5 A;  4KNX A;  2OEG A;  2XJA A;  1KK5 A;  2V0J A;  2FKO A;  4EAB A;  1V3W A;  4N6A A;  3FTT A;  3I3A A;  3BRK X;  1THJ A;  4M2B A;  1KK6 A;  3TV0 A;  2VD4 A;  5ADX U;  4HZD A;  2AM1 A;  2WTZ A;  4G3S A;  4R36 A;  2I5K A;  4KNR A;  4AAW A;  2QKX A;  1G97 A;  1V67 A;  1SSQ A;  5E3P A;  3NZ2 A;  1T3D A;  2NPO A;  3BXY A;  4IHH A;  3TWD A;  1QRG A;  1SST A;  1XHD A;  2V0L A;  3TIO A;  2OEF A;  3BSW A;  4G3Q A;  3SRT A;  2IU8 A;  3VBN A;  3EG4 A;  2XAT A;  4EQY A;  4CVL A;  3OUP A;  3R3I A;  1KRR A;  1LXA A;  3VBK A;  4E79 A;  3GVD A;  1KGQ A;  3ST8 A;  5U2K A;  4N69 A;  5AFU V;  4EAA A;  5E3Q A;  4M98 A;  3F1X A;  3R8Y A;  5L6S A;  3MQG A;  4MZU A;  4H7O A;  5DEM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...