3EH0A

Crystal structure of lpxd from escherichia coli
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
341
structure length
341
Chain Sequence
b'MASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
publication title Crystal structure and acyl chain selectivity of Escherichia coli LpxD, the N-acyltransferase of lipid A biosynthesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 104
structure length 341
sequence length 341
chains with identical sequence B, C
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eh0A02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 3eh0A01
2V0KA 4MZUA 2OI6A 3R8YA 4J18A 2JF3A 1G97A 2OI5A 3FSXA 4CVLA 3ST8A 3VNPA 3BRKX 5L6VA 4EQYA 2QIVX 4R36A 4E79A 4N6BA 4H7OA 4EA7A 3Q1XA 3DHOA 4QDIA 1YP3A 3R1WA 1J2ZA 3MC4A 3R5CA 3R5BA 1LXAA 2OEGA 1HV9A 5AFUV 3GUEA 4C12A 1TDTA 1HM8A 1SSTA 1KHRA 3EG4A 5L6SA 4HZDA 3VBPA 4R37A 1V67A 4M2BA 2ICXA 5AFUU 3F1XA 1KGQA 3IGJA 4J09A 2QKXA 3OUPA 4M2AA 3VBLA 2V0IA 3BSSA 3FS8A 4FCEA 2IU8A 1G95A 3BXYA 5E3PA 1HM0A 1KQAA 2OI7A 3TWDA 3V4EA 2V0LA 3P47A 4G3SA 4E1KA 4QF5A 4E75A 4G3QA 3I3XA 1KK5A 2GGOA 4AA7A 2VHEA 4MYOA 3BSWA 3R5AA 3DK5A 2XATA 3TV0A 3OTZA 2WLFA 3OTMA 1E8CA 5F42A 4M98A 4KPZA 3MQGA 1SSMA 3D8VA 1QRMA 1QRLA 3VBJA 4EGGA 2W0WA 3HSQA 4M9CA 4HCQA 4N27A 2V0HA 3VBNA 4CVMA 3TDTA 3IXCA 3OW5A 4M28A 4KPXA 2WLDA 2Q4JA 1S80A 1THJA 2P2OA 1KRRA 3R0SA 4M99A 4G87A 4AAWA 2WLCA 4C13A 3HJJA 3KWCA 1KRUA 3ZL8A 1MR7A 1MR9A 2JF2A 3BFPA 3GVDA 2I5KA 4ZIYA 2IUAA 4E6UA 2WLEA 1FWYA 5E3QA 1QRGA 2V0JA 5DEMA 2RIJA 3D98A 3GOSA 4IHHA 2TDTA 1MRLA 3R2WA 3EH0A 1QQ0A 1KK4A 1YP2A 1XATA 4G3PA 4IHGA 2WTZA 4KNRA 3VBIA 2NPOA 3FWWA 4MFGA 5DG3A 5ADXV 2WLGA 3VBMA 4HZCA 3SRTA 1QRFA 3FOQA 2AQ9A 4EABA 1GG4A 2GGQA 4CVKA 3KWDA 2W0VA 3SPTA 1V3WA 3TK8A 3P1BA 3TIOA 3FTTA 2FKOA 4KQLA 4AC3A 4DCLA 5ADXU 3BSYA 3R5DA 1QREA 2IU9A 1KRVA 3NZ2A 5E3RA 4EA9A 2VD4A 1T3DA 3MQHA 3JQYA 3TISA 3R3IA 2ICYA 3ZM6A 3KWEA 3OU9A 1Z90A 3ECTA 4KNXA 3I3AA 3R3RA 4N6AA 3EEVA 3C8VA 3VBKA 1KGTA 3DJ4A 1FXJA 2AM1A 2OEFA 4BUBA 4K6RA 3FSCA 1OCXA 1KK6A 1HM9A 1SSQA 4HUSA 5DEPA 2XJAA 3FSBA 4HURA 3T57A 3ZM5A 3PMOA 1XHDA 4N69A 4EA8A 5U2KA 4EAAA 2IC7A 4IHFA 4E6TA 1YP4A 2AM2A 4ISXA 2QIAA 3FSYA 3CJ8A 4R7PA
chains in the Genus database with same CATH superfamily
1M8NA 2V0KA 4MZUA 2OI6A 3R8YA 4J18A 2JF3A 1G97A 2OI5A 3FSXA 4CVLA 3ST8A 3VNPA 3BRKX 5L6VA 4EQYA 2QIVX 4R36A 3OH1A 4E79A 4N6BA 4H7OA 4EA7A 3Q1XA 3DHOA 4QDIA 1YP3A 3R1WA 1J2ZA 3MC4A 3R5CA 3R5BA 1LXAA 2OEGA 1HV9A 5AFUV 3GUEA 4C12A 1TDTA 1HM8A 1SSTA 1KHRA 3EG4A 3L31A 4IWMA 5L6SA 4HZDA 3VBPA 4R37A 1V67A 4M2BA 2ICXA 5AFUU 3F1XA 1KGQA 3IGJA 4J09A 2QKXA 3OUPA 4M2AA 3VBLA 1KO7A 2V0IA 3BSSA 3FS8A 4FCEA 2IU8A 1G95A 3BXYA 5E3PA 1HM0A 1KQAA 2OI7A 3OH4A 3TWDA 2V0LA 3P47A 4G3SA 3V4EA 4E1KA 4E75A 3GQ8A 3I3XA 4G3QA 1KK5A 2GGOA 4AA7A 2VHEA 4MYOA 3BSWA 3R5AA 3DK5A 3OH0A 2XATA 2FYWA 3TV0A 3OTZA 3OH2A 3L2BA 2WLFA 3GQ9A 3OTMA 1E8CA 5F42A 3EEQA 4M98A 4KPZA 3MQGA 1SSMA 3D8VA 1QRMA 3WSEA 1QRLA 3VBJA 4EGGA 2W0WA 3HSQA 4M9CA 4HCQA 4N27A 2V0HA 3VBNA 4CVMA 3TDTA 3IXCA 3OW5A 4M28A 4IWGA 4KPXA 1NMPA 2WLDA 2Q4JA 1S80A 1THJA 2P2OA 3WSDA 1L0SA 1KRRA 3R0SA 4M99A 4G87A 4AAWA 3WSHA 2WLCA 4C13A 3HJJA 3KWCA 1KRUA 3ZL8A 1MR7A 1MR9A 2JF2A 3BFPA 3GVDA 1EWWA 2I5KA 4ZIYA 2IUAA 3GQAA 2WLEA 4E6UA 1FWYA 5E3QA 1QRGA 2V0JA 5DEMA 2RIJA 3D98A 3GOSA 4IHHA 2TDTA 1MRLA 2YYBA 3R2WA 3EH0A 1QQ0A 1KK4A 1YP2A 1XATA 4G3PA 4IHGA 2WTZA 4KNRA 3VBIA 3WSIA 2NPOA 3FWWA 4MFGA 5DG3A 5ADXV 2WLGA 3VBMA 4HZCA 3OH3A 3SRTA 1QRFA 3FOQA 2AQ9A 4EABA 1GG4A 2GGQA 4CVKA 3KWDA 2W0VA 3SPTA 1V3WA 3TK8A 3P1BA 3TIOA 3FTTA 2FKOA 4KQLA 4AC3A 4DCLA 5ADXU 3BSYA 3R5DA 1QREA 2IU9A 1KRVA 3NZ2A 5E3RA 4EA9A 4ISXA 2VD4A 3WSGA 1T3DA 3MQHA 3JQYA 3TISA 4QF5A 3R3IA 2ICYA 3OGZA 3ZM6A 3KWEA 3OU9A 1Z90A 3ECTA 4KNXA 3I3AA 3R3RA 4N6AA 3EEVA 3C8VA 3VBKA 1KGTA 3DJ4A 1FXJA 2AM1A 2OEFA 4BUBA 4K6RA 3FSCA 1OCXA 1KK6A 1HM9A 1SSQA 4HUSA 5DEPA 2IOJA 3FSBA 2XJAA 4HURA 1N4IA 3SUCA 3T57A 3WSFA 3PMOA 3ZM5A 1XHDA 4N69A 4EA8A 5U2KA 4EAAA 2IC7A 3GQ7A 4IHFA 1YP4A 4E6TA 1Z2FA 2QIAA 1KNXA 2AM2A 3FSYA 1NMOA 3CJ8A 4R7PA
chains in the Genus database with same CATH topology
2V0KA 4MZUA 2OI6A 3R8YA 4J18A 2JF3A 1G97A 2OI5A 3FSXA 4CVLA 3ST8A 3VNPA 3BRKX 5L6VA 4EQYA 2QIVX 4R36A 4E79A 4N6BA 4H7OA 4EA7A 3Q1XA 3DHOA 4QDIA 1YP3A 3R1WA 1J2ZA 3MC4A 3R5CA 3R5BA 1LXAA 2OEGA 1HV9A 5AFUV 3GUEA 4C12A 1TDTA 1HM8A 1SSTA 1KHRA 3EG4A 5L6SA 4HZDA 3VBPA 4R37A 1V67A 4M2BA 2ICXA 5AFUU 3F1XA 1KGQA 3IGJA 4J09A 2QKXA 3OUPA 4M2AA 3VBLA 2V0IA 3BSSA 3FS8A 4FCEA 2IU8A 1G95A 3BXYA 5E3PA 1HM0A 1KQAA 2OI7A 3TWDA 3V4EA 2V0LA 3P47A 4G3SA 4E1KA 4QF5A 4E75A 4G3QA 3I3XA 1KK5A 2GGOA 4AA7A 2VHEA 4MYOA 3BSWA 3R5AA 3DK5A 2XATA 3TV0A 3OTZA 2WLFA 3OTMA 1E8CA 5F42A 4M98A 4KPZA 3MQGA 1SSMA 3D8VA 1QRMA 1QRLA 3VBJA 4EGGA 2W0WA 3HSQA 4M9CA 4HCQA 4N27A 2V0HA 3VBNA 4CVMA 3TDTA 3IXCA 3OW5A 4M28A 4KPXA 2WLDA 2Q4JA 1S80A 1THJA 2P2OA 1KRRA 3R0SA 4M99A 4G87A 4AAWA 2WLCA 4C13A 3HJJA 3KWCA 1KRUA 3ZL8A 1MR7A 1MR9A 2JF2A 3BFPA 3GVDA 2I5KA 4ZIYA 2IUAA 4E6UA 2WLEA 1FWYA 5E3QA 1QRGA 2V0JA 5DEMA 2RIJA 3D98A 3GOSA 4IHHA 2TDTA 1MRLA 3R2WA 3EH0A 1QQ0A 1KK4A 1YP2A 1XATA 4G3PA 4IHGA 2WTZA 4KNRA 3VBIA 2NPOA 3FWWA 4MFGA 5DG3A 5ADXV 2WLGA 3VBMA 4HZCA 3SRTA 1QRFA 3FOQA 2AQ9A 4EABA 1GG4A 2GGQA 4CVKA 3KWDA 2W0VA 3SPTA 1V3WA 3TK8A 3P1BA 3TIOA 3FTTA 2FKOA 4KQLA 4AC3A 4DCLA 5ADXU 3BSYA 3R5DA 1QREA 2IU9A 1KRVA 3NZ2A 5E3RA 4EA9A 2VD4A 1T3DA 3MQHA 3JQYA 3TISA 3R3IA 2ICYA 3ZM6A 3KWEA 3OU9A 1Z90A 3ECTA 4KNXA 3I3AA 3R3RA 4N6AA 3EEVA 3C8VA 3VBKA 1KGTA 3DJ4A 1FXJA 2AM1A 2OEFA 4BUBA 4K6RA 3FSCA 1OCXA 1KK6A 1HM9A 1SSQA 4HUSA 5DEPA 2XJAA 3FSBA 4HURA 3T57A 3ZM5A 3PMOA 1XHDA 4N69A 4EA8A 5U2KA 4EAAA 2IC7A 4IHFA 4E6TA 1YP4A 2AM2A 4ISXA 2QIAA 3FSYA 3CJ8A 4R7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V0K A;  4MZU A;  2OI6 A;  3R8Y A;  4J18 A;  2JF3 A;  1G97 A;  2OI5 A;  3FSX A;  4CVL A;  3ST8 A;  3VNP A;  3BRK X;  5L6V A;  4EQY A;  2QIV X;  4R36 A;  4E79 A;  4N6B A;  4H7O A;  4EA7 A;  3Q1X A;  3DHO A;  4QDI A;  1YP3 A;  3R1W A;  1J2Z A;  3MC4 A;  3R5C A;  3R5B A;  1LXA A;  2OEG A;  1HV9 A;  5AFU V;  3GUE A;  4C12 A;  1TDT A;  1HM8 A;  1SST A;  1KHR A;  3EG4 A;  5L6S A;  4HZD A;  3VBP A;  4R37 A;  1V67 A;  4M2B A;  2ICX A;  5AFU U;  3F1X A;  1KGQ A;  3IGJ A;  4J09 A;  2QKX A;  3OUP A;  4M2A A;  3VBL A;  2V0I A;  3BSS A;  3FS8 A;  4FCE A;  2IU8 A;  1G95 A;  3BXY A;  5E3P A;  1HM0 A;  1KQA A;  2OI7 A;  3TWD A;  3V4E A;  2V0L A;  3P47 A;  4G3S A;  4E1K A;  4QF5 A;  4E75 A;  4G3Q A;  3I3X A;  1KK5 A;  2GGO A;  4AA7 A;  2VHE A;  4MYO A;  3BSW A;  3R5A A;  3DK5 A;  2XAT A;  3TV0 A;  3OTZ A;  2WLF A;  3OTM A;  1E8C A;  5F42 A;  4M98 A;  4KPZ A;  3MQG A;  1SSM A;  3D8V A;  1QRM A;  1QRL A;  3VBJ A;  4EGG A;  2W0W A;  3HSQ A;  4M9C A;  4HCQ A;  4N27 A;  2V0H A;  3VBN A;  4CVM A;  3TDT A;  3IXC A;  3OW5 A;  4M28 A;  4KPX A;  2WLD A;  2Q4J A;  1S80 A;  1THJ A;  2P2O A;  1KRR A;  3R0S A;  4M99 A;  4G87 A;  4AAW A;  2WLC A;  4C13 A;  3HJJ A;  3KWC A;  1KRU A;  3ZL8 A;  1MR7 A;  1MR9 A;  2JF2 A;  3BFP A;  3GVD A;  2I5K A;  4ZIY A;  2IUA A;  4E6U A;  2WLE A;  1FWY A;  5E3Q A;  1QRG A;  2V0J A;  5DEM A;  2RIJ A;  3D98 A;  3GOS A;  4IHH A;  2TDT A;  1MRL A;  3R2W A;  3EH0 A;  1QQ0 A;  1KK4 A;  1YP2 A;  1XAT A;  4G3P A;  4IHG A;  2WTZ A;  4KNR A;  3VBI A;  2NPO A;  3FWW A;  4MFG A;  5DG3 A;  5ADX V;  2WLG A;  3VBM A;  4HZC A;  3SRT A;  1QRF A;  3FOQ A;  2AQ9 A;  4EAB A;  1GG4 A;  2GGQ A;  4CVK A;  3KWD A;  2W0V A;  3SPT A;  1V3W A;  3TK8 A;  3P1B A;  3TIO A;  3FTT A;  2FKO A;  4KQL A;  4AC3 A;  4DCL A;  5ADX U;  3BSY A;  3R5D A;  1QRE A;  2IU9 A;  1KRV A;  3NZ2 A;  5E3R A;  4EA9 A;  2VD4 A;  1T3D A;  3MQH A;  3JQY A;  3TIS A;  3R3I A;  2ICY A;  3ZM6 A;  3KWE A;  3OU9 A;  1Z90 A;  3ECT A;  4KNX A;  3I3A A;  3R3R A;  4N6A A;  3EEV A;  3C8V A;  3VBK A;  1KGT A;  3DJ4 A;  1FXJ A;  2AM1 A;  2OEF A;  4BUB A;  4K6R A;  3FSC A;  1OCX A;  1KK6 A;  1HM9 A;  1SSQ A;  4HUS A;  5DEP A;  2XJA A;  3FSB A;  4HUR A;  3T57 A;  3ZM5 A;  3PMO A;  1XHD A;  4N69 A;  4EA8 A;  5U2K A;  4EAA A;  2IC7 A;  4IHF A;  4E6T A;  1YP4 A;  2AM2 A;  4ISX A;  2QIA A;  3FSY A;  3CJ8 A;  4R7P A; 
#chains in the Genus database with same CATH topology
 1M8N A;  2V0K A;  4MZU A;  2OI6 A;  3R8Y A;  4J18 A;  2JF3 A;  1G97 A;  2OI5 A;  3FSX A;  4CVL A;  3ST8 A;  3VNP A;  3BRK X;  5L6V A;  4EQY A;  2QIV X;  4R36 A;  3OH1 A;  4E79 A;  4N6B A;  4H7O A;  4EA7 A;  3Q1X A;  3DHO A;  4QDI A;  1YP3 A;  3R1W A;  1J2Z A;  3MC4 A;  3R5C A;  3R5B A;  1LXA A;  2OEG A;  1HV9 A;  5AFU V;  3GUE A;  4C12 A;  1TDT A;  1HM8 A;  1SST A;  1KHR A;  3EG4 A;  3L31 A;  4IWM A;  5L6S A;  4HZD A;  3VBP A;  4R37 A;  1V67 A;  4M2B A;  2ICX A;  5AFU U;  3F1X A;  1KGQ A;  3IGJ A;  4J09 A;  2QKX A;  3OUP A;  4M2A A;  3VBL A;  1KO7 A;  2V0I A;  3BSS A;  3FS8 A;  4FCE A;  2IU8 A;  1G95 A;  3BXY A;  5E3P A;  1HM0 A;  1KQA A;  2OI7 A;  3OH4 A;  3TWD A;  2V0L A;  3P47 A;  4G3S A;  3V4E A;  4E1K A;  4E75 A;  3GQ8 A;  3I3X A;  4G3Q A;  1KK5 A;  2GGO A;  4AA7 A;  2VHE A;  4MYO A;  3BSW A;  3R5A A;  3DK5 A;  3OH0 A;  2XAT A;  2FYW A;  3TV0 A;  3OTZ A;  3OH2 A;  3L2B A;  2WLF A;  3GQ9 A;  3OTM A;  1E8C A;  5F42 A;  3EEQ A;  4M98 A;  4KPZ A;  3MQG A;  1SSM A;  3D8V A;  1QRM A;  3WSE A;  1QRL A;  3VBJ A;  4EGG A;  2W0W A;  3HSQ A;  4M9C A;  4HCQ A;  4N27 A;  2V0H A;  3VBN A;  4CVM A;  3TDT A;  3IXC A;  3OW5 A;  4M28 A;  4IWG A;  4KPX A;  1NMP A;  2WLD A;  2Q4J A;  1S80 A;  1THJ A;  2P2O A;  3WSD A;  1L0S A;  1KRR A;  3R0S A;  4M99 A;  4G87 A;  4AAW A;  3WSH A;  2WLC A;  4C13 A;  3HJJ A;  3KWC A;  1KRU A;  3ZL8 A;  1MR7 A;  1MR9 A;  2JF2 A;  3BFP A;  3GVD A;  1EWW A;  2I5K A;  4ZIY A;  2IUA A;  3GQA A;  2WLE A;  4E6U A;  1FWY A;  5E3Q A;  1QRG A;  2V0J A;  5DEM A;  2RIJ A;  3D98 A;  3GOS A;  4IHH A;  2TDT A;  1MRL A;  2YYB A;  3R2W A;  3EH0 A;  1QQ0 A;  1KK4 A;  1YP2 A;  1XAT A;  4G3P A;  4IHG A;  2WTZ A;  4KNR A;  3VBI A;  3WSI A;  2NPO A;  3FWW A;  4MFG A;  5DG3 A;  5ADX V;  2WLG A;  3VBM A;  4HZC A;  3OH3 A;  3SRT A;  1QRF A;  3FOQ A;  2AQ9 A;  4EAB A;  1GG4 A;  2GGQ A;  4CVK A;  3KWD A;  2W0V A;  3SPT A;  1V3W A;  3TK8 A;  3P1B A;  3TIO A;  3FTT A;  2FKO A;  4KQL A;  4AC3 A;  4DCL A;  5ADX U;  3BSY A;  3R5D A;  1QRE A;  2IU9 A;  1KRV A;  3NZ2 A;  5E3R A;  4EA9 A;  4ISX A;  2VD4 A;  3WSG A;  1T3D A;  3MQH A;  3JQY A;  3TIS A;  4QF5 A;  3R3I A;  2ICY A;  3OGZ A;  3ZM6 A;  3KWE A;  3OU9 A;  1Z90 A;  3ECT A;  4KNX A;  3I3A A;  3R3R A;  4N6A A;  3EEV A;  3C8V A;  3VBK A;  1KGT A;  3DJ4 A;  1FXJ A;  2AM1 A;  2OEF A;  4BUB A;  4K6R A;  3FSC A;  1OCX A;  1KK6 A;  1HM9 A;  1SSQ A;  4HUS A;  5DEP A;  2IOJ A;  3FSB A;  2XJA A;  4HUR A;  1N4I A;  3SUC A;  3T57 A;  3WSF A;  3PMO A;  3ZM5 A;  1XHD A;  4N69 A;  4EA8 A;  5U2K A;  4EAA A;  2IC7 A;  3GQ7 A;  4IHF A;  1YP4 A;  4E6T A;  1Z2F A;  2QIA A;  1KNX A;  2AM2 A;  3FSY A;  1NMO A;  3CJ8 A;  4R7P A; 
#chains in the Genus database with same CATH homology
 2V0K A;  4MZU A;  2OI6 A;  3R8Y A;  4J18 A;  2JF3 A;  1G97 A;  2OI5 A;  3FSX A;  4CVL A;  3ST8 A;  3VNP A;  3BRK X;  5L6V A;  4EQY A;  2QIV X;  4R36 A;  4E79 A;  4N6B A;  4H7O A;  4EA7 A;  3Q1X A;  3DHO A;  4QDI A;  1YP3 A;  3R1W A;  1J2Z A;  3MC4 A;  3R5C A;  3R5B A;  1LXA A;  2OEG A;  1HV9 A;  5AFU V;  3GUE A;  4C12 A;  1TDT A;  1HM8 A;  1SST A;  1KHR A;  3EG4 A;  5L6S A;  4HZD A;  3VBP A;  4R37 A;  1V67 A;  4M2B A;  2ICX A;  5AFU U;  3F1X A;  1KGQ A;  3IGJ A;  4J09 A;  2QKX A;  3OUP A;  4M2A A;  3VBL A;  2V0I A;  3BSS A;  3FS8 A;  4FCE A;  2IU8 A;  1G95 A;  3BXY A;  5E3P A;  1HM0 A;  1KQA A;  2OI7 A;  3TWD A;  3V4E A;  2V0L A;  3P47 A;  4G3S A;  4E1K A;  4QF5 A;  4E75 A;  4G3Q A;  3I3X A;  1KK5 A;  2GGO A;  4AA7 A;  2VHE A;  4MYO A;  3BSW A;  3R5A A;  3DK5 A;  2XAT A;  3TV0 A;  3OTZ A;  2WLF A;  3OTM A;  1E8C A;  5F42 A;  4M98 A;  4KPZ A;  3MQG A;  1SSM A;  3D8V A;  1QRM A;  1QRL A;  3VBJ A;  4EGG A;  2W0W A;  3HSQ A;  4M9C A;  4HCQ A;  4N27 A;  2V0H A;  3VBN A;  4CVM A;  3TDT A;  3IXC A;  3OW5 A;  4M28 A;  4KPX A;  2WLD A;  2Q4J A;  1S80 A;  1THJ A;  2P2O A;  1KRR A;  3R0S A;  4M99 A;  4G87 A;  4AAW A;  2WLC A;  4C13 A;  3HJJ A;  3KWC A;  1KRU A;  3ZL8 A;  1MR7 A;  1MR9 A;  2JF2 A;  3BFP A;  3GVD A;  2I5K A;  4ZIY A;  2IUA A;  4E6U A;  2WLE A;  1FWY A;  5E3Q A;  1QRG A;  2V0J A;  5DEM A;  2RIJ A;  3D98 A;  3GOS A;  4IHH A;  2TDT A;  1MRL A;  3R2W A;  3EH0 A;  1QQ0 A;  1KK4 A;  1YP2 A;  1XAT A;  4G3P A;  4IHG A;  2WTZ A;  4KNR A;  3VBI A;  2NPO A;  3FWW A;  4MFG A;  5DG3 A;  5ADX V;  2WLG A;  3VBM A;  4HZC A;  3SRT A;  1QRF A;  3FOQ A;  2AQ9 A;  4EAB A;  1GG4 A;  2GGQ A;  4CVK A;  3KWD A;  2W0V A;  3SPT A;  1V3W A;  3TK8 A;  3P1B A;  3TIO A;  3FTT A;  2FKO A;  4KQL A;  4AC3 A;  4DCL A;  5ADX U;  3BSY A;  3R5D A;  1QRE A;  2IU9 A;  1KRV A;  3NZ2 A;  5E3R A;  4EA9 A;  2VD4 A;  1T3D A;  3MQH A;  3JQY A;  3TIS A;  3R3I A;  2ICY A;  3ZM6 A;  3KWE A;  3OU9 A;  1Z90 A;  3ECT A;  4KNX A;  3I3A A;  3R3R A;  4N6A A;  3EEV A;  3C8V A;  3VBK A;  1KGT A;  3DJ4 A;  1FXJ A;  2AM1 A;  2OEF A;  4BUB A;  4K6R A;  3FSC A;  1OCX A;  1KK6 A;  1HM9 A;  1SSQ A;  4HUS A;  5DEP A;  2XJA A;  3FSB A;  4HUR A;  3T57 A;  3ZM5 A;  3PMO A;  1XHD A;  4N69 A;  4EA8 A;  5U2K A;  4EAA A;  2IC7 A;  4IHF A;  4E6T A;  1YP4 A;  2AM2 A;  4ISX A;  2QIA A;  3FSY A;  3CJ8 A;  4R7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...