3EH0A

Crystal structure of lpxd from escherichia coli
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
341
structure length
341
Chain Sequence
MASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLERKVNQQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase
publication title Crystal structure and acyl chain selectivity of Escherichia coli LpxD, the N-acyltransferase of lipid A biosynthesis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 104
structure length 341
sequence length 341
chains with identical sequence B, C
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2008-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 3eh0A02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 3eh0A01
4CVKA 1QRMA 2VHEA 1KK6A 3OTMA 2ICYA 1XATA 2RIJA 3ZM6A 4EA7A 3VBNA 3F1XA 4EAAA 2QIAA 3R3IA 1HM9A 3OU9A 3KWCA 3MQHA 3I3AA 2IU8A 4M2AA 4M2BA 2V0JA 1KK5A 5AFUU 4CVMA 4QDIA 2OI5A 2V0IA 3P47A 3I3XA 1QRGA 4AA7A 4R37A 1QRFA 3VBPA 2AM2A 3R8YA 1G97A 4ISXA 4EABA 3HSQA 4G3SA 4C13A 4HURA 5DEMA 3VBMA 1J2ZA 2WLFA 3GUEA 4N69A 4K6RA 4CVLA 1MRLA 4MZUA 3D8VA 2P2OA 3D98A 3FSXA 3R5BA 2XATA 2IU9A 3P1BA 4KNXA 3BFPA 1KK4A 4HCQA 1HV9A 3VBKA 4KNRA 4HZDA 1E8CA 4KPZA 3VBIA 3EEVA 1GG4A 2VD4A 3KWEA 2IC7A 1KRVA 3OTZA 4H7OA 3R5AA 4IHFA 4EQYA 4MFGA 4EA8A 2OI7A 4N6BA 4EGGA 4HUSA 3TV0A 3DJ4A 1YP2A 4G3QA 2WLGA 2FKOA 4QF5A 4G87A 4DCLA 4KPXA 4C12A 4MYOA 2TDTA 2AM1A 2JF3A 2W0VA 3ECTA 3FSYA 3FSCA 5F42A 2V0LA 3ZM5A 2OEFA 3FS8A 4IHGA 2WLCA 3Q1XA 3SRTA 3R1WA 2AQ9A 1THJA 1V3WA 3C8VA 3GVDA 3VBLA 4ZIYA 2GGQA 1QQ0A 4N27A 3IXCA 1KQAA 3BSYA 2V0HA 3MC4A 3PMOA 3R0SA 5DG3A 1MR7A 1YP4A 4J09A 4M98A 2I5KA 1FXJA 3BRKX 4AAWA 2ICXA 5E3QA 2OI6A 5DEPA 4BUBA 3ZL8A 3TDTA 1KGQA 2QKXA 3GOSA 3T57A 5U2KA 1S80A 4EA9A 5L6SA 4R36A 4E6UA 4M99A 1KRUA 4E1KA 3DHOA 1MR9A 3R5DA 3FOQA 3VBJA 3V4EA 1G95A 4IHHA 4R7PA 5L6VA 2WTZA 5ADXV 3OUPA 5AFUV 1QREA 1Z90A 1OCXA 3FWWA 1FWYA 3MQGA 3BXYA 4E79A 3EG4A 3R3RA 2W0WA 2WLEA 4N6AA 2XJAA 1KRRA 1YP3A 3FSBA 3TK8A 4J18A 1SSTA 3HJJA 3R5CA 2Q4JA 4KQLA 3BSWA 3OW5A 4M9CA 3KWDA 1QRLA 1TDTA 1XHDA 3BSSA 3NZ2A 5ADXU 4HZCA 3IGJA 3TISA 3DK5A 1KHRA 2GGOA 2IUAA 3JQYA 4FCEA 3TIOA 2NPOA 3SPTA 4AC3A 1SSMA 1KGTA 4E75A 4M28A 5E3PA 3ST8A 2JF2A 3EH0A 1HM0A 2WLDA 2V0KA 3CJ8A 1LXAA 2QIVX 4G3PA 1V67A 3VNPA 1SSQA 3FTTA 1HM8A 2OEGA 3TWDA 4E6TA 1T3DA 3R2WA 5E3RA
chains in the Genus database with same CATH superfamily
4CVKA 2IOJA 1QRMA 2VHEA 1KK6A 3OTMA 2ICYA 1XATA 2RIJA 1N4IA 2YYBA 3ZM6A 4EA7A 3VBNA 3F1XA 4EAAA 2QIAA 3R3IA 1HM9A 3OU9A 3KWCA 3MQHA 3I3AA 2IU8A 4M2AA 3OGZA 4M2BA 2V0JA 3OH1A 1KK5A 5AFUU 4CVMA 4QDIA 3WSFA 2OI5A 2V0IA 3P47A 3I3XA 1QRGA 4AA7A 4R37A 1QRFA 3VBPA 2AM2A 3R8YA 1G97A 4ISXA 1KO7A 4EABA 3HSQA 4G3SA 4C13A 4HURA 5DEMA 4MZUA 3VBMA 1J2ZA 2WLFA 3GUEA 1EWWA 4N69A 4K6RA 4CVLA 1MRLA 3OH0A 3D8VA 2P2OA 3D98A 3FSXA 3R5BA 2XATA 2IU9A 3P1BA 1L0SA 4KNXA 3BFPA 3EEQA 1KK4A 4HCQA 1HV9A 3VBKA 4KNRA 4HZDA 1E8CA 4KPZA 3VBIA 3EEVA 1GG4A 2VD4A 3KWEA 2IC7A 4IWGA 1KRVA 3OTZA 4H7OA 3R5AA 4IHFA 4EQYA 4MFGA 4EA8A 2OI7A 4N6BA 4EGGA 4HUSA 3OH2A 3DJ4A 1YP2A 4G3QA 2WLGA 3TV0A 2FKOA 4QF5A 1KNXA 4IWMA 4G87A 4DCLA 4KPXA 4C12A 4MYOA 3VBLA 2TDTA 2AM1A 2JF3A 2W0VA 3ECTA 3FSYA 3FSCA 5F42A 2V0LA 3WSIA 3ZM5A 2OEFA 3FS8A 4IHGA 2WLCA 3Q1XA 3SRTA 3R1WA 2AQ9A 1THJA 1Z2FA 1V3WA 3C8VA 3GVDA 3R2WA 2GGQA 1QQ0A 4ZIYA 4N27A 3WSHA 3IXCA 1KQAA 3BSYA 2V0HA 3MC4A 3PMOA 3R0SA 5DG3A 3WSDA 1MR7A 1YP4A 4J09A 4M98A 2I5KA 1FXJA 1M8NA 3BRKX 2ICXA 5E3QA 2OI6A 5DEPA 4AAWA 4BUBA 3ZL8A 3TDTA 1KGQA 2QKXA 3GOSA 3T57A 5U2KA 1S80A 4EA9A 5L6SA 3OH3A 4R36A 4E6UA 1NMOA 3SUCA 4M99A 1KRUA 4E1KA 3GQ8A 3DHOA 1MR9A 3R5DA 3FOQA 3VBJA 3V4EA 1G95A 4IHHA 4R7PA 5L6VA 2WTZA 5ADXV 3OUPA 5AFUV 1QREA 1Z90A 1OCXA 3FWWA 1FWYA 3WSEA 3L31A 3L2BA 3MQGA 3BXYA 4E79A 3EG4A 3R3RA 2W0WA 2WLEA 3GQAA 4N6AA 1KRRA 1YP3A 3FSBA 3TK8A 2XJAA 4J18A 1SSTA 3HJJA 3R5CA 2Q4JA 4KQLA 3BSWA 3OW5A 4M9CA 3KWDA 1QRLA 1TDTA 1XHDA 3BSSA 3NZ2A 5ADXU 3GQ7A 4HZCA 1NMPA 3IGJA 3TISA 3DK5A 1KHRA 2GGOA 2IUAA 3JQYA 4FCEA 3TIOA 2NPOA 3SPTA 4AC3A 1SSMA 1KGTA 4E75A 4M28A 5E3PA 3ST8A 2JF2A 3EH0A 1HM0A 2WLDA 2V0KA 3GQ9A 3CJ8A 1LXAA 2QIVX 4G3PA 1V67A 3VNPA 1SSQA 3FTTA 3WSGA 1HM8A 2OEGA 3TWDA 4E6TA 1T3DA 3OH4A 5E3RA 2FYWA
chains in the Genus database with same CATH topology
4CVKA 1QRMA 2VHEA 1KK6A 3OTMA 2ICYA 1XATA 2RIJA 3ZM6A 4EA7A 3VBNA 3F1XA 4EAAA 2QIAA 3R3IA 1HM9A 3OU9A 3KWCA 3MQHA 3I3AA 2IU8A 4M2AA 4M2BA 2V0JA 1KK5A 5AFUU 4CVMA 4QDIA 2OI5A 2V0IA 3P47A 3I3XA 1QRGA 4AA7A 4R37A 1QRFA 3VBPA 2AM2A 3R8YA 1G97A 4ISXA 4EABA 3HSQA 4G3SA 4C13A 4HURA 5DEMA 3VBMA 1J2ZA 2WLFA 3GUEA 4N69A 4K6RA 4CVLA 1MRLA 4MZUA 3D8VA 2P2OA 3D98A 3FSXA 3R5BA 2XATA 2IU9A 3P1BA 4KNXA 3BFPA 1KK4A 4HCQA 1HV9A 3VBKA 4KNRA 4HZDA 1E8CA 4KPZA 3VBIA 3EEVA 1GG4A 2VD4A 3KWEA 2IC7A 1KRVA 3OTZA 4H7OA 3R5AA 4IHFA 4EQYA 4MFGA 4EA8A 2OI7A 4N6BA 4EGGA 4HUSA 3TV0A 3DJ4A 1YP2A 4G3QA 2WLGA 2FKOA 4QF5A 4G87A 4DCLA 4KPXA 4C12A 4MYOA 2TDTA 2AM1A 2JF3A 2W0VA 3ECTA 3FSYA 3FSCA 5F42A 2V0LA 3ZM5A 2OEFA 3FS8A 4IHGA 2WLCA 3Q1XA 3SRTA 3R1WA 2AQ9A 1THJA 1V3WA 3C8VA 3GVDA 3VBLA 4ZIYA 2GGQA 1QQ0A 4N27A 3IXCA 1KQAA 3BSYA 2V0HA 3MC4A 3PMOA 3R0SA 5DG3A 1MR7A 1YP4A 4J09A 4M98A 2I5KA 1FXJA 3BRKX 4AAWA 2ICXA 5E3QA 2OI6A 5DEPA 4BUBA 3ZL8A 3TDTA 1KGQA 2QKXA 3GOSA 3T57A 5U2KA 1S80A 4EA9A 5L6SA 4R36A 4E6UA 4M99A 1KRUA 4E1KA 3DHOA 1MR9A 3R5DA 3FOQA 3VBJA 3V4EA 1G95A 4IHHA 4R7PA 5L6VA 2WTZA 5ADXV 3OUPA 5AFUV 1QREA 1Z90A 1OCXA 3FWWA 1FWYA 3MQGA 3BXYA 4E79A 3EG4A 3R3RA 2W0WA 2WLEA 4N6AA 2XJAA 1KRRA 1YP3A 3FSBA 3TK8A 4J18A 1SSTA 3HJJA 3R5CA 2Q4JA 4KQLA 3BSWA 3OW5A 4M9CA 3KWDA 1QRLA 1TDTA 1XHDA 3BSSA 3NZ2A 5ADXU 4HZCA 3IGJA 3TISA 3DK5A 1KHRA 2GGOA 2IUAA 3JQYA 4FCEA 3TIOA 2NPOA 3SPTA 4AC3A 1SSMA 1KGTA 4E75A 4M28A 5E3PA 3ST8A 2JF2A 3EH0A 1HM0A 2WLDA 2V0KA 3CJ8A 1LXAA 2QIVX 4G3PA 1V67A 3VNPA 1SSQA 3FTTA 1HM8A 2OEGA 3TWDA 4E6TA 1T3DA 3R2WA 5E3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CVK A;  1QRM A;  2VHE A;  1KK6 A;  3OTM A;  2ICY A;  1XAT A;  2RIJ A;  3ZM6 A;  4EA7 A;  3VBN A;  3F1X A;  4EAA A;  2QIA A;  3R3I A;  1HM9 A;  3OU9 A;  3KWC A;  3MQH A;  3I3A A;  2IU8 A;  4M2A A;  4M2B A;  2V0J A;  1KK5 A;  5AFU U;  4CVM A;  4QDI A;  2OI5 A;  2V0I A;  3P47 A;  3I3X A;  1QRG A;  4AA7 A;  4R37 A;  1QRF A;  3VBP A;  2AM2 A;  3R8Y A;  1G97 A;  4ISX A;  4EAB A;  3HSQ A;  4G3S A;  4C13 A;  4HUR A;  5DEM A;  3VBM A;  1J2Z A;  2WLF A;  3GUE A;  4N69 A;  4K6R A;  4CVL A;  1MRL A;  4MZU A;  3D8V A;  2P2O A;  3D98 A;  3FSX A;  3R5B A;  2XAT A;  2IU9 A;  3P1B A;  4KNX A;  3BFP A;  1KK4 A;  4HCQ A;  1HV9 A;  3VBK A;  4KNR A;  4HZD A;  1E8C A;  4KPZ A;  3VBI A;  3EEV A;  1GG4 A;  2VD4 A;  3KWE A;  2IC7 A;  1KRV A;  3OTZ A;  4H7O A;  3R5A A;  4IHF A;  4EQY A;  4MFG A;  4EA8 A;  2OI7 A;  4N6B A;  4EGG A;  4HUS A;  3TV0 A;  3DJ4 A;  1YP2 A;  4G3Q A;  2WLG A;  2FKO A;  4QF5 A;  4G87 A;  4DCL A;  4KPX A;  4C12 A;  4MYO A;  2TDT A;  2AM1 A;  2JF3 A;  2W0V A;  3ECT A;  3FSY A;  3FSC A;  5F42 A;  2V0L A;  3ZM5 A;  2OEF A;  3FS8 A;  4IHG A;  2WLC A;  3Q1X A;  3SRT A;  3R1W A;  2AQ9 A;  1THJ A;  1V3W A;  3C8V A;  3GVD A;  3VBL A;  4ZIY A;  2GGQ A;  1QQ0 A;  4N27 A;  3IXC A;  1KQA A;  3BSY A;  2V0H A;  3MC4 A;  3PMO A;  3R0S A;  5DG3 A;  1MR7 A;  1YP4 A;  4J09 A;  4M98 A;  2I5K A;  1FXJ A;  3BRK X;  4AAW A;  2ICX A;  5E3Q A;  2OI6 A;  5DEP A;  4BUB A;  3ZL8 A;  3TDT A;  1KGQ A;  2QKX A;  3GOS A;  3T57 A;  5U2K A;  1S80 A;  4EA9 A;  5L6S A;  4R36 A;  4E6U A;  4M99 A;  1KRU A;  4E1K A;  3DHO A;  1MR9 A;  3R5D A;  3FOQ A;  3VBJ A;  3V4E A;  1G95 A;  4IHH A;  4R7P A;  5L6V A;  2WTZ A;  5ADX V;  3OUP A;  5AFU V;  1QRE A;  1Z90 A;  1OCX A;  3FWW A;  1FWY A;  3MQG A;  3BXY A;  4E79 A;  3EG4 A;  3R3R A;  2W0W A;  2WLE A;  4N6A A;  2XJA A;  1KRR A;  1YP3 A;  3FSB A;  3TK8 A;  4J18 A;  1SST A;  3HJJ A;  3R5C A;  2Q4J A;  4KQL A;  3BSW A;  3OW5 A;  4M9C A;  3KWD A;  1QRL A;  1TDT A;  1XHD A;  3BSS A;  3NZ2 A;  5ADX U;  4HZC A;  3IGJ A;  3TIS A;  3DK5 A;  1KHR A;  2GGO A;  2IUA A;  3JQY A;  4FCE A;  3TIO A;  2NPO A;  3SPT A;  4AC3 A;  1SSM A;  1KGT A;  4E75 A;  4M28 A;  5E3P A;  3ST8 A;  2JF2 A;  3EH0 A;  1HM0 A;  2WLD A;  2V0K A;  3CJ8 A;  1LXA A;  2QIV X;  4G3P A;  1V67 A;  3VNP A;  1SSQ A;  3FTT A;  1HM8 A;  2OEG A;  3TWD A;  4E6T A;  1T3D A;  3R2W A;  5E3R A; 
#chains in the Genus database with same CATH topology
 4CVK A;  2IOJ A;  1QRM A;  2VHE A;  1KK6 A;  3OTM A;  2ICY A;  1XAT A;  2RIJ A;  1N4I A;  2YYB A;  3ZM6 A;  4EA7 A;  3VBN A;  3F1X A;  4EAA A;  2QIA A;  3R3I A;  1HM9 A;  3OU9 A;  3KWC A;  3MQH A;  3I3A A;  2IU8 A;  4M2A A;  3OGZ A;  4M2B A;  2V0J A;  3OH1 A;  1KK5 A;  5AFU U;  4CVM A;  4QDI A;  3WSF A;  2OI5 A;  2V0I A;  3P47 A;  3I3X A;  1QRG A;  4AA7 A;  4R37 A;  1QRF A;  3VBP A;  2AM2 A;  3R8Y A;  1G97 A;  4ISX A;  1KO7 A;  4EAB A;  3HSQ A;  4G3S A;  4C13 A;  4HUR A;  5DEM A;  4MZU A;  3VBM A;  1J2Z A;  2WLF A;  3GUE A;  1EWW A;  4N69 A;  4K6R A;  4CVL A;  1MRL A;  3OH0 A;  3D8V A;  2P2O A;  3D98 A;  3FSX A;  3R5B A;  2XAT A;  2IU9 A;  3P1B A;  1L0S A;  4KNX A;  3BFP A;  3EEQ A;  1KK4 A;  4HCQ A;  1HV9 A;  3VBK A;  4KNR A;  4HZD A;  1E8C A;  4KPZ A;  3VBI A;  3EEV A;  1GG4 A;  2VD4 A;  3KWE A;  2IC7 A;  4IWG A;  1KRV A;  3OTZ A;  4H7O A;  3R5A A;  4IHF A;  4EQY A;  4MFG A;  4EA8 A;  2OI7 A;  4N6B A;  4EGG A;  4HUS A;  3OH2 A;  3DJ4 A;  1YP2 A;  4G3Q A;  2WLG A;  3TV0 A;  2FKO A;  4QF5 A;  1KNX A;  4IWM A;  4G87 A;  4DCL A;  4KPX A;  4C12 A;  4MYO A;  3VBL A;  2TDT A;  2AM1 A;  2JF3 A;  2W0V A;  3ECT A;  3FSY A;  3FSC A;  5F42 A;  2V0L A;  3WSI A;  3ZM5 A;  2OEF A;  3FS8 A;  4IHG A;  2WLC A;  3Q1X A;  3SRT A;  3R1W A;  2AQ9 A;  1THJ A;  1Z2F A;  1V3W A;  3C8V A;  3GVD A;  3R2W A;  2GGQ A;  1QQ0 A;  4ZIY A;  4N27 A;  3WSH A;  3IXC A;  1KQA A;  3BSY A;  2V0H A;  3MC4 A;  3PMO A;  3R0S A;  5DG3 A;  3WSD A;  1MR7 A;  1YP4 A;  4J09 A;  4M98 A;  2I5K A;  1FXJ A;  1M8N A;  3BRK X;  2ICX A;  5E3Q A;  2OI6 A;  5DEP A;  4AAW A;  4BUB A;  3ZL8 A;  3TDT A;  1KGQ A;  2QKX A;  3GOS A;  3T57 A;  5U2K A;  1S80 A;  4EA9 A;  5L6S A;  3OH3 A;  4R36 A;  4E6U A;  1NMO A;  3SUC A;  4M99 A;  1KRU A;  4E1K A;  3GQ8 A;  3DHO A;  1MR9 A;  3R5D A;  3FOQ A;  3VBJ A;  3V4E A;  1G95 A;  4IHH A;  4R7P A;  5L6V A;  2WTZ A;  5ADX V;  3OUP A;  5AFU V;  1QRE A;  1Z90 A;  1OCX A;  3FWW A;  1FWY A;  3WSE A;  3L31 A;  3L2B A;  3MQG A;  3BXY A;  4E79 A;  3EG4 A;  3R3R A;  2W0W A;  2WLE A;  3GQA A;  4N6A A;  1KRR A;  1YP3 A;  3FSB A;  3TK8 A;  2XJA A;  4J18 A;  1SST A;  3HJJ A;  3R5C A;  2Q4J A;  4KQL A;  3BSW A;  3OW5 A;  4M9C A;  3KWD A;  1QRL A;  1TDT A;  1XHD A;  3BSS A;  3NZ2 A;  5ADX U;  3GQ7 A;  4HZC A;  1NMP A;  3IGJ A;  3TIS A;  3DK5 A;  1KHR A;  2GGO A;  2IUA A;  3JQY A;  4FCE A;  3TIO A;  2NPO A;  3SPT A;  4AC3 A;  1SSM A;  1KGT A;  4E75 A;  4M28 A;  5E3P A;  3ST8 A;  2JF2 A;  3EH0 A;  1HM0 A;  2WLD A;  2V0K A;  3GQ9 A;  3CJ8 A;  1LXA A;  2QIV X;  4G3P A;  1V67 A;  3VNP A;  1SSQ A;  3FTT A;  3WSG A;  1HM8 A;  2OEG A;  3TWD A;  4E6T A;  1T3D A;  3OH4 A;  5E3R A;  2FYW A; 
#chains in the Genus database with same CATH homology
 4CVK A;  1QRM A;  2VHE A;  1KK6 A;  3OTM A;  2ICY A;  1XAT A;  2RIJ A;  3ZM6 A;  4EA7 A;  3VBN A;  3F1X A;  4EAA A;  2QIA A;  3R3I A;  1HM9 A;  3OU9 A;  3KWC A;  3MQH A;  3I3A A;  2IU8 A;  4M2A A;  4M2B A;  2V0J A;  1KK5 A;  5AFU U;  4CVM A;  4QDI A;  2OI5 A;  2V0I A;  3P47 A;  3I3X A;  1QRG A;  4AA7 A;  4R37 A;  1QRF A;  3VBP A;  2AM2 A;  3R8Y A;  1G97 A;  4ISX A;  4EAB A;  3HSQ A;  4G3S A;  4C13 A;  4HUR A;  5DEM A;  3VBM A;  1J2Z A;  2WLF A;  3GUE A;  4N69 A;  4K6R A;  4CVL A;  1MRL A;  4MZU A;  3D8V A;  2P2O A;  3D98 A;  3FSX A;  3R5B A;  2XAT A;  2IU9 A;  3P1B A;  4KNX A;  3BFP A;  1KK4 A;  4HCQ A;  1HV9 A;  3VBK A;  4KNR A;  4HZD A;  1E8C A;  4KPZ A;  3VBI A;  3EEV A;  1GG4 A;  2VD4 A;  3KWE A;  2IC7 A;  1KRV A;  3OTZ A;  4H7O A;  3R5A A;  4IHF A;  4EQY A;  4MFG A;  4EA8 A;  2OI7 A;  4N6B A;  4EGG A;  4HUS A;  3TV0 A;  3DJ4 A;  1YP2 A;  4G3Q A;  2WLG A;  2FKO A;  4QF5 A;  4G87 A;  4DCL A;  4KPX A;  4C12 A;  4MYO A;  2TDT A;  2AM1 A;  2JF3 A;  2W0V A;  3ECT A;  3FSY A;  3FSC A;  5F42 A;  2V0L A;  3ZM5 A;  2OEF A;  3FS8 A;  4IHG A;  2WLC A;  3Q1X A;  3SRT A;  3R1W A;  2AQ9 A;  1THJ A;  1V3W A;  3C8V A;  3GVD A;  3VBL A;  4ZIY A;  2GGQ A;  1QQ0 A;  4N27 A;  3IXC A;  1KQA A;  3BSY A;  2V0H A;  3MC4 A;  3PMO A;  3R0S A;  5DG3 A;  1MR7 A;  1YP4 A;  4J09 A;  4M98 A;  2I5K A;  1FXJ A;  3BRK X;  4AAW A;  2ICX A;  5E3Q A;  2OI6 A;  5DEP A;  4BUB A;  3ZL8 A;  3TDT A;  1KGQ A;  2QKX A;  3GOS A;  3T57 A;  5U2K A;  1S80 A;  4EA9 A;  5L6S A;  4R36 A;  4E6U A;  4M99 A;  1KRU A;  4E1K A;  3DHO A;  1MR9 A;  3R5D A;  3FOQ A;  3VBJ A;  3V4E A;  1G95 A;  4IHH A;  4R7P A;  5L6V A;  2WTZ A;  5ADX V;  3OUP A;  5AFU V;  1QRE A;  1Z90 A;  1OCX A;  3FWW A;  1FWY A;  3MQG A;  3BXY A;  4E79 A;  3EG4 A;  3R3R A;  2W0W A;  2WLE A;  4N6A A;  2XJA A;  1KRR A;  1YP3 A;  3FSB A;  3TK8 A;  4J18 A;  1SST A;  3HJJ A;  3R5C A;  2Q4J A;  4KQL A;  3BSW A;  3OW5 A;  4M9C A;  3KWD A;  1QRL A;  1TDT A;  1XHD A;  3BSS A;  3NZ2 A;  5ADX U;  4HZC A;  3IGJ A;  3TIS A;  3DK5 A;  1KHR A;  2GGO A;  2IUA A;  3JQY A;  4FCE A;  3TIO A;  2NPO A;  3SPT A;  4AC3 A;  1SSM A;  1KGT A;  4E75 A;  4M28 A;  5E3P A;  3ST8 A;  2JF2 A;  3EH0 A;  1HM0 A;  2WLD A;  2V0K A;  3CJ8 A;  1LXA A;  2QIV X;  4G3P A;  1V67 A;  3VNP A;  1SSQ A;  3FTT A;  1HM8 A;  2OEG A;  3TWD A;  4E6T A;  1T3D A;  3R2W A;  5E3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...