4IWGA

Crystal structure of the conserved hypothetical protein mj0927 from methanocaldococcus jannaschii (in c2221 form)
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
244
structure length
244
Chain Sequence
MKAKEIIEFIETFAPKDLAIEGDNIGLQVGDNLDKEIKKLGIALDPSLSVIKKAEKEGVDFLFTHHPLLKDPIRNFTGVIYKKLKILMENDIILYSAHTNLDICKNGLNDALAELYNLENPKPLYDNGLGRVGIFKGSFEEFLEITKKYIHKNPIVVKSKEVDDNFKLAVLSGYGLSQSSIKYVAEKADVYLSGDLTHHSKILAEELGLVVVDATHYSTEVFGLKKFKEFLSSNLDLEIISLDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0135 protein MJ0927
publication title Crystal Structure of the Conserved Hypothetical Protein MJ0927 from Methanocaldococcus jannaschii
rcsb
source organism Methanocaldococcus jannaschii
molecule tags Unknown function
total genus 88
structure length 244
sequence length 244
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01784 NIF3 NIF3 (NGG1p interacting factor 3)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 4iwgA01
3.40.1390.30 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 NIF3 (NGG1p interacting factor 3)-like 4iwgA02
4IWGA 3WSIA 2FYWA 3WSEA 1NMOA 3WSDA 3WSFA 3WSGA 3WSHA 2YYBA 1NMPA 4IWMA
chains in the Genus database with same CATH superfamily
3EEQA 3L31A 2FYWA 1NMOA 3ZL8A 4CVLA 2AM1A 4E79A 2IOJA 4QF5A 4IWGA 2IUAA 3EH0A 3WSEA 4C13A 4ZIYA 2IU9A 3WSDA 2XJAA 2WTZA 4QDIA 3WSHA 2AM2A 4C12A 1KNXA 4IHFA 3WSGA 4CVKA 4IHHA 3ZM5A 1NMPA 1GG4A 3ZM6A 4CVMA 3PMOA 4IHGA 3WSIA 1KO7A 3L2BA 3WSFA 2IU8A 2YYBA 4E75A 4BUBA 1E8CA 4IWMA
chains in the Genus database with same CATH topology
4IWGA 3WSIA 2FYWA 3WSEA 1NMOA 3WSDA 3WSFA 3WSGA 3WSHA 2YYBA 1NMPA 4IWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IWG A;  3WSI A;  2FYW A;  3WSE A;  1NMO A;  3WSD A;  3WSF A;  3WSG A;  3WSH A;  2YYB A;  1NMP A;  4IWM A; 
#chains in the Genus database with same CATH topology
 3EEQ A;  3L31 A;  2FYW A;  1NMO A;  3ZL8 A;  4CVL A;  2AM1 A;  4E79 A;  2IOJ A;  4QF5 A;  4IWG A;  2IUA A;  3EH0 A;  3WSE A;  4C13 A;  4ZIY A;  2IU9 A;  3WSD A;  2XJA A;  2WTZ A;  4QDI A;  3WSH A;  2AM2 A;  4C12 A;  1KNX A;  4IHF A;  3WSG A;  4CVK A;  4IHH A;  3ZM5 A;  1NMP A;  1GG4 A;  3ZM6 A;  4CVM A;  3PMO A;  4IHG A;  3WSI A;  1KO7 A;  3L2B A;  3WSF A;  2IU8 A;  2YYB A;  4E75 A;  4BUB A;  1E8C A;  4IWM A; 
#chains in the Genus database with same CATH homology
 4IWG A;  3WSI A;  2FYW A;  3WSE A;  1NMO A;  3WSD A;  3WSF A;  3WSG A;  3WSH A;  2YYB A;  1NMP A;  4IWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...