2IUAA

C. trachomatis lpxd
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MSQSTYSLEQLADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE
publication title Structure and Reactivity of Lpxd, the N-Acyltransferase of Lipid a Biosynthesis
pubmed doi rcsb
source organism Chlamydia trachomatis
molecule tags Transferase
total genus 110
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2iuaA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 2iuaA01
1TDTA 3TK8A 4G3QA 3ZM6A 1QRGA 1S80A 1XHDA 3HSQA 3P1BA 2I5KA 4H7OA 3V4EA 4EABA 4CVLA 4CVKA 1OCXA 1QREA 1KRRA 3OTZA 4KNRA 3FSCA 3FWWA 3MQHA 4BUBA 1XATA 3OUPA 3ST8A 1YP4A 3VBNA 5L6VA 1QRLA 2AQ9A 2V0KA 2V0IA 3R0SA 2V0HA 5E3QA 2Q4JA 2OI5A 2RIJA 2AM1A 4KQLA 1FXJA 3I3AA 1KK4A 2ICYA 1T3DA 4E79A 3BFPA 3GVDA 2NPOA 2GGOA 2QIAA 3KWEA 3TISA 2WLFA 4KPXA 3TWDA 3DJ4A 2W0VA 1MR9A 4KNXA 4R37A 4EQYA 1KRVA 5ADXV 3TV0A 1QQ0A 2AM2A 3HJJA 1YP2A 4KPZA 4M2AA 2TDTA 3P47A 3TIOA 1KGQA 3R5CA 4AC3A 3IXCA 5ADXU 3D8VA 3R8YA 4E1KA 3BSSA 4HCQA 2VHEA 1V67A 3R3RA 1HM0A 2W0WA 2OEGA 3MQGA 4M9CA 4J18A 4MZUA 4E6TA 2JF2A 4ISXA 1THJA 4E6UA 1HM9A 4IHGA 4E75A 1J2ZA 3KWDA 4HZDA 5DEMA 1KHRA 4M2BA 1Z90A 4N6AA 5F42A 3ZM5A 4K6RA 4C12A 2WLEA 4CVMA 2VD4A 3FS8A 4FCEA 4HURA 1KRUA 4MFGA 2XATA 3FSYA 3GUEA 1KQAA 2WLGA 1E8CA 4M99A 2WTZA 3VBPA 4IHFA 3DK5A 3NZ2A 4HUSA 3F1XA 4AAWA 2WLCA 3R1WA 3TDTA 4IHHA 1SSQA 3R3IA 4QDIA 3FTTA 3EH0A 3ECTA 4HZCA 3VBKA 1MR7A 2OI7A 1KGTA 3KWCA 1FWYA 1G95A 1SSMA 3BSWA 4M28A 2GGQA 3I3XA 3SRTA 5E3RA 2V0JA 3MC4A 3IGJA 3VNPA 3JQYA 3R2WA 1GG4A 4G87A 1HV9A 1G97A 3BSYA 1QRMA 5AFUV 2ICXA 1SSTA 2QKXA 3VBLA 3FOQA 3GOSA 3T57A 2JF3A 5E3PA 1KK6A 3BRKX 4G3SA 3FSBA 2WLDA 3D98A 2IUAA 3EEVA 3PMOA 4N27A 4EA8A 4DCLA 2IU8A 4N6BA 1QRFA 5AFUU 4QF5A 2XJAA 1KK5A 3VBJA 4G3PA 2P2OA 3R5BA 4R7PA 2V0LA 2IU9A 3R5AA 5DG3A 3R5DA 2FKOA 3CJ8A 3OW5A 3DHOA 5DEPA 4AA7A 2OI6A 3VBIA 2QIVX 4MYOA 4EGGA 3ZL8A 3BXYA 1V3WA 4EA7A 1MRLA 4R36A 5L6SA 4J09A 4EA9A 3VBMA 5U2KA 3C8VA 4N69A 1LXAA 4ZIYA 2OEFA 1YP3A 4EAAA 3OU9A 3EG4A 3FSXA 3Q1XA 3SPTA 4C13A 2IC7A 3OTMA 4M98A 1HM8A
chains in the Genus database with same CATH superfamily
1TDTA 3TK8A 4G3QA 3ZM6A 1QRGA 1S80A 1XHDA 3HSQA 3P1BA 2I5KA 4H7OA 3V4EA 3GQ7A 4EABA 3EEQA 3WSGA 1OCXA 4CVLA 1QREA 1KRRA 3OTZA 4KNRA 3FSCA 3FWWA 3MQHA 4BUBA 1XATA 3OUPA 3ST8A 1YP4A 3L31A 3VBNA 5L6VA 3OH3A 1QRLA 1L0SA 2AQ9A 2V0KA 2YYBA 2V0IA 3R0SA 2V0HA 5E3QA 2Q4JA 2OI5A 2RIJA 2AM1A 4KQLA 1FXJA 3I3AA 1KK4A 2ICYA 1T3DA 3OH1A 4E79A 3BFPA 3GVDA 1KO7A 2NPOA 2GGOA 2QIAA 3KWEA 3TISA 2WLFA 4KPXA 3TWDA 3DJ4A 2W0VA 1MR9A 3OH2A 4KNXA 4R37A 1KRVA 4EQYA 5ADXV 3TV0A 1QQ0A 2AM2A 3HJJA 1YP2A 4KPZA 4M2AA 2TDTA 3P47A 3TIOA 1KGQA 1KNXA 3R5CA 4AC3A 3IXCA 5ADXU 3OH0A 3D8VA 3R8YA 4E1KA 3BSSA 4HCQA 3GQAA 2VHEA 1EWWA 1V67A 3R3RA 1HM0A 2W0WA 2OEGA 3MQGA 4M9CA 4J18A 4MZUA 4E6TA 2JF2A 4ISXA 1THJA 4E6UA 1HM9A 1N4IA 4IWGA 4IHGA 4E75A 1J2ZA 3KWDA 4HZDA 5DEMA 1Z2FA 1KHRA 4M2BA 1Z90A 4N6AA 5F42A 3ZM5A 4K6RA 4C12A 4IWMA 2WLEA 3SUCA 4CVMA 2VD4A 3FS8A 4FCEA 4HURA 1KRUA 4MFGA 1M8NA 2XATA 3FSYA 3GUEA 1KQAA 2WLGA 3OGZA 4M99A 1E8CA 2WTZA 3VBPA 4IHFA 3DK5A 3NZ2A 4HUSA 3F1XA 4AAWA 1NMPA 2WLCA 3R1WA 3TDTA 4IHHA 1SSQA 3R3IA 4QDIA 3FTTA 3EH0A 3ECTA 4HZCA 3OH4A 3VBKA 1MR7A 2OI7A 1KGTA 3KWCA 1FWYA 1G95A 2FYWA 3GQ8A 1SSMA 3BSWA 4M28A 2GGQA 3I3XA 3SRTA 5E3RA 2V0JA 3WSHA 3MC4A 1NMOA 3IGJA 3VNPA 3JQYA 3R2WA 1GG4A 4G87A 1HV9A 1G97A 3BSYA 1QRMA 5AFUV 2ICXA 1SSTA 2QKXA 3VBLA 3FOQA 3GOSA 3T57A 3WSIA 2JF3A 5E3PA 1KK6A 3BRKX 4G3SA 3FSBA 2WLDA 3D98A 2IUAA 3EEVA 3PMOA 4N27A 4EA8A 4CVKA 4DCLA 2IU8A 4N6BA 1QRFA 5AFUU 3L2BA 2XJAA 1KK5A 4QF5A 3WSEA 3VBJA 3WSFA 4G3PA 2P2OA 3WSDA 3R5BA 4R7PA 2V0LA 2IU9A 3R5AA 5DG3A 3R5DA 2FKOA 3CJ8A 3OW5A 3DHOA 5DEPA 4AA7A 3GQ9A 2OI6A 3VBIA 2IOJA 2QIVX 4MYOA 4EGGA 3ZL8A 3BXYA 1V3WA 4EA7A 1MRLA 4R36A 5L6SA 4J09A 4EA9A 3VBMA 5U2KA 3C8VA 4N69A 1LXAA 4ZIYA 2OEFA 1YP3A 4EAAA 3OU9A 3EG4A 3FSXA 3Q1XA 3SPTA 4C13A 2IC7A 3OTMA 4M98A 1HM8A
chains in the Genus database with same CATH topology
1TDTA 3TK8A 4G3QA 3ZM6A 1QRGA 1S80A 1XHDA 3HSQA 3P1BA 2I5KA 4H7OA 3V4EA 4EABA 4CVLA 4CVKA 1OCXA 1QREA 1KRRA 3OTZA 4KNRA 3FSCA 3FWWA 3MQHA 4BUBA 1XATA 3OUPA 3ST8A 1YP4A 3VBNA 5L6VA 1QRLA 2AQ9A 2V0KA 2V0IA 3R0SA 2V0HA 5E3QA 2Q4JA 2OI5A 2RIJA 2AM1A 4KQLA 1FXJA 3I3AA 1KK4A 2ICYA 1T3DA 4E79A 3BFPA 3GVDA 2NPOA 2GGOA 2QIAA 3KWEA 3TISA 2WLFA 4KPXA 3TWDA 3DJ4A 2W0VA 1MR9A 4KNXA 4R37A 4EQYA 1KRVA 5ADXV 3TV0A 1QQ0A 2AM2A 3HJJA 1YP2A 4KPZA 4M2AA 2TDTA 3P47A 3TIOA 1KGQA 3R5CA 4AC3A 3IXCA 5ADXU 3D8VA 3R8YA 4E1KA 3BSSA 4HCQA 2VHEA 1V67A 3R3RA 1HM0A 2W0WA 2OEGA 3MQGA 4M9CA 4J18A 4MZUA 4E6TA 2JF2A 4ISXA 1THJA 4E6UA 1HM9A 4IHGA 4E75A 1J2ZA 3KWDA 4HZDA 5DEMA 1KHRA 4M2BA 1Z90A 4N6AA 5F42A 3ZM5A 4K6RA 4C12A 2WLEA 4CVMA 2VD4A 3FS8A 4FCEA 4HURA 1KRUA 4MFGA 2XATA 3FSYA 3GUEA 1KQAA 2WLGA 1E8CA 4M99A 2WTZA 3VBPA 4IHFA 3DK5A 3NZ2A 4HUSA 3F1XA 4AAWA 2WLCA 3R1WA 3TDTA 4IHHA 1SSQA 3R3IA 4QDIA 3FTTA 3EH0A 3ECTA 4HZCA 3VBKA 1MR7A 2OI7A 1KGTA 3KWCA 1FWYA 1G95A 1SSMA 3BSWA 4M28A 2GGQA 3I3XA 3SRTA 5E3RA 2V0JA 3MC4A 3IGJA 3VNPA 3JQYA 3R2WA 1GG4A 4G87A 1HV9A 1G97A 3BSYA 1QRMA 5AFUV 2ICXA 1SSTA 2QKXA 3VBLA 3FOQA 3GOSA 3T57A 2JF3A 5E3PA 1KK6A 3BRKX 4G3SA 3FSBA 2WLDA 3D98A 2IUAA 3EEVA 3PMOA 4N27A 4EA8A 4DCLA 2IU8A 4N6BA 1QRFA 5AFUU 4QF5A 2XJAA 1KK5A 3VBJA 4G3PA 2P2OA 3R5BA 4R7PA 2V0LA 2IU9A 3R5AA 5DG3A 3R5DA 2FKOA 3CJ8A 3OW5A 3DHOA 5DEPA 4AA7A 2OI6A 3VBIA 2QIVX 4MYOA 4EGGA 3ZL8A 3BXYA 1V3WA 4EA7A 1MRLA 4R36A 5L6SA 4J09A 4EA9A 3VBMA 5U2KA 3C8VA 4N69A 1LXAA 4ZIYA 2OEFA 1YP3A 4EAAA 3OU9A 3EG4A 3FSXA 3Q1XA 3SPTA 4C13A 2IC7A 3OTMA 4M98A 1HM8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TDT A;  3TK8 A;  4G3Q A;  3ZM6 A;  1QRG A;  1S80 A;  1XHD A;  3HSQ A;  3P1B A;  2I5K A;  4H7O A;  3V4E A;  4EAB A;  4CVL A;  4CVK A;  1OCX A;  1QRE A;  1KRR A;  3OTZ A;  4KNR A;  3FSC A;  3FWW A;  3MQH A;  4BUB A;  1XAT A;  3OUP A;  3ST8 A;  1YP4 A;  3VBN A;  5L6V A;  1QRL A;  2AQ9 A;  2V0K A;  2V0I A;  3R0S A;  2V0H A;  5E3Q A;  2Q4J A;  2OI5 A;  2RIJ A;  2AM1 A;  4KQL A;  1FXJ A;  3I3A A;  1KK4 A;  2ICY A;  1T3D A;  4E79 A;  3BFP A;  3GVD A;  2NPO A;  2GGO A;  2QIA A;  3KWE A;  3TIS A;  2WLF A;  4KPX A;  3TWD A;  3DJ4 A;  2W0V A;  1MR9 A;  4KNX A;  4R37 A;  4EQY A;  1KRV A;  5ADX V;  3TV0 A;  1QQ0 A;  2AM2 A;  3HJJ A;  1YP2 A;  4KPZ A;  4M2A A;  2TDT A;  3P47 A;  3TIO A;  1KGQ A;  3R5C A;  4AC3 A;  3IXC A;  5ADX U;  3D8V A;  3R8Y A;  4E1K A;  3BSS A;  4HCQ A;  2VHE A;  1V67 A;  3R3R A;  1HM0 A;  2W0W A;  2OEG A;  3MQG A;  4M9C A;  4J18 A;  4MZU A;  4E6T A;  2JF2 A;  4ISX A;  1THJ A;  4E6U A;  1HM9 A;  4IHG A;  4E75 A;  1J2Z A;  3KWD A;  4HZD A;  5DEM A;  1KHR A;  4M2B A;  1Z90 A;  4N6A A;  5F42 A;  3ZM5 A;  4K6R A;  4C12 A;  2WLE A;  4CVM A;  2VD4 A;  3FS8 A;  4FCE A;  4HUR A;  1KRU A;  4MFG A;  2XAT A;  3FSY A;  3GUE A;  1KQA A;  2WLG A;  1E8C A;  4M99 A;  2WTZ A;  3VBP A;  4IHF A;  3DK5 A;  3NZ2 A;  4HUS A;  3F1X A;  4AAW A;  2WLC A;  3R1W A;  3TDT A;  4IHH A;  1SSQ A;  3R3I A;  4QDI A;  3FTT A;  3EH0 A;  3ECT A;  4HZC A;  3VBK A;  1MR7 A;  2OI7 A;  1KGT A;  3KWC A;  1FWY A;  1G95 A;  1SSM A;  3BSW A;  4M28 A;  2GGQ A;  3I3X A;  3SRT A;  5E3R A;  2V0J A;  3MC4 A;  3IGJ A;  3VNP A;  3JQY A;  3R2W A;  1GG4 A;  4G87 A;  1HV9 A;  1G97 A;  3BSY A;  1QRM A;  5AFU V;  2ICX A;  1SST A;  2QKX A;  3VBL A;  3FOQ A;  3GOS A;  3T57 A;  2JF3 A;  5E3P A;  1KK6 A;  3BRK X;  4G3S A;  3FSB A;  2WLD A;  3D98 A;  2IUA A;  3EEV A;  3PMO A;  4N27 A;  4EA8 A;  4DCL A;  2IU8 A;  4N6B A;  1QRF A;  5AFU U;  4QF5 A;  2XJA A;  1KK5 A;  3VBJ A;  4G3P A;  2P2O A;  3R5B A;  4R7P A;  2V0L A;  2IU9 A;  3R5A A;  5DG3 A;  3R5D A;  2FKO A;  3CJ8 A;  3OW5 A;  3DHO A;  5DEP A;  4AA7 A;  2OI6 A;  3VBI A;  2QIV X;  4MYO A;  4EGG A;  3ZL8 A;  3BXY A;  1V3W A;  4EA7 A;  1MRL A;  4R36 A;  5L6S A;  4J09 A;  4EA9 A;  3VBM A;  5U2K A;  3C8V A;  4N69 A;  1LXA A;  4ZIY A;  2OEF A;  1YP3 A;  4EAA A;  3OU9 A;  3EG4 A;  3FSX A;  3Q1X A;  3SPT A;  4C13 A;  2IC7 A;  3OTM A;  4M98 A;  1HM8 A; 
#chains in the Genus database with same CATH topology
 1TDT A;  3TK8 A;  4G3Q A;  3ZM6 A;  1QRG A;  1S80 A;  1XHD A;  3HSQ A;  3P1B A;  2I5K A;  4H7O A;  3V4E A;  3GQ7 A;  4EAB A;  3EEQ A;  3WSG A;  1OCX A;  4CVL A;  1QRE A;  1KRR A;  3OTZ A;  4KNR A;  3FSC A;  3FWW A;  3MQH A;  4BUB A;  1XAT A;  3OUP A;  3ST8 A;  1YP4 A;  3L31 A;  3VBN A;  5L6V A;  3OH3 A;  1QRL A;  1L0S A;  2AQ9 A;  2V0K A;  2YYB A;  2V0I A;  3R0S A;  2V0H A;  5E3Q A;  2Q4J A;  2OI5 A;  2RIJ A;  2AM1 A;  4KQL A;  1FXJ A;  3I3A A;  1KK4 A;  2ICY A;  1T3D A;  3OH1 A;  4E79 A;  3BFP A;  3GVD A;  1KO7 A;  2NPO A;  2GGO A;  2QIA A;  3KWE A;  3TIS A;  2WLF A;  4KPX A;  3TWD A;  3DJ4 A;  2W0V A;  1MR9 A;  3OH2 A;  4KNX A;  4R37 A;  1KRV A;  4EQY A;  5ADX V;  3TV0 A;  1QQ0 A;  2AM2 A;  3HJJ A;  1YP2 A;  4KPZ A;  4M2A A;  2TDT A;  3P47 A;  3TIO A;  1KGQ A;  1KNX A;  3R5C A;  4AC3 A;  3IXC A;  5ADX U;  3OH0 A;  3D8V A;  3R8Y A;  4E1K A;  3BSS A;  4HCQ A;  3GQA A;  2VHE A;  1EWW A;  1V67 A;  3R3R A;  1HM0 A;  2W0W A;  2OEG A;  3MQG A;  4M9C A;  4J18 A;  4MZU A;  4E6T A;  2JF2 A;  4ISX A;  1THJ A;  4E6U A;  1HM9 A;  1N4I A;  4IWG A;  4IHG A;  4E75 A;  1J2Z A;  3KWD A;  4HZD A;  5DEM A;  1Z2F A;  1KHR A;  4M2B A;  1Z90 A;  4N6A A;  5F42 A;  3ZM5 A;  4K6R A;  4C12 A;  4IWM A;  2WLE A;  3SUC A;  4CVM A;  2VD4 A;  3FS8 A;  4FCE A;  4HUR A;  1KRU A;  4MFG A;  1M8N A;  2XAT A;  3FSY A;  3GUE A;  1KQA A;  2WLG A;  3OGZ A;  4M99 A;  1E8C A;  2WTZ A;  3VBP A;  4IHF A;  3DK5 A;  3NZ2 A;  4HUS A;  3F1X A;  4AAW A;  1NMP A;  2WLC A;  3R1W A;  3TDT A;  4IHH A;  1SSQ A;  3R3I A;  4QDI A;  3FTT A;  3EH0 A;  3ECT A;  4HZC A;  3OH4 A;  3VBK A;  1MR7 A;  2OI7 A;  1KGT A;  3KWC A;  1FWY A;  1G95 A;  2FYW A;  3GQ8 A;  1SSM A;  3BSW A;  4M28 A;  2GGQ A;  3I3X A;  3SRT A;  5E3R A;  2V0J A;  3WSH A;  3MC4 A;  1NMO A;  3IGJ A;  3VNP A;  3JQY A;  3R2W A;  1GG4 A;  4G87 A;  1HV9 A;  1G97 A;  3BSY A;  1QRM A;  5AFU V;  2ICX A;  1SST A;  2QKX A;  3VBL A;  3FOQ A;  3GOS A;  3T57 A;  3WSI A;  2JF3 A;  5E3P A;  1KK6 A;  3BRK X;  4G3S A;  3FSB A;  2WLD A;  3D98 A;  2IUA A;  3EEV A;  3PMO A;  4N27 A;  4EA8 A;  4CVK A;  4DCL A;  2IU8 A;  4N6B A;  1QRF A;  5AFU U;  3L2B A;  2XJA A;  1KK5 A;  4QF5 A;  3WSE A;  3VBJ A;  3WSF A;  4G3P A;  2P2O A;  3WSD A;  3R5B A;  4R7P A;  2V0L A;  2IU9 A;  3R5A A;  5DG3 A;  3R5D A;  2FKO A;  3CJ8 A;  3OW5 A;  3DHO A;  5DEP A;  4AA7 A;  3GQ9 A;  2OI6 A;  3VBI A;  2IOJ A;  2QIV X;  4MYO A;  4EGG A;  3ZL8 A;  3BXY A;  1V3W A;  4EA7 A;  1MRL A;  4R36 A;  5L6S A;  4J09 A;  4EA9 A;  3VBM A;  5U2K A;  3C8V A;  4N69 A;  1LXA A;  4ZIY A;  2OEF A;  1YP3 A;  4EAA A;  3OU9 A;  3EG4 A;  3FSX A;  3Q1X A;  3SPT A;  4C13 A;  2IC7 A;  3OTM A;  4M98 A;  1HM8 A; 
#chains in the Genus database with same CATH homology
 1TDT A;  3TK8 A;  4G3Q A;  3ZM6 A;  1QRG A;  1S80 A;  1XHD A;  3HSQ A;  3P1B A;  2I5K A;  4H7O A;  3V4E A;  4EAB A;  4CVL A;  4CVK A;  1OCX A;  1QRE A;  1KRR A;  3OTZ A;  4KNR A;  3FSC A;  3FWW A;  3MQH A;  4BUB A;  1XAT A;  3OUP A;  3ST8 A;  1YP4 A;  3VBN A;  5L6V A;  1QRL A;  2AQ9 A;  2V0K A;  2V0I A;  3R0S A;  2V0H A;  5E3Q A;  2Q4J A;  2OI5 A;  2RIJ A;  2AM1 A;  4KQL A;  1FXJ A;  3I3A A;  1KK4 A;  2ICY A;  1T3D A;  4E79 A;  3BFP A;  3GVD A;  2NPO A;  2GGO A;  2QIA A;  3KWE A;  3TIS A;  2WLF A;  4KPX A;  3TWD A;  3DJ4 A;  2W0V A;  1MR9 A;  4KNX A;  4R37 A;  4EQY A;  1KRV A;  5ADX V;  3TV0 A;  1QQ0 A;  2AM2 A;  3HJJ A;  1YP2 A;  4KPZ A;  4M2A A;  2TDT A;  3P47 A;  3TIO A;  1KGQ A;  3R5C A;  4AC3 A;  3IXC A;  5ADX U;  3D8V A;  3R8Y A;  4E1K A;  3BSS A;  4HCQ A;  2VHE A;  1V67 A;  3R3R A;  1HM0 A;  2W0W A;  2OEG A;  3MQG A;  4M9C A;  4J18 A;  4MZU A;  4E6T A;  2JF2 A;  4ISX A;  1THJ A;  4E6U A;  1HM9 A;  4IHG A;  4E75 A;  1J2Z A;  3KWD A;  4HZD A;  5DEM A;  1KHR A;  4M2B A;  1Z90 A;  4N6A A;  5F42 A;  3ZM5 A;  4K6R A;  4C12 A;  2WLE A;  4CVM A;  2VD4 A;  3FS8 A;  4FCE A;  4HUR A;  1KRU A;  4MFG A;  2XAT A;  3FSY A;  3GUE A;  1KQA A;  2WLG A;  1E8C A;  4M99 A;  2WTZ A;  3VBP A;  4IHF A;  3DK5 A;  3NZ2 A;  4HUS A;  3F1X A;  4AAW A;  2WLC A;  3R1W A;  3TDT A;  4IHH A;  1SSQ A;  3R3I A;  4QDI A;  3FTT A;  3EH0 A;  3ECT A;  4HZC A;  3VBK A;  1MR7 A;  2OI7 A;  1KGT A;  3KWC A;  1FWY A;  1G95 A;  1SSM A;  3BSW A;  4M28 A;  2GGQ A;  3I3X A;  3SRT A;  5E3R A;  2V0J A;  3MC4 A;  3IGJ A;  3VNP A;  3JQY A;  3R2W A;  1GG4 A;  4G87 A;  1HV9 A;  1G97 A;  3BSY A;  1QRM A;  5AFU V;  2ICX A;  1SST A;  2QKX A;  3VBL A;  3FOQ A;  3GOS A;  3T57 A;  2JF3 A;  5E3P A;  1KK6 A;  3BRK X;  4G3S A;  3FSB A;  2WLD A;  3D98 A;  2IUA A;  3EEV A;  3PMO A;  4N27 A;  4EA8 A;  4DCL A;  2IU8 A;  4N6B A;  1QRF A;  5AFU U;  4QF5 A;  2XJA A;  1KK5 A;  3VBJ A;  4G3P A;  2P2O A;  3R5B A;  4R7P A;  2V0L A;  2IU9 A;  3R5A A;  5DG3 A;  3R5D A;  2FKO A;  3CJ8 A;  3OW5 A;  3DHO A;  5DEP A;  4AA7 A;  2OI6 A;  3VBI A;  2QIV X;  4MYO A;  4EGG A;  3ZL8 A;  3BXY A;  1V3W A;  4EA7 A;  1MRL A;  4R36 A;  5L6S A;  4J09 A;  4EA9 A;  3VBM A;  5U2K A;  3C8V A;  4N69 A;  1LXA A;  4ZIY A;  2OEF A;  1YP3 A;  4EAA A;  3OU9 A;  3EG4 A;  3FSX A;  3Q1X A;  3SPT A;  4C13 A;  2IC7 A;  3OTM A;  4M98 A;  1HM8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...