2IUAA

C. trachomatis lpxd
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
346
structure length
346
Chain Sequence
MSQSTYSLEQLADFLKVEFQGNGATLLSGVEEIEEAKTAHITFLDNEKYAKHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPVDSGFPGIHPTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIGAYSTVGEHSYIHPRVVIRERVSIGKRVIIQPGAVIGSCGFGYVTSAFGQHKHLKHLGKVIIEDDVEIGANTTIDRGRFKHSVVREGSKIDNLVQIAHQVEVGQHSMIVAQAGIAGSTKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHRQVAKVRNLPRLEERIAALEKLVQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE
publication title Structure and Reactivity of Lpxd, the N-Acyltransferase of Lipid a Biosynthesis
pubmed doi rcsb
source organism Chlamydia trachomatis
total genus 110
structure length 346
sequence length 346
chains with identical sequence B, C
ec nomenclature ec 2.3.1.-:
pdb deposition date 2006-05-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 2iuaA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 2iuaA01
4KPXA 3DHOA 3MQHA 3MC4A 1KRVA 3TK8A 4QDIA 2OI6A 3CJ8A 3IXCA 2Q4JA 2GGQA 4R36A 5ADXV 4N6BA 1S80A 3ECTA 4E6TA 1V67A 2V0HA 3GUEA 4EA8A 2V0LA 3OTZA 1KRRA 3TDTA 3FOQA 1E8CA 4EA7A 1J2ZA 3F1XA 5AFUV 1QRLA 2I5KA 3TIOA 2NPOA 4G3SA 4KNRA 4AA7A 1KGTA 3ST8A 4G3PA 1FWYA 5L6SA 3R5CA 3FS8A 2OI5A 1YP3A 2ICYA 4ISXA 5U2KA 1QRMA 2IC7A 3VBMA 3R0SA 4N69A 1KK5A 5E3QA 3ZM5A 4E79A 4KQLA 5F42A 3FSYA 4MZUA 3D8VA 4E6UA 2AM2A 4AAWA 1G95A 2FKOA 4N6AA 3BSSA 3FSXA 3R1WA 4HCQA 4HURA 1QRFA 4M2AA 1Z90A 1TDTA 4KPZA 1SSQA 4HZDA 2JF3A 3NZ2A 4MFGA 4HUSA 4M99A 3OW5A 1MRLA 3EG4A 4M2BA 2W0WA 3D98A 3R5AA 3TV0A 3I3XA 5ADXU 3HSQA 5E3RA 4CVKA 1OCXA 4KNXA 4M28A 1T3DA 2WLEA 2WTZA 3OTMA 3ZL8A 3KWCA 3R3RA 3DJ4A 3T57A 2VHEA 2OEFA 1MR7A 3BRKX 4QF5A 2WLCA 3SRTA 1KK6A 5E3PA 2QIVX 4EA9A 3PMOA 2IU8A 3FSCA 3P47A 4G3QA 3TISA 4AC3A 4MYOA 5AFUU 4BUBA 4H7OA 1THJA 3GVDA 3FWWA 2IU9A 2JF2A 2QKXA 3MQGA 2AM1A 1QQ0A 4IHGA 3VBLA 4K6RA 2W0VA 3R5BA 1KRUA 1KK4A 1SSMA 2VD4A 1KGQA 4M9CA 3TWDA 3R2WA 1V3WA 4C12A 5DEPA 3V4EA 2P2OA 1QREA 2TDTA 1G97A 2WLGA 4N27A 4J09A 5DEMA 1HM8A 3VNPA 3OU9A 2GGOA 3KWEA 3EH0A 2IUAA 3OUPA 3BFPA 3KWDA 2WLFA 2OEGA 4R37A 5L6VA 4EAAA 3FTTA 3R3IA 4E75A 4IHFA 3BSWA 3DK5A 3IGJA 4HZCA 1HM9A 4CVLA 4EQYA 4J18A 3ZM6A 2V0JA 3VBJA 4FCEA 4ZIYA 1XATA 3BXYA 3EEVA 3GOSA 4C13A 4M98A 1XHDA 2ICXA 3SPTA 2QIAA 3VBKA 3JQYA 1YP4A 1KQAA 3VBPA 1HV9A 4CVMA 3P1BA 4EABA 2AQ9A 1LXAA 4EGGA 1GG4A 1MR9A 1YP2A 3C8VA 4R7PA 2XJAA 1FXJA 3VBNA 1SSTA 3VBIA 2V0IA 5DG3A 3R8YA 2WLDA 3Q1XA 1QRGA 3BSYA 2OI7A 3R5DA 4E1KA 4IHHA 1HM0A 3FSBA 4G87A 2XATA 3I3AA 1KHRA 3HJJA 4DCLA 2V0KA 2RIJA
chains in the Genus database with same CATH superfamily
3GQ8A 4KPXA 3WSEA 3DHOA 3MQHA 3MC4A 1KRVA 3TK8A 3WSIA 4QDIA 4IWMA 3WSGA 2OI6A 3CJ8A 3IXCA 2Q4JA 2GGQA 4R36A 5ADXV 4N6BA 1NMPA 1S80A 3ECTA 4E6TA 1V67A 2V0HA 3GUEA 4EA8A 2V0LA 1NMOA 4IWGA 3OH3A 3OTZA 1EWWA 1KRRA 3TDTA 3FOQA 1E8CA 4EA7A 1J2ZA 3F1XA 5AFUV 1QRLA 2I5KA 3TIOA 2NPOA 4G3SA 4KNRA 4AA7A 1KGTA 3ST8A 4G3PA 1FWYA 5L6SA 3R5CA 3FS8A 2OI5A 1YP3A 2ICYA 4ISXA 5U2KA 3WSHA 1QRMA 2IC7A 3SUCA 3VBMA 3OH2A 3R0SA 4N69A 1KK5A 5E3QA 3ZM5A 4E79A 4KQLA 5F42A 3FSYA 4MZUA 3D8VA 4E6UA 2AM2A 4AAWA 1G95A 2FKOA 4N6AA 3WSFA 1L0SA 3BSSA 3FSXA 3R1WA 4HCQA 4HURA 1QRFA 4M2AA 1Z90A 1TDTA 1Z2FA 1SSQA 4KPZA 4HZDA 2JF3A 3NZ2A 4MFGA 1KO7A 4HUSA 3EEQA 4M99A 3OW5A 1MRLA 3EG4A 4M2BA 2W0WA 3D98A 3R5AA 3TV0A 3I3XA 3OGZA 5ADXU 3HSQA 5E3RA 4CVKA 1OCXA 4KNXA 4M28A 1T3DA 2WLEA 2WTZA 3OTMA 3ZL8A 2FYWA 3KWCA 3R3RA 2YYBA 3DJ4A 3T57A 2VHEA 2OEFA 1MR7A 1M8NA 3BRKX 4QF5A 2WLCA 3GQ9A 3SRTA 1KK6A 5E3PA 2QIVX 4EA9A 3PMOA 2IU8A 3FSCA 3P47A 4G3QA 3TISA 4AC3A 4MYOA 5AFUU 4BUBA 4H7OA 3OH1A 1THJA 3GVDA 3FWWA 2IU9A 2JF2A 2QKXA 3MQGA 2AM1A 1QQ0A 4IHGA 3VBLA 4K6RA 2W0VA 3R5BA 1KRUA 1KK4A 1SSMA 2VD4A 1KGQA 4M9CA 3TWDA 3R2WA 1V3WA 2IOJA 4C12A 5DEPA 3V4EA 2P2OA 1QREA 2TDTA 1G97A 2WLGA 4N27A 4J09A 5DEMA 1HM8A 3VNPA 3OU9A 2GGOA 3KWEA 3EH0A 2IUAA 3OUPA 3BFPA 3KWDA 3GQ7A 2WLFA 4DCLA 2OEGA 4R37A 5L6VA 4EAAA 3FTTA 3R3IA 4E75A 4IHFA 3BSWA 3DK5A 3IGJA 4HZCA 1HM9A 3OH4A 4EQYA 4CVLA 4J18A 3ZM6A 2V0JA 3VBJA 4FCEA 4ZIYA 1XATA 3BXYA 3EEVA 3GOSA 4C13A 4M98A 1XHDA 2ICXA 3SPTA 2QIAA 3VBKA 3JQYA 1YP4A 1KQAA 3VBPA 1HV9A 4CVMA 3P1BA 4EABA 2AQ9A 1LXAA 3GQAA 4EGGA 1GG4A 1MR9A 1YP2A 3C8VA 4R7PA 2XJAA 3WSDA 1FXJA 3VBNA 1SSTA 3VBIA 3L31A 2V0IA 5DG3A 3R8YA 2WLDA 3Q1XA 1QRGA 3BSYA 2OI7A 3R5DA 4E1KA 4IHHA 1HM0A 3FSBA 4G87A 2XATA 3L2BA 3I3AA 3OH0A 1KHRA 3HJJA 1KNXA 1N4IA 2V0KA 2RIJA
chains in the Genus database with same CATH topology
4KPXA 3DHOA 3MQHA 3MC4A 1KRVA 3TK8A 4QDIA 2OI6A 3CJ8A 3IXCA 2Q4JA 2GGQA 4R36A 5ADXV 4N6BA 1S80A 3ECTA 4E6TA 1V67A 2V0HA 3GUEA 4EA8A 2V0LA 3OTZA 1KRRA 3TDTA 3FOQA 1E8CA 4EA7A 1J2ZA 3F1XA 5AFUV 1QRLA 2I5KA 3TIOA 2NPOA 4G3SA 4KNRA 4AA7A 1KGTA 3ST8A 4G3PA 1FWYA 5L6SA 3R5CA 3FS8A 2OI5A 1YP3A 2ICYA 4ISXA 5U2KA 1QRMA 2IC7A 3VBMA 3R0SA 4N69A 1KK5A 5E3QA 3ZM5A 4E79A 4KQLA 5F42A 3FSYA 4MZUA 3D8VA 4E6UA 2AM2A 4AAWA 1G95A 2FKOA 4N6AA 3BSSA 3FSXA 3R1WA 4HCQA 4HURA 1QRFA 4M2AA 1Z90A 1TDTA 4KPZA 1SSQA 4HZDA 2JF3A 3NZ2A 4MFGA 4HUSA 4M99A 3OW5A 1MRLA 3EG4A 4M2BA 2W0WA 3D98A 3R5AA 3TV0A 3I3XA 5ADXU 3HSQA 5E3RA 4CVKA 1OCXA 4KNXA 4M28A 1T3DA 2WLEA 2WTZA 3OTMA 3ZL8A 3KWCA 3R3RA 3DJ4A 3T57A 2VHEA 2OEFA 1MR7A 3BRKX 4QF5A 2WLCA 3SRTA 1KK6A 5E3PA 2QIVX 4EA9A 3PMOA 2IU8A 3FSCA 3P47A 4G3QA 3TISA 4AC3A 4MYOA 5AFUU 4BUBA 4H7OA 1THJA 3GVDA 3FWWA 2IU9A 2JF2A 2QKXA 3MQGA 2AM1A 1QQ0A 4IHGA 3VBLA 4K6RA 2W0VA 3R5BA 1KRUA 1KK4A 1SSMA 2VD4A 1KGQA 4M9CA 3TWDA 3R2WA 1V3WA 4C12A 5DEPA 3V4EA 2P2OA 1QREA 2TDTA 1G97A 2WLGA 4N27A 4J09A 5DEMA 1HM8A 3VNPA 3OU9A 2GGOA 3KWEA 3EH0A 2IUAA 3OUPA 3BFPA 3KWDA 2WLFA 2OEGA 4R37A 5L6VA 4EAAA 3FTTA 3R3IA 4E75A 4IHFA 3BSWA 3DK5A 3IGJA 4HZCA 1HM9A 4CVLA 4EQYA 4J18A 3ZM6A 2V0JA 3VBJA 4FCEA 4ZIYA 1XATA 3BXYA 3EEVA 3GOSA 4C13A 4M98A 1XHDA 2ICXA 3SPTA 2QIAA 3VBKA 3JQYA 1YP4A 1KQAA 3VBPA 1HV9A 4CVMA 3P1BA 4EABA 2AQ9A 1LXAA 4EGGA 1GG4A 1MR9A 1YP2A 3C8VA 4R7PA 2XJAA 1FXJA 3VBNA 1SSTA 3VBIA 2V0IA 5DG3A 3R8YA 2WLDA 3Q1XA 1QRGA 3BSYA 2OI7A 3R5DA 4E1KA 4IHHA 1HM0A 3FSBA 4G87A 2XATA 3I3AA 1KHRA 3HJJA 4DCLA 2V0KA 2RIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KPX A;  3DHO A;  3MQH A;  3MC4 A;  1KRV A;  3TK8 A;  4QDI A;  2OI6 A;  3CJ8 A;  3IXC A;  2Q4J A;  2GGQ A;  4R36 A;  5ADX V;  4N6B A;  1S80 A;  3ECT A;  4E6T A;  1V67 A;  2V0H A;  3GUE A;  4EA8 A;  2V0L A;  3OTZ A;  1KRR A;  3TDT A;  3FOQ A;  1E8C A;  4EA7 A;  1J2Z A;  3F1X A;  5AFU V;  1QRL A;  2I5K A;  3TIO A;  2NPO A;  4G3S A;  4KNR A;  4AA7 A;  1KGT A;  3ST8 A;  4G3P A;  1FWY A;  5L6S A;  3R5C A;  3FS8 A;  2OI5 A;  1YP3 A;  2ICY A;  4ISX A;  5U2K A;  1QRM A;  2IC7 A;  3VBM A;  3R0S A;  4N69 A;  1KK5 A;  5E3Q A;  3ZM5 A;  4E79 A;  4KQL A;  5F42 A;  3FSY A;  4MZU A;  3D8V A;  4E6U A;  2AM2 A;  4AAW A;  1G95 A;  2FKO A;  4N6A A;  3BSS A;  3FSX A;  3R1W A;  4HCQ A;  4HUR A;  1QRF A;  4M2A A;  1Z90 A;  1TDT A;  4KPZ A;  1SSQ A;  4HZD A;  2JF3 A;  3NZ2 A;  4MFG A;  4HUS A;  4M99 A;  3OW5 A;  1MRL A;  3EG4 A;  4M2B A;  2W0W A;  3D98 A;  3R5A A;  3TV0 A;  3I3X A;  5ADX U;  3HSQ A;  5E3R A;  4CVK A;  1OCX A;  4KNX A;  4M28 A;  1T3D A;  2WLE A;  2WTZ A;  3OTM A;  3ZL8 A;  3KWC A;  3R3R A;  3DJ4 A;  3T57 A;  2VHE A;  2OEF A;  1MR7 A;  3BRK X;  4QF5 A;  2WLC A;  3SRT A;  1KK6 A;  5E3P A;  2QIV X;  4EA9 A;  3PMO A;  2IU8 A;  3FSC A;  3P47 A;  4G3Q A;  3TIS A;  4AC3 A;  4MYO A;  5AFU U;  4BUB A;  4H7O A;  1THJ A;  3GVD A;  3FWW A;  2IU9 A;  2JF2 A;  2QKX A;  3MQG A;  2AM1 A;  1QQ0 A;  4IHG A;  3VBL A;  4K6R A;  2W0V A;  3R5B A;  1KRU A;  1KK4 A;  1SSM A;  2VD4 A;  1KGQ A;  4M9C A;  3TWD A;  3R2W A;  1V3W A;  4C12 A;  5DEP A;  3V4E A;  2P2O A;  1QRE A;  2TDT A;  1G97 A;  2WLG A;  4N27 A;  4J09 A;  5DEM A;  1HM8 A;  3VNP A;  3OU9 A;  2GGO A;  3KWE A;  3EH0 A;  2IUA A;  3OUP A;  3BFP A;  3KWD A;  2WLF A;  2OEG A;  4R37 A;  5L6V A;  4EAA A;  3FTT A;  3R3I A;  4E75 A;  4IHF A;  3BSW A;  3DK5 A;  3IGJ A;  4HZC A;  1HM9 A;  4CVL A;  4EQY A;  4J18 A;  3ZM6 A;  2V0J A;  3VBJ A;  4FCE A;  4ZIY A;  1XAT A;  3BXY A;  3EEV A;  3GOS A;  4C13 A;  4M98 A;  1XHD A;  2ICX A;  3SPT A;  2QIA A;  3VBK A;  3JQY A;  1YP4 A;  1KQA A;  3VBP A;  1HV9 A;  4CVM A;  3P1B A;  4EAB A;  2AQ9 A;  1LXA A;  4EGG A;  1GG4 A;  1MR9 A;  1YP2 A;  3C8V A;  4R7P A;  2XJA A;  1FXJ A;  3VBN A;  1SST A;  3VBI A;  2V0I A;  5DG3 A;  3R8Y A;  2WLD A;  3Q1X A;  1QRG A;  3BSY A;  2OI7 A;  3R5D A;  4E1K A;  4IHH A;  1HM0 A;  3FSB A;  4G87 A;  2XAT A;  3I3A A;  1KHR A;  3HJJ A;  4DCL A;  2V0K A;  2RIJ A; 
#chains in the Genus database with same CATH topology
 3GQ8 A;  4KPX A;  3WSE A;  3DHO A;  3MQH A;  3MC4 A;  1KRV A;  3TK8 A;  3WSI A;  4QDI A;  4IWM A;  3WSG A;  2OI6 A;  3CJ8 A;  3IXC A;  2Q4J A;  2GGQ A;  4R36 A;  5ADX V;  4N6B A;  1NMP A;  1S80 A;  3ECT A;  4E6T A;  1V67 A;  2V0H A;  3GUE A;  4EA8 A;  2V0L A;  1NMO A;  4IWG A;  3OH3 A;  3OTZ A;  1EWW A;  1KRR A;  3TDT A;  3FOQ A;  1E8C A;  4EA7 A;  1J2Z A;  3F1X A;  5AFU V;  1QRL A;  2I5K A;  3TIO A;  2NPO A;  4G3S A;  4KNR A;  4AA7 A;  1KGT A;  3ST8 A;  4G3P A;  1FWY A;  5L6S A;  3R5C A;  3FS8 A;  2OI5 A;  1YP3 A;  2ICY A;  4ISX A;  5U2K A;  3WSH A;  1QRM A;  2IC7 A;  3SUC A;  3VBM A;  3OH2 A;  3R0S A;  4N69 A;  1KK5 A;  5E3Q A;  3ZM5 A;  4E79 A;  4KQL A;  5F42 A;  3FSY A;  4MZU A;  3D8V A;  4E6U A;  2AM2 A;  4AAW A;  1G95 A;  2FKO A;  4N6A A;  3WSF A;  1L0S A;  3BSS A;  3FSX A;  3R1W A;  4HCQ A;  4HUR A;  1QRF A;  4M2A A;  1Z90 A;  1TDT A;  1Z2F A;  1SSQ A;  4KPZ A;  4HZD A;  2JF3 A;  3NZ2 A;  4MFG A;  1KO7 A;  4HUS A;  3EEQ A;  4M99 A;  3OW5 A;  1MRL A;  3EG4 A;  4M2B A;  2W0W A;  3D98 A;  3R5A A;  3TV0 A;  3I3X A;  3OGZ A;  5ADX U;  3HSQ A;  5E3R A;  4CVK A;  1OCX A;  4KNX A;  4M28 A;  1T3D A;  2WLE A;  2WTZ A;  3OTM A;  3ZL8 A;  2FYW A;  3KWC A;  3R3R A;  2YYB A;  3DJ4 A;  3T57 A;  2VHE A;  2OEF A;  1MR7 A;  1M8N A;  3BRK X;  4QF5 A;  2WLC A;  3GQ9 A;  3SRT A;  1KK6 A;  5E3P A;  2QIV X;  4EA9 A;  3PMO A;  2IU8 A;  3FSC A;  3P47 A;  4G3Q A;  3TIS A;  4AC3 A;  4MYO A;  5AFU U;  4BUB A;  4H7O A;  3OH1 A;  1THJ A;  3GVD A;  3FWW A;  2IU9 A;  2JF2 A;  2QKX A;  3MQG A;  2AM1 A;  1QQ0 A;  4IHG A;  3VBL A;  4K6R A;  2W0V A;  3R5B A;  1KRU A;  1KK4 A;  1SSM A;  2VD4 A;  1KGQ A;  4M9C A;  3TWD A;  3R2W A;  1V3W A;  2IOJ A;  4C12 A;  5DEP A;  3V4E A;  2P2O A;  1QRE A;  2TDT A;  1G97 A;  2WLG A;  4N27 A;  4J09 A;  5DEM A;  1HM8 A;  3VNP A;  3OU9 A;  2GGO A;  3KWE A;  3EH0 A;  2IUA A;  3OUP A;  3BFP A;  3KWD A;  3GQ7 A;  2WLF A;  4DCL A;  2OEG A;  4R37 A;  5L6V A;  4EAA A;  3FTT A;  3R3I A;  4E75 A;  4IHF A;  3BSW A;  3DK5 A;  3IGJ A;  4HZC A;  1HM9 A;  3OH4 A;  4EQY A;  4CVL A;  4J18 A;  3ZM6 A;  2V0J A;  3VBJ A;  4FCE A;  4ZIY A;  1XAT A;  3BXY A;  3EEV A;  3GOS A;  4C13 A;  4M98 A;  1XHD A;  2ICX A;  3SPT A;  2QIA A;  3VBK A;  3JQY A;  1YP4 A;  1KQA A;  3VBP A;  1HV9 A;  4CVM A;  3P1B A;  4EAB A;  2AQ9 A;  1LXA A;  3GQA A;  4EGG A;  1GG4 A;  1MR9 A;  1YP2 A;  3C8V A;  4R7P A;  2XJA A;  3WSD A;  1FXJ A;  3VBN A;  1SST A;  3VBI A;  3L31 A;  2V0I A;  5DG3 A;  3R8Y A;  2WLD A;  3Q1X A;  1QRG A;  3BSY A;  2OI7 A;  3R5D A;  4E1K A;  4IHH A;  1HM0 A;  3FSB A;  4G87 A;  2XAT A;  3L2B A;  3I3A A;  3OH0 A;  1KHR A;  3HJJ A;  1KNX A;  1N4I A;  2V0K A;  2RIJ A; 
#chains in the Genus database with same CATH homology
 4KPX A;  3DHO A;  3MQH A;  3MC4 A;  1KRV A;  3TK8 A;  4QDI A;  2OI6 A;  3CJ8 A;  3IXC A;  2Q4J A;  2GGQ A;  4R36 A;  5ADX V;  4N6B A;  1S80 A;  3ECT A;  4E6T A;  1V67 A;  2V0H A;  3GUE A;  4EA8 A;  2V0L A;  3OTZ A;  1KRR A;  3TDT A;  3FOQ A;  1E8C A;  4EA7 A;  1J2Z A;  3F1X A;  5AFU V;  1QRL A;  2I5K A;  3TIO A;  2NPO A;  4G3S A;  4KNR A;  4AA7 A;  1KGT A;  3ST8 A;  4G3P A;  1FWY A;  5L6S A;  3R5C A;  3FS8 A;  2OI5 A;  1YP3 A;  2ICY A;  4ISX A;  5U2K A;  1QRM A;  2IC7 A;  3VBM A;  3R0S A;  4N69 A;  1KK5 A;  5E3Q A;  3ZM5 A;  4E79 A;  4KQL A;  5F42 A;  3FSY A;  4MZU A;  3D8V A;  4E6U A;  2AM2 A;  4AAW A;  1G95 A;  2FKO A;  4N6A A;  3BSS A;  3FSX A;  3R1W A;  4HCQ A;  4HUR A;  1QRF A;  4M2A A;  1Z90 A;  1TDT A;  4KPZ A;  1SSQ A;  4HZD A;  2JF3 A;  3NZ2 A;  4MFG A;  4HUS A;  4M99 A;  3OW5 A;  1MRL A;  3EG4 A;  4M2B A;  2W0W A;  3D98 A;  3R5A A;  3TV0 A;  3I3X A;  5ADX U;  3HSQ A;  5E3R A;  4CVK A;  1OCX A;  4KNX A;  4M28 A;  1T3D A;  2WLE A;  2WTZ A;  3OTM A;  3ZL8 A;  3KWC A;  3R3R A;  3DJ4 A;  3T57 A;  2VHE A;  2OEF A;  1MR7 A;  3BRK X;  4QF5 A;  2WLC A;  3SRT A;  1KK6 A;  5E3P A;  2QIV X;  4EA9 A;  3PMO A;  2IU8 A;  3FSC A;  3P47 A;  4G3Q A;  3TIS A;  4AC3 A;  4MYO A;  5AFU U;  4BUB A;  4H7O A;  1THJ A;  3GVD A;  3FWW A;  2IU9 A;  2JF2 A;  2QKX A;  3MQG A;  2AM1 A;  1QQ0 A;  4IHG A;  3VBL A;  4K6R A;  2W0V A;  3R5B A;  1KRU A;  1KK4 A;  1SSM A;  2VD4 A;  1KGQ A;  4M9C A;  3TWD A;  3R2W A;  1V3W A;  4C12 A;  5DEP A;  3V4E A;  2P2O A;  1QRE A;  2TDT A;  1G97 A;  2WLG A;  4N27 A;  4J09 A;  5DEM A;  1HM8 A;  3VNP A;  3OU9 A;  2GGO A;  3KWE A;  3EH0 A;  2IUA A;  3OUP A;  3BFP A;  3KWD A;  2WLF A;  2OEG A;  4R37 A;  5L6V A;  4EAA A;  3FTT A;  3R3I A;  4E75 A;  4IHF A;  3BSW A;  3DK5 A;  3IGJ A;  4HZC A;  1HM9 A;  4CVL A;  4EQY A;  4J18 A;  3ZM6 A;  2V0J A;  3VBJ A;  4FCE A;  4ZIY A;  1XAT A;  3BXY A;  3EEV A;  3GOS A;  4C13 A;  4M98 A;  1XHD A;  2ICX A;  3SPT A;  2QIA A;  3VBK A;  3JQY A;  1YP4 A;  1KQA A;  3VBP A;  1HV9 A;  4CVM A;  3P1B A;  4EAB A;  2AQ9 A;  1LXA A;  4EGG A;  1GG4 A;  1MR9 A;  1YP2 A;  3C8V A;  4R7P A;  2XJA A;  1FXJ A;  3VBN A;  1SST A;  3VBI A;  2V0I A;  5DG3 A;  3R8Y A;  2WLD A;  3Q1X A;  1QRG A;  3BSY A;  2OI7 A;  3R5D A;  4E1K A;  4IHH A;  1HM0 A;  3FSB A;  4G87 A;  2XAT A;  3I3A A;  1KHR A;  3HJJ A;  4DCL A;  2V0K A;  2RIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...