4IHGA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
334
Chain Sequence
HASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/lipid binding protein
molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
total genus 104
structure length 334
sequence length 334
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihgA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihgA01
2VD4A 4HCQA 4EA7A 3I3AA 3VBLA 5AFUU 4ZIYA 2WTZA 5DG3A 3KWCA 4R7PA 3F1XA 4HURA 1E8CA 1XATA 1OCXA 3FSXA 3ST8A 2AM1A 1QRFA 4N6AA 5DEPA 3BFPA 4IHGA 1QQ0A 3NZ2A 4J09A 4R37A 5AFUV 4H7OA 4K6RA 1LXAA 2V0HA 3R3RA 1KK5A 5DEMA 1KGTA 3ZL8A 3VNPA 3VBIA 3D8VA 1Z90A 2GGQA 1KRRA 4FCEA 4M9CA 3IGJA 4EABA 2ICXA 3CJ8A 1KRUA 4EA8A 4G3SA 2V0IA 2QIAA 3JQYA 2V0KA 1XHDA 3P1BA 3HSQA 3OUPA 1YP2A 3FOQA 4J18A 2IU9A 1MRLA 1QRMA 1KQAA 3BSWA 3R5AA 3VBNA 3VBJA 2V0JA 1FXJA 3EEVA 4EQYA 2I5KA 3V4EA 1KK6A 1THJA 4E6TA 3OW5A 4BUBA 1QRGA 3ECTA 4G3QA 2W0WA 3Q1XA 3P47A 3BXYA 2WLDA 5E3RA 3TIOA 2P2OA 2ICYA 3SPTA 2OI6A 2JF3A 1T3DA 4E1KA 5ADXU 3ZM5A 4AAWA 1YP3A 2TDTA 4DCLA 4HZDA 4N69A 4MFGA 4EAAA 5E3PA 3TV0A 2JF2A 2VHEA 3DK5A 3R8YA 4CVKA 3BSYA 3DJ4A 5E3QA 4EA9A 4IHFA 5ADXV 5L6VA 4AA7A 3ZM6A 2WLGA 5F42A 3OTMA 4M28A 1J2ZA 1HM9A 3IXCA 3FSCA 3R5BA 1SSQA 1V67A 2WLFA 4QDIA 2OI5A 3R3IA 3BSSA 4E6UA 2AQ9A 3TWDA 3GUEA 4C12A 2RIJA 3D98A 3FWWA 5U2KA 3VBPA 3KWEA 2XJAA 3FS8A 4KQLA 4AC3A 4ISXA 2OEFA 1S80A 4G3PA 4N27A 4CVMA 1MR7A 3TK8A 3R0SA 1FWYA 4QF5A 3DHOA 4M2BA 5L6SA 1QRLA 2OI7A 2Q4JA 4G87A 3OU9A 3T57A 3OTZA 4KNRA 3TISA 4M98A 3KWDA 1SSMA 4M2AA 3R5CA 1GG4A 3C8VA 2FKOA 2QKXA 4MZUA 3VBKA 3R2WA 4MYOA 3PMOA 4KNXA 3FSBA 1YP4A 4E79A 2OEGA 3MC4A 2IC7A 2GGOA 2XATA 1HM8A 1MR9A 2NPOA 1HM0A 1SSTA 3FSYA 4HZCA 3R1WA 3SRTA 3I3XA 4HUSA 1KK4A 3GOSA 1KGQA 1HV9A 1KRVA 3R5DA 3HJJA 1G97A 2WLCA 4M99A 3VBMA 4CVLA 2V0LA 4E75A 4IHHA 2IU8A 2QIVX 2AM2A 2WLEA 2W0VA 4R36A 4EGGA 4KPXA 3TDTA 3MQHA 1QREA 1V3WA 1TDTA 3BRKX 3FTTA 4KPZA 2IUAA 3MQGA 1KHRA 4N6BA 1G95A 3GVDA 4C13A 3EH0A 3EG4A
chains in the Genus database with same CATH superfamily
2VD4A 4HCQA 4EA7A 3I3AA 3VBLA 5AFUU 4ZIYA 4IWGA 2WTZA 5DG3A 3KWCA 4R7PA 3F1XA 4HURA 1E8CA 1XATA 1OCXA 3FSXA 3ST8A 2AM1A 1QRFA 4N6AA 5DEPA 3BFPA 4IHGA 1QQ0A 3NZ2A 4J09A 4R37A 5AFUV 4H7OA 4K6RA 1LXAA 2V0HA 3R3RA 1KK5A 3GQ7A 5DEMA 1KGTA 3ZL8A 3VNPA 3VBIA 3D8VA 3GQ8A 1Z90A 2GGQA 1KRRA 4FCEA 4M9CA 3IGJA 4EABA 2ICXA 3CJ8A 1KRUA 4EA8A 4G3SA 2V0IA 2QIAA 3JQYA 2V0KA 1XHDA 3P1BA 3HSQA 3OUPA 1YP2A 3FOQA 4J18A 2IU9A 1MRLA 1QRMA 1KQAA 3BSWA 3R5AA 3VBNA 2YYBA 3WSFA 3VBJA 3WSDA 2V0JA 1FXJA 3EEVA 4EQYA 2I5KA 3V4EA 1KK6A 1THJA 4E6TA 1NMOA 3OW5A 4BUBA 1QRGA 3ECTA 4G3QA 2W0WA 3Q1XA 3P47A 3BXYA 2WLDA 5E3RA 3TIOA 2P2OA 2ICYA 3SPTA 2OI6A 2JF3A 1T3DA 4E1KA 5ADXU 3ZM5A 4AAWA 1YP3A 2TDTA 4DCLA 4HZDA 4N69A 4MFGA 4EAAA 5E3PA 3TV0A 3OH3A 3SUCA 2JF2A 2VHEA 3DK5A 3R8YA 1L0SA 4CVKA 3BSYA 3DJ4A 5E3QA 4EA9A 4IHFA 5ADXV 5L6VA 4AA7A 3ZM6A 3OH4A 2WLGA 3OGZA 1EWWA 5F42A 2FYWA 3L2BA 3OTMA 4M28A 3WSHA 1J2ZA 1HM9A 3IXCA 3FSCA 3R5BA 1NMPA 1SSQA 3WSEA 1V67A 2WLFA 3OH1A 4QDIA 2OI5A 3WSGA 3R3IA 3EEQA 3BSSA 4E6UA 2AQ9A 3TWDA 3GUEA 4C12A 1KNXA 2RIJA 3D98A 3FWWA 5U2KA 3VBPA 3KWEA 2XJAA 3FS8A 4KQLA 4AC3A 1Z2FA 4ISXA 2OEFA 1S80A 4G3PA 4N27A 4CVMA 1MR7A 3TK8A 3OH0A 3R0SA 1FWYA 4QF5A 1N4IA 3DHOA 4M2BA 5L6SA 1QRLA 4IWMA 2OI7A 2Q4JA 4G87A 3OU9A 3T57A 3OTZA 3GQ9A 4KNRA 3TISA 4M98A 3KWDA 1SSMA 3GQAA 3R5CA 4M2AA 1GG4A 3C8VA 2FKOA 2QKXA 4MZUA 3WSIA 3VBKA 3R2WA 4MYOA 3PMOA 4KNXA 3FSBA 1YP4A 4E79A 2OEGA 3MC4A 2IC7A 1KO7A 2GGOA 2XATA 1HM8A 1MR9A 2NPOA 2IOJA 1HM0A 1SSTA 3FSYA 4HZCA 3R1WA 3SRTA 3I3XA 4HUSA 1KK4A 3GOSA 1KGQA 1HV9A 1KRVA 3R5DA 3HJJA 1G97A 2WLCA 1M8NA 3OH2A 4M99A 3VBMA 4CVLA 2V0LA 4E75A 4IHHA 2IU8A 2QIVX 2AM2A 2WLEA 2W0VA 4R36A 4EGGA 4KPXA 3TDTA 3MQHA 1QREA 1V3WA 1TDTA 3BRKX 3FTTA 4KPZA 2IUAA 3MQGA 1KHRA 4N6BA 1G95A 3GVDA 4C13A 3EH0A 3L31A 3EG4A
chains in the Genus database with same CATH topology
2VD4A 4HCQA 4EA7A 3I3AA 3VBLA 5AFUU 4ZIYA 2WTZA 5DG3A 3KWCA 4R7PA 3F1XA 4HURA 1E8CA 1XATA 1OCXA 3FSXA 3ST8A 2AM1A 1QRFA 4N6AA 5DEPA 3BFPA 4IHGA 1QQ0A 3NZ2A 4J09A 4R37A 5AFUV 4H7OA 4K6RA 1LXAA 2V0HA 3R3RA 1KK5A 5DEMA 1KGTA 3ZL8A 3VNPA 3VBIA 3D8VA 1Z90A 2GGQA 1KRRA 4FCEA 4M9CA 3IGJA 4EABA 2ICXA 3CJ8A 1KRUA 4EA8A 4G3SA 2V0IA 2QIAA 3JQYA 2V0KA 1XHDA 3P1BA 3HSQA 3OUPA 1YP2A 3FOQA 4J18A 2IU9A 1MRLA 1QRMA 1KQAA 3BSWA 3R5AA 3VBNA 3VBJA 2V0JA 1FXJA 3EEVA 4EQYA 2I5KA 3V4EA 1KK6A 1THJA 4E6TA 3OW5A 4BUBA 1QRGA 3ECTA 4G3QA 2W0WA 3Q1XA 3P47A 3BXYA 2WLDA 5E3RA 3TIOA 2P2OA 2ICYA 3SPTA 2OI6A 2JF3A 1T3DA 4E1KA 5ADXU 3ZM5A 4AAWA 1YP3A 2TDTA 4DCLA 4HZDA 4N69A 4MFGA 4EAAA 5E3PA 3TV0A 2JF2A 2VHEA 3DK5A 3R8YA 4CVKA 3BSYA 3DJ4A 5E3QA 4EA9A 4IHFA 5ADXV 5L6VA 4AA7A 3ZM6A 2WLGA 5F42A 3OTMA 4M28A 1J2ZA 1HM9A 3IXCA 3FSCA 3R5BA 1SSQA 1V67A 2WLFA 4QDIA 2OI5A 3R3IA 3BSSA 4E6UA 2AQ9A 3TWDA 3GUEA 4C12A 2RIJA 3D98A 3FWWA 5U2KA 3VBPA 3KWEA 2XJAA 3FS8A 4KQLA 4AC3A 4ISXA 2OEFA 1S80A 4G3PA 4N27A 4CVMA 1MR7A 3TK8A 3R0SA 1FWYA 4QF5A 3DHOA 4M2BA 5L6SA 1QRLA 2OI7A 2Q4JA 4G87A 3OU9A 3T57A 3OTZA 4KNRA 3TISA 4M98A 3KWDA 1SSMA 4M2AA 3R5CA 1GG4A 3C8VA 2FKOA 2QKXA 4MZUA 3VBKA 3R2WA 4MYOA 3PMOA 4KNXA 3FSBA 1YP4A 4E79A 2OEGA 3MC4A 2IC7A 2GGOA 2XATA 1HM8A 1MR9A 2NPOA 1HM0A 1SSTA 3FSYA 4HZCA 3R1WA 3SRTA 3I3XA 4HUSA 1KK4A 3GOSA 1KGQA 1HV9A 1KRVA 3R5DA 3HJJA 1G97A 2WLCA 4M99A 3VBMA 4CVLA 2V0LA 4E75A 4IHHA 2IU8A 2QIVX 2AM2A 2WLEA 2W0VA 4R36A 4EGGA 4KPXA 3TDTA 3MQHA 1QREA 1V3WA 1TDTA 3BRKX 3FTTA 4KPZA 2IUAA 3MQGA 1KHRA 4N6BA 1G95A 3GVDA 4C13A 3EH0A 3EG4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VD4 A;  4HCQ A;  4EA7 A;  3I3A A;  3VBL A;  5AFU U;  4ZIY A;  2WTZ A;  5DG3 A;  3KWC A;  4R7P A;  3F1X A;  4HUR A;  1E8C A;  1XAT A;  1OCX A;  3FSX A;  3ST8 A;  2AM1 A;  1QRF A;  4N6A A;  5DEP A;  3BFP A;  4IHG A;  1QQ0 A;  3NZ2 A;  4J09 A;  4R37 A;  5AFU V;  4H7O A;  4K6R A;  1LXA A;  2V0H A;  3R3R A;  1KK5 A;  5DEM A;  1KGT A;  3ZL8 A;  3VNP A;  3VBI A;  3D8V A;  1Z90 A;  2GGQ A;  1KRR A;  4FCE A;  4M9C A;  3IGJ A;  4EAB A;  2ICX A;  3CJ8 A;  1KRU A;  4EA8 A;  4G3S A;  2V0I A;  2QIA A;  3JQY A;  2V0K A;  1XHD A;  3P1B A;  3HSQ A;  3OUP A;  1YP2 A;  3FOQ A;  4J18 A;  2IU9 A;  1MRL A;  1QRM A;  1KQA A;  3BSW A;  3R5A A;  3VBN A;  3VBJ A;  2V0J A;  1FXJ A;  3EEV A;  4EQY A;  2I5K A;  3V4E A;  1KK6 A;  1THJ A;  4E6T A;  3OW5 A;  4BUB A;  1QRG A;  3ECT A;  4G3Q A;  2W0W A;  3Q1X A;  3P47 A;  3BXY A;  2WLD A;  5E3R A;  3TIO A;  2P2O A;  2ICY A;  3SPT A;  2OI6 A;  2JF3 A;  1T3D A;  4E1K A;  5ADX U;  3ZM5 A;  4AAW A;  1YP3 A;  2TDT A;  4DCL A;  4HZD A;  4N69 A;  4MFG A;  4EAA A;  5E3P A;  3TV0 A;  2JF2 A;  2VHE A;  3DK5 A;  3R8Y A;  4CVK A;  3BSY A;  3DJ4 A;  5E3Q A;  4EA9 A;  4IHF A;  5ADX V;  5L6V A;  4AA7 A;  3ZM6 A;  2WLG A;  5F42 A;  3OTM A;  4M28 A;  1J2Z A;  1HM9 A;  3IXC A;  3FSC A;  3R5B A;  1SSQ A;  1V67 A;  2WLF A;  4QDI A;  2OI5 A;  3R3I A;  3BSS A;  4E6U A;  2AQ9 A;  3TWD A;  3GUE A;  4C12 A;  2RIJ A;  3D98 A;  3FWW A;  5U2K A;  3VBP A;  3KWE A;  2XJA A;  3FS8 A;  4KQL A;  4AC3 A;  4ISX A;  2OEF A;  1S80 A;  4G3P A;  4N27 A;  4CVM A;  1MR7 A;  3TK8 A;  3R0S A;  1FWY A;  4QF5 A;  3DHO A;  4M2B A;  5L6S A;  1QRL A;  2OI7 A;  2Q4J A;  4G87 A;  3OU9 A;  3T57 A;  3OTZ A;  4KNR A;  3TIS A;  4M98 A;  3KWD A;  1SSM A;  4M2A A;  3R5C A;  1GG4 A;  3C8V A;  2FKO A;  2QKX A;  4MZU A;  3VBK A;  3R2W A;  4MYO A;  3PMO A;  4KNX A;  3FSB A;  1YP4 A;  4E79 A;  2OEG A;  3MC4 A;  2IC7 A;  2GGO A;  2XAT A;  1HM8 A;  1MR9 A;  2NPO A;  1HM0 A;  1SST A;  3FSY A;  4HZC A;  3R1W A;  3SRT A;  3I3X A;  4HUS A;  1KK4 A;  3GOS A;  1KGQ A;  1HV9 A;  1KRV A;  3R5D A;  3HJJ A;  1G97 A;  2WLC A;  4M99 A;  3VBM A;  4CVL A;  2V0L A;  4E75 A;  4IHH A;  2IU8 A;  2QIV X;  2AM2 A;  2WLE A;  2W0V A;  4R36 A;  4EGG A;  4KPX A;  3TDT A;  3MQH A;  1QRE A;  1V3W A;  1TDT A;  3BRK X;  3FTT A;  4KPZ A;  2IUA A;  3MQG A;  1KHR A;  4N6B A;  1G95 A;  3GVD A;  4C13 A;  3EH0 A;  3EG4 A; 
#chains in the Genus database with same CATH topology
 2VD4 A;  4HCQ A;  4EA7 A;  3I3A A;  3VBL A;  5AFU U;  4ZIY A;  4IWG A;  2WTZ A;  5DG3 A;  3KWC A;  4R7P A;  3F1X A;  4HUR A;  1E8C A;  1XAT A;  1OCX A;  3FSX A;  3ST8 A;  2AM1 A;  1QRF A;  4N6A A;  5DEP A;  3BFP A;  4IHG A;  1QQ0 A;  3NZ2 A;  4J09 A;  4R37 A;  5AFU V;  4H7O A;  4K6R A;  1LXA A;  2V0H A;  3R3R A;  1KK5 A;  3GQ7 A;  5DEM A;  1KGT A;  3ZL8 A;  3VNP A;  3VBI A;  3D8V A;  3GQ8 A;  1Z90 A;  2GGQ A;  1KRR A;  4FCE A;  4M9C A;  3IGJ A;  4EAB A;  2ICX A;  3CJ8 A;  1KRU A;  4EA8 A;  4G3S A;  2V0I A;  2QIA A;  3JQY A;  2V0K A;  1XHD A;  3P1B A;  3HSQ A;  3OUP A;  1YP2 A;  3FOQ A;  4J18 A;  2IU9 A;  1MRL A;  1QRM A;  1KQA A;  3BSW A;  3R5A A;  3VBN A;  2YYB A;  3WSF A;  3VBJ A;  3WSD A;  2V0J A;  1FXJ A;  3EEV A;  4EQY A;  2I5K A;  3V4E A;  1KK6 A;  1THJ A;  4E6T A;  1NMO A;  3OW5 A;  4BUB A;  1QRG A;  3ECT A;  4G3Q A;  2W0W A;  3Q1X A;  3P47 A;  3BXY A;  2WLD A;  5E3R A;  3TIO A;  2P2O A;  2ICY A;  3SPT A;  2OI6 A;  2JF3 A;  1T3D A;  4E1K A;  5ADX U;  3ZM5 A;  4AAW A;  1YP3 A;  2TDT A;  4DCL A;  4HZD A;  4N69 A;  4MFG A;  4EAA A;  5E3P A;  3TV0 A;  3OH3 A;  3SUC A;  2JF2 A;  2VHE A;  3DK5 A;  3R8Y A;  1L0S A;  4CVK A;  3BSY A;  3DJ4 A;  5E3Q A;  4EA9 A;  4IHF A;  5ADX V;  5L6V A;  4AA7 A;  3ZM6 A;  3OH4 A;  2WLG A;  3OGZ A;  1EWW A;  5F42 A;  2FYW A;  3L2B A;  3OTM A;  4M28 A;  3WSH A;  1J2Z A;  1HM9 A;  3IXC A;  3FSC A;  3R5B A;  1NMP A;  1SSQ A;  3WSE A;  1V67 A;  2WLF A;  3OH1 A;  4QDI A;  2OI5 A;  3WSG A;  3R3I A;  3EEQ A;  3BSS A;  4E6U A;  2AQ9 A;  3TWD A;  3GUE A;  4C12 A;  1KNX A;  2RIJ A;  3D98 A;  3FWW A;  5U2K A;  3VBP A;  3KWE A;  2XJA A;  3FS8 A;  4KQL A;  4AC3 A;  1Z2F A;  4ISX A;  2OEF A;  1S80 A;  4G3P A;  4N27 A;  4CVM A;  1MR7 A;  3TK8 A;  3OH0 A;  3R0S A;  1FWY A;  4QF5 A;  1N4I A;  3DHO A;  4M2B A;  5L6S A;  1QRL A;  4IWM A;  2OI7 A;  2Q4J A;  4G87 A;  3OU9 A;  3T57 A;  3OTZ A;  3GQ9 A;  4KNR A;  3TIS A;  4M98 A;  3KWD A;  1SSM A;  3GQA A;  3R5C A;  4M2A A;  1GG4 A;  3C8V A;  2FKO A;  2QKX A;  4MZU A;  3WSI A;  3VBK A;  3R2W A;  4MYO A;  3PMO A;  4KNX A;  3FSB A;  1YP4 A;  4E79 A;  2OEG A;  3MC4 A;  2IC7 A;  1KO7 A;  2GGO A;  2XAT A;  1HM8 A;  1MR9 A;  2NPO A;  2IOJ A;  1HM0 A;  1SST A;  3FSY A;  4HZC A;  3R1W A;  3SRT A;  3I3X A;  4HUS A;  1KK4 A;  3GOS A;  1KGQ A;  1HV9 A;  1KRV A;  3R5D A;  3HJJ A;  1G97 A;  2WLC A;  1M8N A;  3OH2 A;  4M99 A;  3VBM A;  4CVL A;  2V0L A;  4E75 A;  4IHH A;  2IU8 A;  2QIV X;  2AM2 A;  2WLE A;  2W0V A;  4R36 A;  4EGG A;  4KPX A;  3TDT A;  3MQH A;  1QRE A;  1V3W A;  1TDT A;  3BRK X;  3FTT A;  4KPZ A;  2IUA A;  3MQG A;  1KHR A;  4N6B A;  1G95 A;  3GVD A;  4C13 A;  3EH0 A;  3L31 A;  3EG4 A; 
#chains in the Genus database with same CATH homology
 2VD4 A;  4HCQ A;  4EA7 A;  3I3A A;  3VBL A;  5AFU U;  4ZIY A;  2WTZ A;  5DG3 A;  3KWC A;  4R7P A;  3F1X A;  4HUR A;  1E8C A;  1XAT A;  1OCX A;  3FSX A;  3ST8 A;  2AM1 A;  1QRF A;  4N6A A;  5DEP A;  3BFP A;  4IHG A;  1QQ0 A;  3NZ2 A;  4J09 A;  4R37 A;  5AFU V;  4H7O A;  4K6R A;  1LXA A;  2V0H A;  3R3R A;  1KK5 A;  5DEM A;  1KGT A;  3ZL8 A;  3VNP A;  3VBI A;  3D8V A;  1Z90 A;  2GGQ A;  1KRR A;  4FCE A;  4M9C A;  3IGJ A;  4EAB A;  2ICX A;  3CJ8 A;  1KRU A;  4EA8 A;  4G3S A;  2V0I A;  2QIA A;  3JQY A;  2V0K A;  1XHD A;  3P1B A;  3HSQ A;  3OUP A;  1YP2 A;  3FOQ A;  4J18 A;  2IU9 A;  1MRL A;  1QRM A;  1KQA A;  3BSW A;  3R5A A;  3VBN A;  3VBJ A;  2V0J A;  1FXJ A;  3EEV A;  4EQY A;  2I5K A;  3V4E A;  1KK6 A;  1THJ A;  4E6T A;  3OW5 A;  4BUB A;  1QRG A;  3ECT A;  4G3Q A;  2W0W A;  3Q1X A;  3P47 A;  3BXY A;  2WLD A;  5E3R A;  3TIO A;  2P2O A;  2ICY A;  3SPT A;  2OI6 A;  2JF3 A;  1T3D A;  4E1K A;  5ADX U;  3ZM5 A;  4AAW A;  1YP3 A;  2TDT A;  4DCL A;  4HZD A;  4N69 A;  4MFG A;  4EAA A;  5E3P A;  3TV0 A;  2JF2 A;  2VHE A;  3DK5 A;  3R8Y A;  4CVK A;  3BSY A;  3DJ4 A;  5E3Q A;  4EA9 A;  4IHF A;  5ADX V;  5L6V A;  4AA7 A;  3ZM6 A;  2WLG A;  5F42 A;  3OTM A;  4M28 A;  1J2Z A;  1HM9 A;  3IXC A;  3FSC A;  3R5B A;  1SSQ A;  1V67 A;  2WLF A;  4QDI A;  2OI5 A;  3R3I A;  3BSS A;  4E6U A;  2AQ9 A;  3TWD A;  3GUE A;  4C12 A;  2RIJ A;  3D98 A;  3FWW A;  5U2K A;  3VBP A;  3KWE A;  2XJA A;  3FS8 A;  4KQL A;  4AC3 A;  4ISX A;  2OEF A;  1S80 A;  4G3P A;  4N27 A;  4CVM A;  1MR7 A;  3TK8 A;  3R0S A;  1FWY A;  4QF5 A;  3DHO A;  4M2B A;  5L6S A;  1QRL A;  2OI7 A;  2Q4J A;  4G87 A;  3OU9 A;  3T57 A;  3OTZ A;  4KNR A;  3TIS A;  4M98 A;  3KWD A;  1SSM A;  4M2A A;  3R5C A;  1GG4 A;  3C8V A;  2FKO A;  2QKX A;  4MZU A;  3VBK A;  3R2W A;  4MYO A;  3PMO A;  4KNX A;  3FSB A;  1YP4 A;  4E79 A;  2OEG A;  3MC4 A;  2IC7 A;  2GGO A;  2XAT A;  1HM8 A;  1MR9 A;  2NPO A;  1HM0 A;  1SST A;  3FSY A;  4HZC A;  3R1W A;  3SRT A;  3I3X A;  4HUS A;  1KK4 A;  3GOS A;  1KGQ A;  1HV9 A;  1KRV A;  3R5D A;  3HJJ A;  1G97 A;  2WLC A;  4M99 A;  3VBM A;  4CVL A;  2V0L A;  4E75 A;  4IHH A;  2IU8 A;  2QIV X;  2AM2 A;  2WLE A;  2W0V A;  4R36 A;  4EGG A;  4KPX A;  3TDT A;  3MQH A;  1QRE A;  1V3W A;  1TDT A;  3BRK X;  3FTT A;  4KPZ A;  2IUA A;  3MQG A;  1KHR A;  4N6B A;  1G95 A;  3GVD A;  4C13 A;  3EH0 A;  3EG4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...