4IHGA

Chasing acyl carrier protein through a catalytic cycle of lipid a production
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
334
structure length
334
Chain Sequence
HASIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLGLCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAPSAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGSRLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVIIGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGGVIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYSSGIPLQPNKVWRKTAALVMNIDDMSKRLKSLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase
publication title Chasing acyl carrier protein through a catalytic cycle of lipid A production.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/lipid binding protein
total genus 104
structure length 334
sequence length 334
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00132 Hexapep Bacterial transferase hexapeptide (six repeats)
A PF04613 LpxD UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD
A PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.10.10 Mainly Beta 3 Solenoid UDP N-Acetylglucosamine Acyltransferase; domain 1 Hexapeptide repeat proteins 4ihgA02
3.40.1390.10 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 MurE/MurF, N-terminal domain 4ihgA01
4ZIYA 4CVLA 2OEFA 1HV9A 3EG4A 3OUPA 5AFUU 1E8CA 4E6TA 4C13A 2VHEA 3VBIA 2FKOA 3R5BA 2AQ9A 2WLFA 3PMOA 4J18A 1KHRA 2V0KA 1T3DA 1G95A 3BRKX 3OTMA 3TDTA 3TIOA 3DK5A 3VBKA 5DG3A 3ZL8A 2XATA 4EAAA 1QRMA 4G87A 3R5CA 3R0SA 1KGQA 3R3IA 4IHGA 2WLCA 1SSQA 3P47A 3GOSA 2Q4JA 2OI7A 2NPOA 3KWDA 4EA9A 2JF3A 1KRVA 1SSMA 3EH0A 2ICYA 1KRRA 1QRFA 3EEVA 3MQGA 1J2ZA 3JQYA 3CJ8A 3SPTA 2IU9A 3VNPA 3F1XA 3FSBA 2VD4A 3ZM6A 3C8VA 1QRLA 3VBMA 1MR9A 3OU9A 4M28A 2IC7A 5DEPA 2V0LA 3P1BA 2WLGA 3FWWA 3VBLA 3D98A 1OCXA 1Z90A 3ST8A 3KWEA 3TV0A 4QDIA 3R5DA 3SRTA 4MYOA 3BFPA 3VBJA 3GUEA 4FCEA 3FOQA 2JF2A 4MZUA 3BXYA 4K6RA 4R7PA 3T57A 3DHOA 1MR7A 3DJ4A 1HM9A 4HZCA 2GGOA 4M98A 2OI5A 1KK6A 4KNXA 1LXAA 5E3QA 1KGTA 3FTTA 4E75A 4EQYA 5ADXV 4HURA 4IHHA 5E3RA 1V67A 2W0VA 4MFGA 3I3AA 4HCQA 3TWDA 4AA7A 4EA8A 5ADXU 4G3PA 1HM0A 4H7OA 1QREA 1G97A 1SSTA 3R5AA 1V3WA 4N6BA 2WTZA 4HUSA 4N27A 4EGGA 2IUAA 1FXJA 1TDTA 2QKXA 2V0JA 3KWCA 3R2WA 4DCLA 4BUBA 2P2OA 4R37A 3NZ2A 4KNRA 3MQHA 3V4EA 1XHDA 2RIJA 4KQLA 2AM1A 3BSWA 1S80A 4J09A 4E79A 4AAWA 4EA7A 3OW5A 3VBPA 3BSSA 4C12A 3OTZA 4M9CA 2WLEA 3TK8A 4N69A 2WLDA 3HSQA 4E1KA 1QQ0A 4KPXA 5DEMA 1XATA 4G3QA 4N6AA 2IU8A 4HZDA 3Q1XA 4IHFA 4M2BA 4R36A 2ICXA 3IGJA 5U2KA 3ECTA 2OI6A 2GGQA 2TDTA 3HJJA 2AM2A 3D8VA 3FS8A 3I3XA 3TISA 3ZM5A 2I5KA 2V0IA 3FSXA 4CVKA 4E6UA 2QIVX 5L6VA 3MC4A 5E3PA 1THJA 2OEGA 3BSYA 3FSYA 2XJAA 3IXCA 4M99A 1KQAA 4G3SA 1HM8A 1YP2A 4ISXA 4KPZA 3R8YA 4M2AA 3VBNA 3R1WA 4AC3A 1MRLA 1QRGA 1YP4A 5L6SA 2V0HA 2QIAA 4EABA 3R3RA 1KRUA 1KK4A 1YP3A 3GVDA 1FWYA 5F42A 1GG4A 4QF5A 3FSCA 1KK5A 4CVMA 2W0WA 5AFUV
chains in the Genus database with same CATH superfamily
4ZIYA 4CVLA 2OEFA 1HV9A 3EG4A 3OUPA 5AFUU 1E8CA 4E6TA 4C13A 2VHEA 3VBIA 2FKOA 3R5BA 2AQ9A 2WLFA 3PMOA 4J18A 1KHRA 2V0KA 1T3DA 1G95A 3BRKX 3OTMA 3TDTA 3TIOA 3DK5A 3WSGA 1KNXA 3VBKA 5DG3A 3ZL8A 2XATA 3GQAA 1QRMA 4G87A 4EAAA 1NMOA 3R5CA 3R0SA 1KGQA 3R3IA 4IHGA 2WLCA 1SSQA 3P47A 3GOSA 2Q4JA 2OI7A 2NPOA 3KWDA 4EA9A 1N4IA 2JF3A 1KRVA 1SSMA 3EH0A 2ICYA 1KRRA 1QRFA 3EEVA 3GQ9A 1J2ZA 3JQYA 3MQGA 3CJ8A 3GQ8A 2IU9A 3SPTA 3F1XA 3FSBA 3VNPA 2VD4A 3ZM6A 3C8VA 1QRLA 3VBMA 1MR9A 3OU9A 4M28A 2IC7A 5DEPA 2V0LA 3P1BA 3WSHA 2WLGA 3FWWA 4CVMA 3VBLA 3D98A 1OCXA 1Z90A 3ST8A 3KWEA 3TV0A 4QDIA 3OH1A 3R5DA 3SRTA 3L2BA 4MYOA 3BFPA 3VBJA 3GQ7A 3GUEA 4FCEA 3FOQA 2JF2A 4MZUA 3BXYA 4K6RA 4R7PA 3T57A 3DHOA 1L0SA 1MR7A 3DJ4A 1HM9A 4HZCA 2GGOA 4M98A 2OI5A 1KK6A 4KNXA 1LXAA 5E3QA 1KGTA 3FTTA 4E75A 4EQYA 5ADXV 3L31A 3WSDA 4HURA 4IHHA 5E3RA 1V67A 2W0VA 4MFGA 3I3AA 4HCQA 3TWDA 4AA7A 4EA8A 3OGZA 4G3PA 5ADXU 1HM0A 4H7OA 1QREA 1G97A 1SSTA 3OH0A 3R5AA 1V3WA 4N6BA 2WTZA 3WSIA 4HUSA 4N27A 4EGGA 2IUAA 1FXJA 1TDTA 2QKXA 2V0JA 3KWCA 3R2WA 4DCLA 4BUBA 2P2OA 2IOJA 4R37A 3NZ2A 4KNRA 3MQHA 3V4EA 1XHDA 2RIJA 4KQLA 2AM1A 3BSWA 1M8NA 4IWGA 1S80A 3WSEA 1KO7A 4J09A 4E79A 4AAWA 4EA7A 3WSFA 1EWWA 3EEQA 3OW5A 3VBPA 3BSSA 4C12A 3OTZA 4M9CA 2WLEA 3TK8A 4N69A 2WLDA 3HSQA 4E1KA 1QQ0A 4KPXA 5DEMA 1XATA 1Z2FA 4G3QA 4N6AA 2IU8A 4HZDA 3OH2A 3Q1XA 4IHFA 4M2BA 4R36A 2ICXA 3IGJA 5U2KA 3ECTA 2OI6A 2GGQA 2TDTA 3HJJA 2AM2A 3D8VA 3FS8A 3I3XA 2FYWA 3TISA 3OH3A 3ZM5A 2I5KA 2V0IA 3FSXA 4CVKA 4E6UA 2QIVX 5L6VA 3MC4A 1NMPA 5E3PA 1THJA 2OEGA 3BSYA 3FSYA 2YYBA 2XJAA 3IXCA 4M99A 1KQAA 4G3SA 1HM8A 1YP2A 4ISXA 4KPZA 3R8YA 4M2AA 3VBNA 3R1WA 3OH4A 1MRLA 4AC3A 1QRGA 1YP4A 5L6SA 4IWMA 2V0HA 2QIAA 4EABA 3R3RA 1KRUA 1KK4A 1YP3A 3GVDA 1FWYA 5F42A 1GG4A 4QF5A 3FSCA 1KK5A 3SUCA 2W0WA 5AFUV
chains in the Genus database with same CATH topology
4ZIYA 4CVLA 2OEFA 1HV9A 3EG4A 3OUPA 5AFUU 1E8CA 4E6TA 4C13A 2VHEA 3VBIA 2FKOA 3R5BA 2AQ9A 2WLFA 3PMOA 4J18A 1KHRA 2V0KA 1T3DA 1G95A 3BRKX 3OTMA 3TDTA 3TIOA 3DK5A 3VBKA 5DG3A 3ZL8A 2XATA 4EAAA 1QRMA 4G87A 3R5CA 3R0SA 1KGQA 3R3IA 4IHGA 2WLCA 1SSQA 3P47A 3GOSA 2Q4JA 2OI7A 2NPOA 3KWDA 4EA9A 2JF3A 1KRVA 1SSMA 3EH0A 2ICYA 1KRRA 1QRFA 3EEVA 3MQGA 1J2ZA 3JQYA 3CJ8A 3SPTA 2IU9A 3VNPA 3F1XA 3FSBA 2VD4A 3ZM6A 3C8VA 1QRLA 3VBMA 1MR9A 3OU9A 4M28A 2IC7A 5DEPA 2V0LA 3P1BA 2WLGA 3FWWA 3VBLA 3D98A 1OCXA 1Z90A 3ST8A 3KWEA 3TV0A 4QDIA 3R5DA 3SRTA 4MYOA 3BFPA 3VBJA 3GUEA 4FCEA 3FOQA 2JF2A 4MZUA 3BXYA 4K6RA 4R7PA 3T57A 3DHOA 1MR7A 3DJ4A 1HM9A 4HZCA 2GGOA 4M98A 2OI5A 1KK6A 4KNXA 1LXAA 5E3QA 1KGTA 3FTTA 4E75A 4EQYA 5ADXV 4HURA 4IHHA 5E3RA 1V67A 2W0VA 4MFGA 3I3AA 4HCQA 3TWDA 4AA7A 4EA8A 5ADXU 4G3PA 1HM0A 4H7OA 1QREA 1G97A 1SSTA 3R5AA 1V3WA 4N6BA 2WTZA 4HUSA 4N27A 4EGGA 2IUAA 1FXJA 1TDTA 2QKXA 2V0JA 3KWCA 3R2WA 4DCLA 4BUBA 2P2OA 4R37A 3NZ2A 4KNRA 3MQHA 3V4EA 1XHDA 2RIJA 4KQLA 2AM1A 3BSWA 1S80A 4J09A 4E79A 4AAWA 4EA7A 3OW5A 3VBPA 3BSSA 4C12A 3OTZA 4M9CA 2WLEA 3TK8A 4N69A 2WLDA 3HSQA 4E1KA 1QQ0A 4KPXA 5DEMA 1XATA 4G3QA 4N6AA 2IU8A 4HZDA 3Q1XA 4IHFA 4M2BA 4R36A 2ICXA 3IGJA 5U2KA 3ECTA 2OI6A 2GGQA 2TDTA 3HJJA 2AM2A 3D8VA 3FS8A 3I3XA 3TISA 3ZM5A 2I5KA 2V0IA 3FSXA 4CVKA 4E6UA 2QIVX 5L6VA 3MC4A 5E3PA 1THJA 2OEGA 3BSYA 3FSYA 2XJAA 3IXCA 4M99A 1KQAA 4G3SA 1HM8A 1YP2A 4ISXA 4KPZA 3R8YA 4M2AA 3VBNA 3R1WA 4AC3A 1MRLA 1QRGA 1YP4A 5L6SA 2V0HA 2QIAA 4EABA 3R3RA 1KRUA 1KK4A 1YP3A 3GVDA 1FWYA 5F42A 1GG4A 4QF5A 3FSCA 1KK5A 4CVMA 2W0WA 5AFUV
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZIY A;  4CVL A;  2OEF A;  1HV9 A;  3EG4 A;  3OUP A;  5AFU U;  1E8C A;  4E6T A;  4C13 A;  2VHE A;  3VBI A;  2FKO A;  3R5B A;  2AQ9 A;  2WLF A;  3PMO A;  4J18 A;  1KHR A;  2V0K A;  1T3D A;  1G95 A;  3BRK X;  3OTM A;  3TDT A;  3TIO A;  3DK5 A;  3VBK A;  5DG3 A;  3ZL8 A;  2XAT A;  4EAA A;  1QRM A;  4G87 A;  3R5C A;  3R0S A;  1KGQ A;  3R3I A;  4IHG A;  2WLC A;  1SSQ A;  3P47 A;  3GOS A;  2Q4J A;  2OI7 A;  2NPO A;  3KWD A;  4EA9 A;  2JF3 A;  1KRV A;  1SSM A;  3EH0 A;  2ICY A;  1KRR A;  1QRF A;  3EEV A;  3MQG A;  1J2Z A;  3JQY A;  3CJ8 A;  3SPT A;  2IU9 A;  3VNP A;  3F1X A;  3FSB A;  2VD4 A;  3ZM6 A;  3C8V A;  1QRL A;  3VBM A;  1MR9 A;  3OU9 A;  4M28 A;  2IC7 A;  5DEP A;  2V0L A;  3P1B A;  2WLG A;  3FWW A;  3VBL A;  3D98 A;  1OCX A;  1Z90 A;  3ST8 A;  3KWE A;  3TV0 A;  4QDI A;  3R5D A;  3SRT A;  4MYO A;  3BFP A;  3VBJ A;  3GUE A;  4FCE A;  3FOQ A;  2JF2 A;  4MZU A;  3BXY A;  4K6R A;  4R7P A;  3T57 A;  3DHO A;  1MR7 A;  3DJ4 A;  1HM9 A;  4HZC A;  2GGO A;  4M98 A;  2OI5 A;  1KK6 A;  4KNX A;  1LXA A;  5E3Q A;  1KGT A;  3FTT A;  4E75 A;  4EQY A;  5ADX V;  4HUR A;  4IHH A;  5E3R A;  1V67 A;  2W0V A;  4MFG A;  3I3A A;  4HCQ A;  3TWD A;  4AA7 A;  4EA8 A;  5ADX U;  4G3P A;  1HM0 A;  4H7O A;  1QRE A;  1G97 A;  1SST A;  3R5A A;  1V3W A;  4N6B A;  2WTZ A;  4HUS A;  4N27 A;  4EGG A;  2IUA A;  1FXJ A;  1TDT A;  2QKX A;  2V0J A;  3KWC A;  3R2W A;  4DCL A;  4BUB A;  2P2O A;  4R37 A;  3NZ2 A;  4KNR A;  3MQH A;  3V4E A;  1XHD A;  2RIJ A;  4KQL A;  2AM1 A;  3BSW A;  1S80 A;  4J09 A;  4E79 A;  4AAW A;  4EA7 A;  3OW5 A;  3VBP A;  3BSS A;  4C12 A;  3OTZ A;  4M9C A;  2WLE A;  3TK8 A;  4N69 A;  2WLD A;  3HSQ A;  4E1K A;  1QQ0 A;  4KPX A;  5DEM A;  1XAT A;  4G3Q A;  4N6A A;  2IU8 A;  4HZD A;  3Q1X A;  4IHF A;  4M2B A;  4R36 A;  2ICX A;  3IGJ A;  5U2K A;  3ECT A;  2OI6 A;  2GGQ A;  2TDT A;  3HJJ A;  2AM2 A;  3D8V A;  3FS8 A;  3I3X A;  3TIS A;  3ZM5 A;  2I5K A;  2V0I A;  3FSX A;  4CVK A;  4E6U A;  2QIV X;  5L6V A;  3MC4 A;  5E3P A;  1THJ A;  2OEG A;  3BSY A;  3FSY A;  2XJA A;  3IXC A;  4M99 A;  1KQA A;  4G3S A;  1HM8 A;  1YP2 A;  4ISX A;  4KPZ A;  3R8Y A;  4M2A A;  3VBN A;  3R1W A;  4AC3 A;  1MRL A;  1QRG A;  1YP4 A;  5L6S A;  2V0H A;  2QIA A;  4EAB A;  3R3R A;  1KRU A;  1KK4 A;  1YP3 A;  3GVD A;  1FWY A;  5F42 A;  1GG4 A;  4QF5 A;  3FSC A;  1KK5 A;  4CVM A;  2W0W A;  5AFU V; 
#chains in the Genus database with same CATH topology
 4ZIY A;  4CVL A;  2OEF A;  1HV9 A;  3EG4 A;  3OUP A;  5AFU U;  1E8C A;  4E6T A;  4C13 A;  2VHE A;  3VBI A;  2FKO A;  3R5B A;  2AQ9 A;  2WLF A;  3PMO A;  4J18 A;  1KHR A;  2V0K A;  1T3D A;  1G95 A;  3BRK X;  3OTM A;  3TDT A;  3TIO A;  3DK5 A;  3WSG A;  1KNX A;  3VBK A;  5DG3 A;  3ZL8 A;  2XAT A;  3GQA A;  1QRM A;  4G87 A;  4EAA A;  1NMO A;  3R5C A;  3R0S A;  1KGQ A;  3R3I A;  4IHG A;  2WLC A;  1SSQ A;  3P47 A;  3GOS A;  2Q4J A;  2OI7 A;  2NPO A;  3KWD A;  4EA9 A;  1N4I A;  2JF3 A;  1KRV A;  1SSM A;  3EH0 A;  2ICY A;  1KRR A;  1QRF A;  3EEV A;  3GQ9 A;  1J2Z A;  3JQY A;  3MQG A;  3CJ8 A;  3GQ8 A;  2IU9 A;  3SPT A;  3F1X A;  3FSB A;  3VNP A;  2VD4 A;  3ZM6 A;  3C8V A;  1QRL A;  3VBM A;  1MR9 A;  3OU9 A;  4M28 A;  2IC7 A;  5DEP A;  2V0L A;  3P1B A;  3WSH A;  2WLG A;  3FWW A;  4CVM A;  3VBL A;  3D98 A;  1OCX A;  1Z90 A;  3ST8 A;  3KWE A;  3TV0 A;  4QDI A;  3OH1 A;  3R5D A;  3SRT A;  3L2B A;  4MYO A;  3BFP A;  3VBJ A;  3GQ7 A;  3GUE A;  4FCE A;  3FOQ A;  2JF2 A;  4MZU A;  3BXY A;  4K6R A;  4R7P A;  3T57 A;  3DHO A;  1L0S A;  1MR7 A;  3DJ4 A;  1HM9 A;  4HZC A;  2GGO A;  4M98 A;  2OI5 A;  1KK6 A;  4KNX A;  1LXA A;  5E3Q A;  1KGT A;  3FTT A;  4E75 A;  4EQY A;  5ADX V;  3L31 A;  3WSD A;  4HUR A;  4IHH A;  5E3R A;  1V67 A;  2W0V A;  4MFG A;  3I3A A;  4HCQ A;  3TWD A;  4AA7 A;  4EA8 A;  3OGZ A;  4G3P A;  5ADX U;  1HM0 A;  4H7O A;  1QRE A;  1G97 A;  1SST A;  3OH0 A;  3R5A A;  1V3W A;  4N6B A;  2WTZ A;  3WSI A;  4HUS A;  4N27 A;  4EGG A;  2IUA A;  1FXJ A;  1TDT A;  2QKX A;  2V0J A;  3KWC A;  3R2W A;  4DCL A;  4BUB A;  2P2O A;  2IOJ A;  4R37 A;  3NZ2 A;  4KNR A;  3MQH A;  3V4E A;  1XHD A;  2RIJ A;  4KQL A;  2AM1 A;  3BSW A;  1M8N A;  4IWG A;  1S80 A;  3WSE A;  1KO7 A;  4J09 A;  4E79 A;  4AAW A;  4EA7 A;  3WSF A;  1EWW A;  3EEQ A;  3OW5 A;  3VBP A;  3BSS A;  4C12 A;  3OTZ A;  4M9C A;  2WLE A;  3TK8 A;  4N69 A;  2WLD A;  3HSQ A;  4E1K A;  1QQ0 A;  4KPX A;  5DEM A;  1XAT A;  1Z2F A;  4G3Q A;  4N6A A;  2IU8 A;  4HZD A;  3OH2 A;  3Q1X A;  4IHF A;  4M2B A;  4R36 A;  2ICX A;  3IGJ A;  5U2K A;  3ECT A;  2OI6 A;  2GGQ A;  2TDT A;  3HJJ A;  2AM2 A;  3D8V A;  3FS8 A;  3I3X A;  2FYW A;  3TIS A;  3OH3 A;  3ZM5 A;  2I5K A;  2V0I A;  3FSX A;  4CVK A;  4E6U A;  2QIV X;  5L6V A;  3MC4 A;  1NMP A;  5E3P A;  1THJ A;  2OEG A;  3BSY A;  3FSY A;  2YYB A;  2XJA A;  3IXC A;  4M99 A;  1KQA A;  4G3S A;  1HM8 A;  1YP2 A;  4ISX A;  4KPZ A;  3R8Y A;  4M2A A;  3VBN A;  3R1W A;  3OH4 A;  1MRL A;  4AC3 A;  1QRG A;  1YP4 A;  5L6S A;  4IWM A;  2V0H A;  2QIA A;  4EAB A;  3R3R A;  1KRU A;  1KK4 A;  1YP3 A;  3GVD A;  1FWY A;  5F42 A;  1GG4 A;  4QF5 A;  3FSC A;  1KK5 A;  3SUC A;  2W0W A;  5AFU V; 
#chains in the Genus database with same CATH homology
 4ZIY A;  4CVL A;  2OEF A;  1HV9 A;  3EG4 A;  3OUP A;  5AFU U;  1E8C A;  4E6T A;  4C13 A;  2VHE A;  3VBI A;  2FKO A;  3R5B A;  2AQ9 A;  2WLF A;  3PMO A;  4J18 A;  1KHR A;  2V0K A;  1T3D A;  1G95 A;  3BRK X;  3OTM A;  3TDT A;  3TIO A;  3DK5 A;  3VBK A;  5DG3 A;  3ZL8 A;  2XAT A;  4EAA A;  1QRM A;  4G87 A;  3R5C A;  3R0S A;  1KGQ A;  3R3I A;  4IHG A;  2WLC A;  1SSQ A;  3P47 A;  3GOS A;  2Q4J A;  2OI7 A;  2NPO A;  3KWD A;  4EA9 A;  2JF3 A;  1KRV A;  1SSM A;  3EH0 A;  2ICY A;  1KRR A;  1QRF A;  3EEV A;  3MQG A;  1J2Z A;  3JQY A;  3CJ8 A;  3SPT A;  2IU9 A;  3VNP A;  3F1X A;  3FSB A;  2VD4 A;  3ZM6 A;  3C8V A;  1QRL A;  3VBM A;  1MR9 A;  3OU9 A;  4M28 A;  2IC7 A;  5DEP A;  2V0L A;  3P1B A;  2WLG A;  3FWW A;  3VBL A;  3D98 A;  1OCX A;  1Z90 A;  3ST8 A;  3KWE A;  3TV0 A;  4QDI A;  3R5D A;  3SRT A;  4MYO A;  3BFP A;  3VBJ A;  3GUE A;  4FCE A;  3FOQ A;  2JF2 A;  4MZU A;  3BXY A;  4K6R A;  4R7P A;  3T57 A;  3DHO A;  1MR7 A;  3DJ4 A;  1HM9 A;  4HZC A;  2GGO A;  4M98 A;  2OI5 A;  1KK6 A;  4KNX A;  1LXA A;  5E3Q A;  1KGT A;  3FTT A;  4E75 A;  4EQY A;  5ADX V;  4HUR A;  4IHH A;  5E3R A;  1V67 A;  2W0V A;  4MFG A;  3I3A A;  4HCQ A;  3TWD A;  4AA7 A;  4EA8 A;  5ADX U;  4G3P A;  1HM0 A;  4H7O A;  1QRE A;  1G97 A;  1SST A;  3R5A A;  1V3W A;  4N6B A;  2WTZ A;  4HUS A;  4N27 A;  4EGG A;  2IUA A;  1FXJ A;  1TDT A;  2QKX A;  2V0J A;  3KWC A;  3R2W A;  4DCL A;  4BUB A;  2P2O A;  4R37 A;  3NZ2 A;  4KNR A;  3MQH A;  3V4E A;  1XHD A;  2RIJ A;  4KQL A;  2AM1 A;  3BSW A;  1S80 A;  4J09 A;  4E79 A;  4AAW A;  4EA7 A;  3OW5 A;  3VBP A;  3BSS A;  4C12 A;  3OTZ A;  4M9C A;  2WLE A;  3TK8 A;  4N69 A;  2WLD A;  3HSQ A;  4E1K A;  1QQ0 A;  4KPX A;  5DEM A;  1XAT A;  4G3Q A;  4N6A A;  2IU8 A;  4HZD A;  3Q1X A;  4IHF A;  4M2B A;  4R36 A;  2ICX A;  3IGJ A;  5U2K A;  3ECT A;  2OI6 A;  2GGQ A;  2TDT A;  3HJJ A;  2AM2 A;  3D8V A;  3FS8 A;  3I3X A;  3TIS A;  3ZM5 A;  2I5K A;  2V0I A;  3FSX A;  4CVK A;  4E6U A;  2QIV X;  5L6V A;  3MC4 A;  5E3P A;  1THJ A;  2OEG A;  3BSY A;  3FSY A;  2XJA A;  3IXC A;  4M99 A;  1KQA A;  4G3S A;  1HM8 A;  1YP2 A;  4ISX A;  4KPZ A;  3R8Y A;  4M2A A;  3VBN A;  3R1W A;  4AC3 A;  1MRL A;  1QRG A;  1YP4 A;  5L6S A;  2V0H A;  2QIA A;  4EAB A;  3R3R A;  1KRU A;  1KK4 A;  1YP3 A;  3GVD A;  1FWY A;  5F42 A;  1GG4 A;  4QF5 A;  3FSC A;  1KK5 A;  4CVM A;  2W0W A;  5AFU V; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...