1KNXA

Hpr kinase/phosphatase from mycoplasma pneumoniae
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
309
structure length
303
Chain Sequence
MKKLLVKELIEQFQDCVNLIDGHTNTSNVIRVPGLKRVVFEMLGLFSSQIGSVAILGKREFGFLSQKTLVEQQQILHNLLKLNPPAIILTKSFTDPTVLLQVNQTYQVPILKTDFFSTELSFTVETYINEQFATVAQIHGVLLEVFGVGVLLTGRSGIGKSECALDLINKNHLFVGDDAIEIYRLGNRLFGRAQEVAKKFMEIRGLGIINVERFYGLQITKQRTEIQLMVNLLSLTFERLGTELKKQRLLGVDLSFYEIPISPGRKTSEIIESAVIDFKLKHSGYNSALDFIENQKAILKRKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/hydrolase
molecule keywords Probable HPr(Ser) kinase/phosphatase
publication title Crystal Structure of HPr Kinase/Phosphatase from Mycoplasma pneumoniae
pubmed doi rcsb
source organism Mycoplasma pneumoniae
total genus 73
structure length 303
sequence length 309
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.1.-:
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02603 Hpr_kinase_N HPr Serine kinase N terminus
A PF07475 Hpr_kinase_C HPr Serine kinase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1knxA02
3.40.1390.20 Alpha Beta 3-Layer(aba) Sandwich Udp-n-acetylmuramoylalanyl-d-glutamate--2,6- Diaminopimelate Ligase; Chain: A, domain 1 HprK N-terminal domain-like 1knxA01
2OFOA 4B35A 3PVSA 1OXSC 1L7VC 4Q5IA 4QJ5A 1YR8A 4B3GA 1GL7A 3DOFA 3PUVA 3VKHA 4H1VA 3BWDD 3T5DA 2FN4A 1E2KA 5GVRA 4EQ6A 4ZDJA 3EA5A 1ZU4A 2JASA 5SZIA 4Q01A 2ZETA 5F3WB 2ZI3A 1COWA 1QHGA 3EXAA 1TU4A 3DDCA 1SULA 3AB3A 1MABA 4LYHA 2YHSA 4TLDA 4MA4A 2YWFA 4RD4A 5CB8A 3P26A 4FMBB 1CKEA 3L0PA 4GOJA 2CCKA 1OYYA 1XMIA 2CVHA 4OI2A 5FL7D 4BEJA 2ZRCA 2PEYA 2BVNA 1KSGA 3CBQA 3G82C 4TL6A 4DDVA 2QENA 1J7KA 1HQYE 2JIZD 1ZM7A 4L9WA 2WOJA 3LWNA 2QQ0A 1HUQA 3A8TA 5SZJA 4DT1A 4P33A 3IIKA 4II7A 4QGAA 4CIDA 3W90A 2GESA 1MV5A 2TMKA 4B2LA 4QJ4A 3BE4A 4OI4A 2VTKA 1TUIA 4XWOA 5J4YA 1W2GA 4HZUB 1W44A 4HLCA 1DAMA 2CCJA 4LBVA 1KI4A 4YMSA 821PA 4QXAA 2VYFA 3VR1A 4EFMA 3FPAA 4K46A 2P0EA 4PSKA 3LLUA 3TIFA 5IDVA 1F2TA 2MSCB 4JLDA 4AIIA 4CEIB 4C4PA 1AS0A 1NBME 2OO7A 4ASUA 4NP6A 5KPDA 2ZRPA 3PJRA 1YRBA 4CEJB 4OHXA 4UXIA 4C2TA 4WBSA 1P7CA 1VTKA 4TL8A 3BFVA 1X8JA 2ZVQX 1G7RA 5FUWA 1IXSB 1FP6A 2QAGB 1NLYA 1OV4A 1Q0UA 2ZJ5A 3TR0A 1KKLA 5AUNB 2QT0A 1CXZA 4DB4A 3EZFA 4MKIA 4US2R 2ZROA 1C1YA 3I1FA 3JVUA 4JLVA 1GNPA 4EPRA 3FOZA 2IYQA 2ZSDA 4D4KA 4MRPA 5FTMA 3W8RA 3R9XA 5DYGA 2AWNA 1QHSA 5DN6A 2ODNA 4HI0E 3QPUA 2Q3MA 2JLXA 2OLJA 4HATA 1ELOA 1Z6XA 3U3RA 1NY6A 4QM7A 2QU8A 4O2LA 3DMDA 1J70A 4CYMA 3A6PC 2C9CA 1TEVA 3AP3A 3Q5DA 2GJKA 1LF5A 4PC6A 3GJ0A 1FFHA 1KI9A 3IQWA 4WZBE 1KK0A 2C95A 721PA 1WQ1R 3A1TA 1LS1A 2REXB 4KFRA 1S1CA 4PC1A 2FJUA 2HV8A 1TQ4A 2PJZA 1W4CA 2FFHA 2HCJB 3GEEA 1AKYA 2CEAA 3ADBA 5KNCA 4KO8A 2WJIA 5JEDA 3LH5A 3U5ZB 1WCV1 2CLCX 4DBLC 1OB5A 4PO8A 1KTVA 4MGYR 1LW7A 4TT3A 5FTNA 4LGMA 2OE2A 2WTUA 5C1BA 3EZ6A 1LY1A 1YR6A 3KJHA 1DG1G 2PT7A 2ZRFA 2FFAA 4U00A 1AZSC 1W47A 2WWIA 1UKEA 2Z43A 3LO5A 4PXAA 5EXXA 2QBYB 1ZYUA 2RGCA 4LHVA 5JS7A 3KKQA 4AKIA 1P3JA 2CE7A 4JVSB 1G7SA 5HR5A 4A2QA 4LBYA 2QQEA 2RB4A 1QVAA 4F4CA 4M1YA 2X8AA 2JJ1A 2ZIAA 2NO6A 1X1RA 1TTTA 3NHAA 3QJYA 1AM4D 4XTRA 2Q0HA 2WAXA 2C5LA 3PUZA 3QF4B 4KHZA 1OSNA 2ECKA 1J8YF 2VP5A 3WHKA 4OQLA 5KYKA 1P61B 3ZVMA 1U99A 1IXZA 4D80A 2WWXA 4DCTA 1Z2AA 2XXAB 3L31A 4RZ3A 4I99A 4TTPA 1A1VA 3IPXA 4HAVA 3RLFA 4C0JA 3K0SA 1CRPA 3NHBA 2J0VA 3B82A 1KDPA 4MRVA 3IHWA 2QPAA 1FX0A 3R7WA 1Z28A 4BLQA 2IXEA 1UBGA 3A4MA 1YZLA 1G21E 3AF4A 1QHNA 1S9DA 4JYBA 4KV9A 3QPWA 2J5XA 1QBKC 3GCGA 1AKEA 1G6HA 2GCNA 2BBTA 3AM1A 2FGJA 4BZPA 2JLRA 1CJUC 4XWAA 3WYFA 3U7HB 4KCGA 5DISB 1OE0A 4QBHA 3QKUA 1NBMD 1O3YA 3AKEA 4IDHA 5JHHB 1SKYE 2GK6A 2OAP1 3B1WA 3L0IB 4NMMA 4QGHA 2YC4C 3AVTA 3K0AA 1VIAA 3HPQA 1G5RA 1XTJA 1PLJA 2XX3A 2ZR7A 4NYIQ 4BASA 3WHLA 5J4HA 5KTYA 4NONA 5H68A 2W6IA 1JECA 3CRQA 5FI0B 3UMRA 3J81k 2CHQA 4TZ0A 4A82A 1GZSA 1ONBA 2OCYC 4IDNA 4AYXA 4WXPA 2FPKA 4DCVA 3W9YA 5CM8B 2QAGC 3ZJYA 2ANCA 4ZV4A 1IN4A 1H8HD 1R7RA 1N6OA 1P6XA 1UPTA 3RRZA 4WXRA 2WWGA 3OEHA 3NDBB 2A5DA 3AQ4A 4XVRA 4CZ2A 2WM9B 2V6JA 2YWGA 4EKDA 5HCIA 4TMKA 5FPTA 1GIAA 1OLOA 2BCGY 3LV8A 1Q21A 4CF7A 3EX7C 4D25A 1DAHA 1KIMA 2RGNC 2IK8A 2GXAA 4EPVA 3NBFA 1Z6YA 1ZUIA 4F91B 4YLGA 1G8PA 3SJBA 1ZAKA 3T5GA 4MYTA 1NRJB 1U0LA 3GFOA 1KK1A 1E2LA 1W0JD 3VX3A 4PSVA 2H5EA 3VR3A 2QP9X 2H17A 2WJVA 3HU1A 4N3NA 4C3ZA 5AUPB 5AK0A 2IYVA 1E0JA 3MWLA 4TLEA 1YR7A 4BLSA 4DDWA 2BIFA 1E9SA 5JJIA 3B78A 4MQBA 3EWAA 4Q02A 2ODBA 2N46A 1GL6A 3RRNA 2JATA 3A37A 1FPMA 2ONKA 2XNDD 3K70C 1BH2A 1Z0JA 4O0MA 2A5GA 2J9RA 2ZYUX 1XJQA 2JEOA 3BH7A 2ZI5A 2I3BA 1CR1A 2RAPA 2GDJA 5F9HA 1OFUX 4B75A 3CNLA 3WP0A 1RPZA 2WICA 2HDNB 2SHKA 1RJ9A 1XMJA 3KB1A 1E2EA 4G3XA 2J7PD 3TAHA 1NKTA 1OXVA 1UEIA 2V55B 5K8LA 1P60A 4O25A 1ZM9A 4YDSA 1YHNA 3U7EB 1DO0A 3ETLA 1VCIA 2G1KA 1EFCA 4LHYA 1OIWA 5KDOA 3RSOA 5E7MA 4IVRA 3KKMA 4NTZA 2WWYA 3ZDQA 2ZSBA 1E2FA 4GPTA 2YC2C 4YQFA 3LX5A 2J0SA 4JJKA 3CPEA 2ZYWX 2XITA 2PZGA 5CM9C 3U3MA 4GMXA 2V7QD 3I92A 2HCBA 3GFPA 4JVLA 2PX3A 4URYR 4X8LA 2QP4A 3FVQA 3V00A 1KO7A 5LPNA 4S2EA 2IHYA 3DL0A 2G9NA 3M0EA 2CLSA 4LBWA 5EZ5A 1E79A 3MUFA 1NVUQ 2ZRLA 4B74A 1IN7A 1M74A 1R5OA 4GZLA 1ZIOA 3GLHA 4EJSC 3TNFA 5IF9A 1D9XA 1PVOA 1H65A 2FH5B 5B57C 2XTZA 3KXIA 1IBRA 1T9HA 2AXNA 3N2IA 4JBYA 3C8UA 3NDPA 4TWZA 3M1IA 4Q9KA 1KAGA 1NF3A 4M9SA 3A1VA 1Q12A 3KTAA 4EFNA 4DLSA 1P2TA 5C18A 4LC0A 1E2QA 3R20A 1UKZA 4LJYA 1AQYA 1WP9A 1XB2A 1R5NA 2EWVA 4JVNA 1VPLA 3MG9A 3W6OA 1F2UA 3ZQ6A 1G8FA 2EQBA 5DI9A 1W0KD 4OYHA 2GEUA 1DAFA 2A30A 2HEIA 2PMKA 5DSZA 4OHVA 2YVUA 3VR6A 3OE7D 1NG9A 4TSFA 1NNEA 4C0SA 1EX6A 2ZUDA 4URZR 3KKNA 2IYYA 3EC1A 1Z6TA 1G1MA 4WA7A 1T6NA 3KB2A 1NVXQ 2J59A 3BH0A 1ANKA 1YZNA 1MT0A 3RS2A 1RRPA 1RYFA 3CPJB 2VP4A 3QKSA 2DFLA 2Q3FA 2X2EA 5B58C 3PG5A 1XP8A 2OT3B 1G3MA 1KSJA 1U90A 4EPXA 5J4LA 3GLFE 3ZLJA 2HXYA 4LV5B 5IK2D 3NVAA 1Z0AA 1OKKA 2MSEB 2ZJ2A 3E1SA 3K0EA 4HUQB 5J4VA 3SJZA 4DDTA 3S1AB 3Q7PA 1L4YA 2WSSA 2XTMA 3U6KA 3TW8B 4KU4A 2QMUA 5L3SA 3BB1A 1E9AA 5CLQA 4R7ZA 5B30A 4N0DA 3CRMA 2HT6A 2P6NA 4IJMA 1YZQA 2B6HA 3AKDA 1SHZA 5DE3A 1JI0A 5CK4A 5B64A 1COWD 1NIPA 3DPUA 4GP6A 4PSAA 3CWQA 1GTVA 4Q66C 3JVVA 2G77B 5H8WA 2RGBA 1I4LD 4JLKA 5FOUA 1N0VC 5GJVC 4L16A 1R4AA 1T3LA 4U5XA 3UPUA 3B2EA 2R8RA 1NSFA 1QHXA 1NG1A 1HT2E 2VSFA 5EP4A 5EP3A 3G5UA 3ZS8A 3M4YA 1XEWX 2BKEA 1IQPA 4F7WA 2X2FA 4C2UA 1BS1A 2FZLA 3O8CA 3IBYA 1TEXA 2XNSA 3CR8A 4P31A 1WF3A 2ZJZA 1GAJA 1KZGB 2A9KA 2F9MA 1G8YA 2KBFA 2WWFA 3SJAA 4BRUA 5L3QB 3HYTA 3PEUA 5CYPA 2NPIA 2C9OA 3BRWD 5CYOA 1SQ5A 3U44B 2JA1A 1VYVA 5TXGA 3K1JA 4M1SA 2DB3A 1JAIA 1E96A 3QY0A 4QBIA 3TAUA 2WKRA 3FHCB 1GNRA 3PIRA 4IEIA 4ZKEA 2C9YA 1H8HA 2GK7A 5EZ6B 4FXPA 4U7DA 2H8KA 4XD7A 4ASUD 2H16A 2UKDA 2PZEA 2ANBA 3OAAA 5E95A 3K09A 2XJ4A 2DYKA 1KK3A 1W2HA 3Q9LA 4OK3A 2E9SA 5J40A 1OHHA 1KOFA 4DLRA 1S3SA 3GLIB 4P4UA 4C0KA 4DUGA 2EFDB 1DG3A 1HY3A 3IO3A 3QKTA 1SVLA 4ARZB 3ND9A 4MKGA 2XAUA 3DKVA 2JLYA 2F55A 1PLKA 5DH9A 1VCOA 1G5TA 2A7QA 4NCKA 3SN6A 1ZCBA 4W7SA 1G41A 1UJ2A 2QSYA 4MGIR 1CU1A 4FCVA 3L8ZA 1E9CA 3TJZA 1XEWY 3CRRA 5DN6D 1PLLA 1XF9A 4EPTA 2ODWA 1OXUA 2OXRA 4OBEA 5FBVB 1Q1QA 3WMFA 1SXJD 1KK2A 2F1RA 2OSBA 3TUIC 4BLTA 4C30A 1PUIA 3HR8A 1G9XA 4N0EA 4BFZA 2AX4A 1XMVA 3CZPA 3EPHA 4TMWA 5F9FA 4CW7A 4XSGA 4KSBA 5JJKA 2XOKD 1KAOA 1KMHA 3L8YA 5JEEA 4M1WA 3SS8A 2FX3A 5JLJA 1UKYA 3B13B 4B3FX 4A9AA 2GA8A 2GCOB 2J7PA 1XCPA 1I4DD 4ZI2A 3C16C 1YZTA 1Q44A 1CJKC 3A4LA 3IBGA 4HLQB 4XVUA 4AKGA 3V9PA 3BB3A 3GQBA 4AG6A 2XEXA 2O8BA 2D06A 1LV7A 2VA8A 1QHIA 3NIBA 3CH4B 2WOOA 1A2BA 3EZ9A 3GFTA 3KFXA 4L8GA 4V03A 521PA 2RGGA 2YYZA 4MDEA 4QNMA 1W36D 2C96A 4URVR 2ZRBA 3K9LA 2KI5A 4LK2A 5GJCA 4IDOA 3R8CA 2JJ1D 2WKQA 1DEKA 1XBTA 2Z0MA 2FSHA 3FMIA 5FOXA 5CIWA 3P1JA 1XTKA 2V54A 2ZSFA 4TQ9A 1HT1E 2V8OA 3ZZUA 3SC3A 1XD9A 3ZVRA 1FNMA 1GWNA 2P6RA 1SKYB 5C4GB 2Z4RA 2BMEA 4AYWA 2A78A 2R44A 3I72A 4JLNA 4M1OA 3CIOA 1N6NA 2O8DA 4GT1A 1J8MF 1RRFA 1KO8A 5FOSA 3K9HA 4EDHA 1JPNA 4V02A 2WMOB 4TN1A 1WDTA 5FPSA 2ZRHA 3CX7A 2DBYA 3V4FA 4TYYA 1DAIA 3UMFA 1RRGA 4NCIA 1MRNA 1UBEA 2IS1A 3REGA 4BEBA 3SI7A 2NOAA 3X1ZA 4FWIB 3GJXC 2KBEA 2MMGA 4IOKA 4QM6A 3AF1A 3HDTA 3RABA 2FU5C 3QF7A 4XJXA 1P73A 3TVTA 5FBQB 4QG7A 4F38A 4GNKA 2ZI6A 4MKFA 3QXCA 4YXWA 4UNNA 4L5BA 3GLHE 4AI6A 3SE0A 2QZ4A 1W0KA 2W6ID 2QN6A 3TW4A 4B3XA 5IRCD 2CL6X 4KFSA 2CK3A 2D2EA 1TQDA 2ZJOA 3C5HA 4FMDB 3ASYA 4JLAA 2FF7A 5FUVA 5DO9A 1Q57A 4EPYA 3GPLA 1E2GA 1Y63A 5FI1B 2GVZC 1OXTA 4IOJA 4MDFA 2CXXA 2IYUA 2JDIA 5C2JB 4AD8A 3JZMA 3L2OB 1XEXB 2JLQA 3OEHD 1RC8A 1N2CE 3ZD7A 2FE4A 3VHLB 2K5UA 2C99A 3WNCA 4BZXA 3OIYA 1H8EA 4NZYA 4PQRA 2ZAMA 2IUUA 4TLBA 3CUEF 1XZPA 2HUPA 1JEDA 4Q7MB 2A3RA 5IK2A 4Q47A 1KI6A 4PC2A 4RY2A 4D2IA 1AK2A 2WMNB 4DRZA 2JLUA 2NO7A 4MRRA 4NYMR 2AR7A 4TQAA 4EQ6B 2BJWA 3ZQJA 4BECA 2B8WA 2OUKA 4OI1A 2VSOA 5C46F 1KJYA 2QE7D 4RJLA 4GOXA 4IOMA 3VR2A 3B85A 1P9WA 4A4DA 5L3VA 1IXRC 2F1HA 5KDDA 1YZUA 4B71A 1MABB 1W4AA 4ILEA 3UIEA 3THWA 1S3GA 2PCJA 2W83A 4I1UA 2VHCA 1GG2A 2X19A 3FDIA 4D4JA 4LDJA 4PANA 2EFEB 4Y0VA 1VHLA 2AXPA 2I4IA 3KKOA 3QUSA 5ANRB 5AR1A 1FOEB 3QE0A 1CJTC 2GKSA 4WAUA 2EYUA 2W58A 3KFVA 3SBEA 2QMOA 4M4SA 2ZJAA 1KO5A 2P2LA 1YR9A 2R9VA 4JKYA 4YMUA 4KODA 3NTUA 1MO4A 4Z1MA 1JR3A 2XTNA 4MH0R 3OIUA 1IM2A 2IUTA 3QQ5A 4DT1B 1G64A 3TKLA 3AGPA 4Z51A 1Q3HA 4GP7A 1VCMA 2VQSA 3IILA 1N0WA 4I1SA 5EE3A 5CB6A 2F43A 3WNDA 2ZI4A 3SHWA 3GJ3A 2FSIA 1EESA 1BO6A 1A7JA 4D4MA 1AS2A 4FMDF 2IT1A 4LV8B 2QTVB 3SJCA 1Z5ZA 3ZH9B 2FSFA 4RKFA 4BFWA 5JRZA 2FGKA 3A1UA 1CP2A 1E99A 4AYTA 1NN3A 3D31A 3ND8A 2YV5A 1CBUA 3ZIAA 1T0HB 4Q1EA 4Q9LA 2V1XA 2YOFA 4F4IA 2A2ZA 4YC7A 1XPOA 3QVUA 4OKSA 4GI7A 4DVGA 4ZIRA 3TK1A 2XZLA 3EA0A 3AEZA 4M9QA 1OIVA 5GVSA 3CNNA 4R9UC 4PAMA 3I5YA 1E79D 2GEVA 1OH8A 4K81B 2BOVA 5LB2A 2J3EA 5KNDA 2KB0A 2G83A 2BCJQ 3EZ2A 4PHGA 2CE2X 2OBMA 4A6PA 2CL7X 2BMJA 2P65A 1E98A 1WA5A 4F92B 1VCNA 4KXFB 2JLSA 3SOPA 1CULC 3QEOA 4DIDA 4NH0A 4ZPXA 2OZEA 5DNYB 3RHFA 3WYGA 3THYA 1KDOA 5CJPA 2JJ2A 2O0KA 5CK5A 1JJVA 3UKDA 4C0BA 2REOA 1E2HA 4Z8XA 1SXJA 1NSTA 2G6BA 1XD8A 4LI0A 2QAGA 2C2HA 2GZHA 1XTQA 3CKLA 3OZXA 1JXMA 4MGZR 1LS6A 2YOHA 3FYHA 2D7CA 3GLFA 4IOLA 5EJEA 1WBBA 1E4VA 2UZ3A 2XOKA 2BEKA 2J0UB 1GM5A 2BMFA 4RFSA 3OFNA 4FCTA 4V0KA 3VR5A 4ESHA 4TSFD 3A1WA 3CF0A 1NJGA 1QRAA 3LW8A 4LJ8A 4M0LA 5FOWA 1D6JA 5FTJA 3PEYA 4FN5A 2ZM5A 1HEIA 3EIQA 3KQNA 2ZJBA 4HYYA 2I1VB 1KI8A 5DGXA 1XFAA 2IYWA 3I8SA 2CL0X 3B7GA 2WJHA 4OQNA 4B3DA 4JIMA 4TL7A 5DIFA 221PA 1AA9A 3DKPA 3HR7A 4HB0A 1IAQA 4DHEA 3WP1B 1W48A 4US1R 4OQFA 1OKKD 2OAQ1 3EWSA 3O8RA 2VBCA 5BYJA 2B7CA 1R10A 2WSSD 1NMZA 1NN0A 4P4SA 2WZQA 2ZVPX 2OXCA 2ONJA 3BERA 1Z07A 4KLNA 1Q1ZA 3ZYCA 1M6NA 2GEDA 3KQKA 3RDPA 5FH9A 1VYUA 2ZRGA 2GHIA 4DJTA 5FR2A 1AS3A 1AGPA 3RS3A 1FZQA 3C4JA 1P9NA 2R6FA 4A1FA 1RW4A 2IXGA 1OYWA 4B73A 4D0GA 4IDQA 1E9RA 3UG7A 4JJZA 1FX0B 1G4UR 4IEEA 1VG1A 1I4TD 3R7WB 5ELXA 4Q03A 2F1IA 5EQTA 1HH4A 3REFA 4A8JA 5HZKA 2GBLC 5G41A 1E69A 1V5WA 1XXHE 4KYUA 5BQ5A 1TF2A 2CVFA 3CB4A 4MITA 3RRMA 3SHFA 5BN3A 3PQCA 2V4ZA 2DFKB 1M8PA 4DLWA 1TF7A 3K0CA 3TUJC 5E7IA 4H9GA 2YNMA 4B3CA 3QENA 4JBWA 5LB4A 1X8LA 1ZIPA 2EWWA 1MO5A 2B7BA 5EXSA 3W34A 1U9IC 5E4FA 1E6CA 4AG5A 1AIPA 4LJ9A 4AURA 4ZCIA 1Q22A 2RKOA 4M8NE 2Z83A 4D82A 2VSXA 3DO6A 3BGWA 3IEVA 2O8CA 4Q19A 2QG6A 3TSZA 4M9ZA 1MO3A 3SFZA 5FUYA 5HCNA 1NI3A 4JT4A 3TMKA 1GUAA 4XD7D 4EJSA 3OAAD 4RD2A 4DWJA 4FCWA 4GZMA 4IFEA 4JL8A 4P4TA 4JT2A 1KI1A 4YMTA 4Q9JA 1LB1B 4LRWA 1EG7A 1OHHD 4H1UA 2IL1A 4HEJA 2KE5A 5SZHB 1Z47A 2ZU0C 1K8RA 4DUGD 5M04A 3R9WA 3MFYA 3AVOA 4QHYA 2EFCB 5L8VA 2F6RA 4X8HA 1E3MA 3THOA 4BFUA 5KHOC 2AD1A 2C77A 2ZSEA 3X1XA 4LUCA 4M1MA 2FG5A 2FOLA 2QE7A 5EP1A 1SZPA 2NQ2C 3NXSA 4FMCF 2ERXA 2IYTA 3EASA 3BB4A 4BPBA 2NMVA 1CTQA 2JLWA 1B0UA 1BIFA 2DWQA 121PA 3BAFA 1Q3TA 4G5OA 2VH5R 1DE0A 1W5TA 2WWHA 2Q6TA 1U2RA 4NCNA 4XWKA 2ODEA 3QKRA 2AK2A 2ZJ8A 3T1OA 2IF0A 2EU8A 5CDFA 3ZVLA 2OILA 4W5JA 1R8SA 2ZRNA 2DY1A 2XJ9A 4J0QA 2WIAA 3PUWA 2RHMA 4HAYA 3RSLA 5GADl 3VNVA 1FUKA 4PX9A 1KMQA 2PEZA 2GNOA 1RJ9B 4F4JA 1A82A 4KITB 1CJMA 3LW7A 2DHRA 1KNQA 5HE9A 2R65A 3ZZTA 1JXOA 1UADA 4EUNA 3NH6A 2CJWA 3B1XA 4E5UA 1G7CA 1KDRA 4B2PA 4TYQA 1VHTA 1XPUA 1F3OA 3QXJA 4A2WA 1GVNB 2AHOA 2ASEA 3AUYA 1JR6A 4IKEA 3AKYA 1TU3A 2R6AA 4HSEA 2C03A 3IUYA 4I81A 3KJIA 2ZR9A 5FPHA 1JJ7A 4QGGA 2Q21A 4G5RA 3X1YA 2O0JA 4JLPA 3BIFA 3NBXX 3A4NA 4TQUS 1JR3E 2IYXA 4CRWB 4M1KA 4WVFA 3NEJA 2VPPA 1AGRA 2CCGA 4Q1DA 3R8FA 3VU9B 4DXAA 1T0JB 2E87A 2ZJYA 4A92A 4LCBA 1Z0IA 2PBRA 1IN5A 3LD9A 2QL6A 4KFUA 5DLQC 3RVBA 1XPRA 3MGCA 4HDCA 4RD3A 5BW8A 1JALA 2ZE5A 3I32A 4I1OA 2MMCA 4XOIA 1II8A 3PUXA 2EW1A 1NVWQ 3BXZA 3GLHB 4TMXA 3A1SA 3FB4A 4Q7JB 1ZC4A 1Z2CA 1IN8A 3B6EA 3UWOA 5JJLA 2QI9C 4P32A 1TQ6A 2RMKA 3LXXA 2NIPA 4G0NA 2OCPA 4KAXA 2OCAA 4Q21A 2C78A 3SYLA 2QEQA 2QNRA 4RCZA 2FFBA 1CEEA 3KTAB 1US8A 2QMHA 4LWZA 3EPLA 1QDEA 4HDQB 1KGDA 5DYIA 1OFIA 1F6BA 1NP6A 1R0ZA 4PZLA 2ZI9A 4B32A 1V43A 3Q85A 1Q20A 1F2UB 3KUCA 2VL7A 4NCJA 4LJ7A 3WMEA 4OK5A 1ZVQA 4YXWD 2HF8A 4Q1AA 4BGDA 4MUBA 4TYWA 1T3HA 1OIXA 3K53A 3DZDA 1M34E 3AUXA 2CK3D 2LWIA 1CF4A 4POAA 1GRRA 4Q1BA 3U4QA 4JL6A 3Q3JB 1E0KA 1EFTA 3WRYC 3RWMB 3MJHA 5HKKA 2JDID 5DHFA 4CEHA 1OB2A 4GBMA 1SXJE 1GILA 1DS6A 3DMNA 4IVPA 4WIAA 3QKSB 4V0NA 2IWRA 2WHXA 3L82B 5FBLB 1NN5A 4A8JB 1M2OB 3PITA 5G40A 1JQLB 1DPFA 1UEJA 1H8ED 3L0SA 3ASZA 5E3HA 3TQFA 2JLVA 2O8FB 3AVWA 2IOJA 1MH1A 2FA9A 1UKVY 1Z0DA 4HB4A 5BXQC 1NL3A 4W9MC 5LD2B 2C8VA 1XD2A 4KLZA 1P62B 3QNUA 3PEWA 1U8AA 2WAYA 1E32A 3K0FA 5L3SB 2ZSAA 2XB4A 4TL9A 5JBQA 4WZAE 3VKGA 4BFYA 3TVDA 4FWTA 4PPGA 4NYJR 3FKSD 3QBVA 4DDUA 4NHOA 4JKIA 4TYPA 1TL7C 5EE5B 3ZGXA 3DZ8A 4Q4AA 3CO5A 4R2IA 1GP2A 2NTYC 4U02A 4M22A 2NO1A 3AVPA 2VP2A 2AD5A 1ZRHA 3D8BA 3I5XA 1S4QA 4HUQA 2GJ9A 2YZ2A 5KSOA 5GJBA 1SVKA 4TMTA 4LV6A 2WPDD 2ZEJA 4E07A 1DAGA 3PEVA 4DCSA 4DC9A 1UM8A 5FR1A 4Z1MD 1NIJA 1JR3D 5FUXA 1JBKA 5FOTA 4GOKA 2BM1A 3W5IA 4E03A 2VIIA 3T1VA 3IPYA 1D2NA 2RH5A 4Q7LA 3DVLA 4DLZA 2IS6A 1SKQA 3C7KA 2DFTA 4QNRA 1RYHA 1EFRA 2LCFA 4CT5A 4C0HA 4Q7KA 3RWOA 1IONA 5DHAA 5A5GA 4TTRA 4BRWA 4UXHA 1ZD9A 3QXSA 2DCUA 5HE8A 2LKCA 4YMVA 1YE8A 3T35A 4IFBA 4LOAA 2GVDC 2G3YA 1KDTA 2CLDX 2W0MA 3ZIAD 5CIQA 1ESNA 1W4BA 4LHWA 4LYAA 5KOYA 1EK0A 2OCBA 3QXHA 3IO5A 1GNQA 1ZJ6A 4B3BA 2ORIA 3UK6A 4A2PA 1VIYA 1W5SA 4AC9A 3EC2A 3QXXA 4UJ3A 1TNDA 5FBRB 1R2QA 3OIWA 4R2HA 3THXA 1JEEA 4Z8YA 1X86B 4S35A 1LFDB 5JSZA 3AVVA 4PAOA 1DTSA 1YVDA 3EIHA 1CR0A 1ZW6A 2CDNA 2P3SA 3LY5A 4HAWA 4OHWA 4NDZA 4LZZA 1JQJC 2WJGA 5A4JA 3E2IA 5JECA 2BMDA 4PZYA 5CJ2A 4HAUA 3TQCA 1E0SA 3Q8XB 4DSTA 5IHPA 421PA 4HLUC 1KO1A 3VMFA 4PHHA 4DLYA 2REBA 3NH9A 2JJ2D 1R0WA 3LNCA 3T34A 1HE1C 1U98A 4UNRA 5KSZA 3WRXC 3KQHA 3AF0A 1KO4A 4CT4B 3GJ4A 2EFHB 1RZ3A 2HT1A 1M7HA 1R8QA 1RKBA 1G3IA 3KXLA 3HPRA 4GFDA 2ZU6A 4DLTA 4EPWA 2PMDA 3BFKA 5DI3B 3I8XA 2R2AA 1S8FA 3T15A 1KMHB 1EWQA 2X1VA 1BOFA 2P67A 3A36A 4YDHB 3GLGA 1W1WA 2AN9A 1GSIA 5D3MB 5EE0A 1WBDA 4A8JC 3MSXA 1E9FA 1P5ZB 1RVDA 1IJEA 4E09A 1A2KC 1JAHA 3OFND 2VHUA 3KQUA 1Z0KA 1GRQA 1J99A 1ZBDA 3TRFA 5AJZA 1SVMA 1L8QA 3C41J 3B60A 3MWYW 2RHDA 2PLFA 2ZITA 5LD2C 3OESA 5EE9A 5J4KA 3L43A 2O8BB 1CJVC 1OFHA 3CLVA 3LLMA 4HZIA 3SZRA 4BWYA 2XGJA 1N6RA 3B1VA 3HU3A 2YJTD 1S9HA 3U3KA 2FPMA 5CDFE 3FHTA 3AVUA 3I4LA 3QG5A 2L0XA 2ATXA 2CHVA 4AKHA 3AP1A 1ODFA 1G3RA 2AFHE 2WBLC 3H2YA 3NEYA 3C14C 1M7GA 1W4RA 3HU2A 4GL2A 1QHHA 1ETUA 4R71A 3FGNA 1II0A 3FMFA 1KSFX 1XXHA 4V0OA 2BC9A 2CBZA 1N6LA 1HTWA 1YRAA 4D0LB 2GAOA 3T1QA 2WIBA 3GJ5A 3K70D 4Q18A 4B44A 3EPKA 2HJVA 2R6GA 4MUAA 1VMAA 4NL4H 4Q9IA 4B43A 4PZZA 2ZS9A 4Q4HA 1Z22A 5KUTA 4I1VA 4JLMA 2WV9A 2O8DB 3X1DA 2JJ8A 3I73A 2HJGA 4Q4LA 4TMZA 3UG6A 2IEYA 3SYNA 1WXQA 1BKDR 2JAQA 3W3AA 4DCNA 5FPYA 4PAQA 4R98A 1G291 3OF5A 4ZCMA 1X1SA 4DLUA 5IT5A 1Z0FA 4LBZA 2ZI7A 1YJ5A 4JS0A 4BLPA 4C7OA 5AUOB 1A5TA 4DSNA 3KKPA 2ZYVX 2FNAA 3RRYA 2IA5A 4GRAA 2GXUA 2WVJA 3Q5EA 3U60B 1G7TA 1MOZA 4C9BA 2WSMA 4UKDA 4XIGS 1OT3A 2XB2A 2H18A 3SEAA 1EWRA 5H1YA 3KX2A 1XJ0A 3ECCA 2IC5A 2ZRMA 4NKRA 4QHSA 4Q4JA 4RKEA 2O8EA 3BD9A 2R6CA 3O8BA 1IN6A 1SVIA 1G8GA 2ZE7A 4GSYA 4OJKA 4A0HA 1E9EA 2J41A 2Y8EA 3QOFA 2IHBA 5G3ZA 4ZI3A 1G8HA 1UAAA 1FMJA 4JBXA 3FWYA 4PHTA 5JWOA 3BS4A 3CF6R 3CX6A 1PV4A 1P9RA 1TAGA 2GJSA 4G5GA 1T8UA 3HP1A 5F2EA 2D7DA 2GETA 1TPZA 3TBKA 2VHTA 1ZINA 1ZNZA 3DHWC 3ONWA 4NCHA 4HB3A 3T06B 1Q1EA 2BBOA 3RS5A 1E2JA 1KY3A 3VQTA 5KO2A 1KI6B 1FP7A 1F48A 2ORWA 4L9SA 2N42A 2GZAA 1P2SA 3TR5A 2G0NA 3CONA 1K5DA 1UBCA 1YZGA 3LBNA 1S2MA 1K5GA 3B9PA 4WZ6A 4EFLA 2DWOA 4B34A 2QT1A 5AJXA 2QM8A 3CH5A 1DAEA 4ZDKA 4ZKDA 4LYFA 5JRJA 2A5JA 1GKYA 1KSHA 4JMPA 2Z5FA 1XEXA 3THWB 1ZUHA 1IY2A 3FKSA 1P4SA 4NYJQ 3MWKA 1T5IA 1YKSA 4KVAA 2JCSA 3F8TA 5F98A 1SGWA 1XEFA 4ITRC 1I2MA 1NLZA 3KDSE 4X8OA 4BFXA 4O3MA 3RC3A 1SVOA 3CPHA 3QBTA 2EFGA 2QM7A 3WMGA 1G19A 2WPDA 1GDDA 1DAKA 2WJJA 3I62A 1ZD1A 2GXQA 2RGDA 4URUR 3EW9A 2GILA 3LBHA 1DELA 1IY1A 5CLLA 4BFTA 4BLOA 1T91A 4FD2A 3ICEA 2QSZA 4WW0A 1XTSA 2F43B 3CM0A 4N1AA 5AJWA 621PA 1D2MA 1MKYA 1S96A 1UF9A 3EZ7A 4RD0A 1VG0B 3QIAA 1KNXA 3LFUA 2HYIC 3AGQA 3C5CA 4MYHA 4KFTA 2GCPA 4ZDIA 3LRPA 3BK7A 4QFMA 1GL9B 2ZR0A 4B33A 3X2SA 4DCUA 4TYNA 4Y0AA 3AVQA 1E9DA 1F2TB 3HYRA 4XTCS 1RRCA 4G1UC 2IS2A 2FWRA 1OH6A 4MRNA 1OXXK 1WMSA 5FTLA 3VR4A 1FL9A 2GJAA 4IW3B 4B2IA 4YMWA 3U3OA 4ZIRB 1XCGB 4G01B 4L15A 3G0HA 1D5CA 5HTKA 2GBLA 1WRBA 1Z8FA 1BYIA 4OK6A 2GAAA 3KL4A 2GZDA 2IYSA 3W3ZB 3ZZ0A 3AVXA 1SVSA 3MRSA 4C0QC 3ICQB 4DZZA 2FDCA 4D26A 3X1WA 4HZUA 2R62A 2ZUBA 2BBWA 3NC1C 1U8ZA 5KNBA 4PO1A 1IJFA 3TUZC 1LVGA 3PUYA 1U9IA 4LJ5A 5G3YA 4CEIA 4D6PA 3THYB 3AKCA 4BLRA 2P5SA 3BOSA 2J87A 2FPLA 4M9XA 1G5PA 2QTFA 1SXJB 4CEJA 2F3TA 1RE0A 1GKIA 3CZQA 1JNYA 4IHQA 2FZ4A 1DOAA 3CWZA 3KJEA 3PR1A 2ZXUA 1D2EA 3D7MA 3KJGA 4TLCA 3RYTC 3U2QA 5JI2E 1XNJA 4LY6A 1EX7A 3GLFB 3NKVA 1ZUNB 2VP0A 2DWPA 1IY0A 2CMKA 4RFSB 1TUEA 2IXFA 2EYQA 4RFVA 5EUMA 2MSDB 1P75A 3SNHA 2AK3A 3B5JA 3UATA 4DLVA 4A0RA 1Z63A 1SHKA 4PQFA 1F60A 1GFIA 2RGNA 4QKQA 4A36A 4ACAA 5HKKD 2VLIA 2J46A 2QPTA 1ZM3A 1D8TA 2NPFA 1GOTA 1OH7A 4OJQA 4XVQA 1CR2A 4OHYA 3SQWA 3OHMA 1XWIA 3GLIE 2VO1A 3P4YA 1KKMA 4IRUB 4AKEA 2E1RA 3IIMA 3MCAA 2IYZA 3NBZC 4EIWA 1Y3AA 1XZQA 4UNSA 3FE2A 5G53C 1HE8B 3GLGE 1W36B 2KWIA 3FKQA 5EE1A 5TDHA 5J5CA 2B21A 3Q7QA 3QPVA 1E1QA 2B8TA 3PENA 1XJCA 2J0UA 3PFIA 3SFVA 2ZRIA 1EFUA 4P4SB 5FOVA 3K70B 1G6OA 3F3YA 4PQYA 5JZVA 4TMVA 4P0TA 3UWKA 1ZM2A 2VF8A 5HZHA 4JLBA 3BFXA 1HQCA 4FI3C 3JZAA 5FL3A 2VRWA 1ZCAA 1N0UA 1YU9A 1VDZA 1AJEA 4FMCB 3TE6A 4F93B 2HF9A 1WB9A 2QBYA 1MO6A 2PL3A 1MR3F 2J1LA 1G3QA 2Q3HA 3EAQA 2XZPA 2Z4SA 1NVVR 3OEEA 2FSGA 2QGNA 4PFSA 3U7FB 3T12A 1FQJA 2HLDA 3I3SR 3TH5A 2H7VA 1N5JA 1T5LA 5AJYA 4LHZA 3KUDA 4BFSA 2G1JA 2D4HA 3WXMA 1Z6GA 5FTKA 3N5CA 2Q9BA 1HURA 3P20A 1JPJA 1KI7A 3QF4A 3T1TA 4HAXA 1N25A 5D3QA 2J45A 2I1QA 3QVVA 2DR3A 3K0AB 5AUQA 2XXAA 3ADDA 1EFRD 4TLAA 2NO0A 1Z6AA 4WOPA 2EVWX 4ON9A 2IUSA 1KI2A 5LDDC 2QRNA 3AP2A 1E2MA 2WWWA 1E1RA 2O8CB 1G3UA 4L4UA 1U0HC 3CNOA 4XSHA 1J2JA 2DFNA 5TVKA 2ATVA 4BUJA 4EJSB 2CNWD 1U94A 5JFGA 2BJVA 4NU0A 2W6JA 1OFTA 2W00A 1NMXA 1D9ZA 1O87A 2OG2A 4QOSA 2PLRA 1GKUB 5JWRA 4V0LA 2AFIE 4D4LA 1N5LA 1BMFA 1R6BX 4IXMA 2GJ8A 2OBLA 4IVQA 1SXJC 2XSZA 2QMEA 1DBSA 2QRZA 3H4MA 5LBIA 4LHXA 1R0XA 1DARA 1ZNXA 3I61A 1NJFA 4NYMQ 1NKSA 3W6PA 2PCLA 2G0TA 3LDAA 4K8OA 3UMSA 4JLOA 4PHFA 2YKGA 4G5SA 1VYTA 1A4RA 4DSUA 2HYDA 1Z29A 1TX4B 4KI0A 3QKRB 4C0LA 2OM2A 4ABYA 2V3CC 1N6IA 2J0QA 2ERYA 1HYQA 3HJNA 3GJ8A 3LQQA 3LVQE 5AWFC 3VX4A 1G17A 3MLEA 4V0ME 4ESVA 3A58B 2VHJA 1UDXA 3DM5A 2OFXA 2Z6VA 3FMOB 2ZTSA 2ZRKA 2PZFA 4PPNA 3GP8A 1U81A 3EARA 1XTIA 2B92A 3F5FA 4O2RA 2CJWB 5EXTA 1Z06A 1TQ2A 1ZP6A 4ZO4A 1MRSA 4PTLA 5K8TA 1W36C 1OH5A 3B1YA 4YONB 4EAQA 2X77A 4B76A 3CR7A 1Z83A 4BZQA 1Z3IX 1PUJA 4A0GA 5BYKA 5L3RA 4JL5A 3P4XA 4FIDA 3TSWA 2RCNA 3ADKA 5FL7A 1P2UA 3CF2A 5BWMA 3PXGA 1NY5A 4CVNA 1J90A 3NG1A 2JIZA 4NE2A 3SBDA 1KJZA 4US0R 3U3JA 3AF2A 3P32A 2JLZA 4UXJA 3TGPA 3BORA 1T4GA 5TB5A 2H57A 3QSYA 1FMLA 3GJ6A 3B1ZA 4UJ5A 3BBPA 3ZS9A 3NC0C 2BEJA 4JZKA 1FTSA 4RZ2A 3U7GA 3IHLA 4IXNA 1II8B 1VG9B 2IBMA 3K0CC 3LX8A 3LVRE 1QHYA 1QZXA 3CRVA 3O47A 3PCRB 2YWEA 1N5IA 1XRJA 3U6BA 3VHXA 3N70A 2BV3A 3HWSA 1C4OA 3W8NA 2D2FA 2LKDA 1C9KA 3RANA 3RS4A 1TMKA 2FFQA 4GDFA 1M1YE 4PPFA 1E2DA 1ZU5A 2AL7A 1US8B 2D74A 1QF9A 1XCMA 1ZNWA 5AJVB 3SQXA 6Q21A 2VEDA 2D62A 1N6PA 1ZMXA 2ORVA 1XU4A 3M6AA 3VU9A 2XZOA 5JHGB 2IEZA 2VF7A 3LXRA 1XTRA 1P2VA 1NMYA 2BKUA 1OPXA 2QP3A 4B47A 3D3QA 2OEPA 3GEIA 2ZE8A 1U8YA 1S1MA 3AF3A 3BC1A 1E0AA 2P6UA 4UNPA 4DB2A 4LJ6A 1GITA 2ZAOA 4A6XA 5JCPA 3DOEA 4LJAA 4KYIB 2OESA 3U4QB 3FFAA 5BN5A 2ZREA 1X3SA 4CEHB 2RGXA 4KBFA 2BBSA 2O0HA 1BYUA 1GRNA 1DO2A 2W2TA 2ZQ5A 2ZS8A 2C04A 2WKPA 4W5WA 4B48A 1FW6A 1UDWA 2JGNA 1L2TA 2F1JA 3K8YA 3SR0A 4BQSA 2IYLD 4TZ6A 2W2VA 4HB2A 1HV8A 2HXSA 4OL0A 4M53A 3EPJA 4AY2A 4RZUA 2VP6A 1T8TA 5EUQB 3VAAA 2Q9AA 2OV2A 4HLUA 3FFBA 4JSTA 1XD2B 4KBGA 3LA6A 4OQXA 1U0JA 3K0FB 4B6EA 3QG1A 5K8UA 4X8MA 1R0YA 2G88A 4M1TA 2D3WA 1Q1BA 3IIJA 4P3YA 4Q00A 2RGEA 2ZE6A 4JSYA 4A15A 5UKDA 3GMTA 1OF1A 4AK9A 4RCYA 4UQOA 1RFLA 4Q48A 5EP2A 4Q4AB 1XMSA 2GF9A 2VP9A 1E2IA 2AKAB 2QTHA 3FMPB 4HDOB 4PPQA 4RD6A 1LF0A 3RS0A 2YWHA 1FNNA 2OHFA 4RVCA 2ZPTX 1TF5A 1E2NA 2O8FA 3B8HA 3MAAC 1Z08A 4A0FA 4Z54A 3E5HA 1IHUA 2PJRA 4MYUA 5TARA 3U61B 3D6TB 1NVVQ 3S1AA 4CGZA 3L0OA 4URXR 4BE7B 1W46A 5HPYB 4KJZA 2CHGA 1QG4A 3LAWA 1AZTA 5TY0A 5KSPA 1FTNA 1G4AE 4C0AC 3IGFA 1X6VA 5KU1A 2A5FA 1QVRA 1ZC3A 1LTQA 2OFWA 1UFQA 2BM0A 1CRQA 4FINA 1K6MA 3FTQA 1YZKA 4LJ4A 1AQUA 3EG5A 4DKXA 4JLJA 1M7BA 4TTQA 2H92A 2GRJA 3CRW1 4ACBA 2FMXA 5A0FA 3VKWA 5J47A 3SDZA 3IDQA 4QBFA 3W5JA 3WNBA 1N6HA 3DM9B 3RNLA 1WE2A 3N2EA 1EXMA 3KZ1E 4ERNA 3GEHA 1KHTA 2CNWA 2OBNA 3Q72A 3QEJA 3UANA 1NBMA 1F5NA 1HA3A 2KSQA 3ADCA 1G20E 1NN1A 1S0UA 2P5TB 3MMPA 4FW9A 2OLKA 2GWHA 2NGRA 3V4RA 2UVQA 3THXB 3AV0B 1KI3A 5B2ZA 4QJ3A 5JSZB 2F3RA 5L3QA 2A5YB 3IQXA 3MWJA 3WBJA 1XX6A 2QAJA 2Q9CA 4M2LA 4QL3A 3U44A 1I2DA 1G16A 4JYCA 5TMPA 1X8KA 4QHTA 5SZKB 4MRSA 1QG2A 2H1LA 1RIFA 3ZVNA 1CR4A 2NZJA 4PR0A 4HAZA 5H70A 1KYIA 5K8IA 2R6DA 2IWHA 1OW3B 2N1BA 2BHRA 5BN4A 2C98A 3CX8A 3RS7A 3ZD6A 3WYAA 1N3BA 4OI0A 1PZNA 3C15C 3WBKA 2V1UA 1R5BA 4D81A 2AWOA 3GLIA 1FUUA 1YQTA 4LPSA 4ARZA 2IX3A 3GLGB 1T3SA 2QORA 2QUZA 1W0JA 3TSOA 5GJWC 4AWXA 4HLDA 3LQRA 3H1TA 1KY2A 2BWJA 1CLUA 3LBIA 1UBFA 1FQKA 4UNQA 3W6NA 2ZRJA 3AH8A 4Q1FA 2GTPA 2XNDA 4I4LA 4MYCA 1DADA 2UZIR 2O52A 4DIEA 3VNUA 1JB1A 1LNZA 5DI3A 2NZ8A 1II9A 4PC7A 2GF0A 1EGAA 3E70C 4IDPA 5CITA 5EXPA 3H0KA 1QHHB 4RD1A 3IKJA 5D3MA 4MGKR 1E1QD 2BDTA 1XXHB 2IYRA 1OJLA 2ZS7A 2PH1A 2J7KA 1ZD8A 1VG8A 3RC8A 5JWHA 2IW3A 2GCOA 4BFVA 4QBGB 4HUTA 2QROA 4TT3D 4B6FA 3O8DA 3IEUA 4NBSA 1W49A 4Q4HB 4OHZA 8OHMA 1KJWA 5C4MA 2NO9A 3P27A 4Q9HA 2QY9A 3CW2A 3GJ7A 2ZUCA 1PJRA 3EIEA 4LC1A 4Q1CA 2NG1A 4G5QA 4LX0A 3VTKA 4DEXA 3WY9A 4M21A 3KXKA 2ZRAA 3OEED 5TV2A 3UXMA 1IOZA 1P72A 4MKHA 4C7OB 2HLDD 1TADA 2V7QA 3SYKA 4E22A 1E9BA 5JCZA 2GXSA 1E94E 4KSCA 4CDGA 3R9IA 1ZM4A 3H86A 2IF2A 4RSGA 2V6IA 4QGFA 2IS4A 1N5KA 2DPXA 4PC3A 4QRHA 4DLXA 3T61A 5FBWB 3QI2A 1KZ7B 4ZDWA 3TLXA 1B23P 3VFDA 2YOGA 1AN0A 5P21A 5JI3E 5JMTA 4XH9B 3K09C 4Q4JB 2O8EB 3F0TA 2ZRDA 1G18A 1SVWA 1ESMA 1N6KA 4KVGA 1E1RD 3K9GA 2W0SA 3BJIC 3BH6A 3RAPR 2FV8A 3H84A 1NLFA 2PT5A 1W7AA 1L4UA 4W5HA 2KJQA 2PX0A 3MD0A 1DVRA 4DEYA 1CS4C 2F9LA 5FFMA 1CIPA 4LYJA 1E4YA 2FEMA 3FHOA 5FPKA 3B9QA 1EFHA 1VKJA 2W6JD 4GMDA 5KDLA 4NYIR 4ZCLA 1ZNYA 2W2XA 3K9NA 1VECA 4OQMA 4NPHA 3DEFA 3NBYC 5KPJA 1BMFD 2VHQA 2V9PA 3PV0A 3OE7A 3L2BA 2RGAA 2F7SA 2XSZD 3NWJA 2QGZA 1E2PA 4V0MA 2WJYA 3OIVA 1XDBA 4LPKA 2AKYA 5E7JA 4LSGA 4PO9A 2YINC 4QC2A 5JS8A 2ZANA 4D0NA 5KSYA 3AVYA 3SU8A 2FEOA 2QA5A 2QPOA 4JVMA 2ZYTX 2O5VA 3GD7A 4DSOA 4URWR 3MJRA 3KQLA 4RZXA
chains in the Genus database with same CATH superfamily
2OFOA 3RWBA 3EPRA 3PVSA 4B35A 4IHFA 2PO5A 2BSXA 4LGCA 1L7VC 1RYNA 4Q5IA 3N2NA 1A0OA 4QT0A 3R7FA 5C1DA 3H5AA 4C12A 3Q9SA 3TIGA 1RM3A 3SEFA 5JYEA 3OCWA 3F5DA 4GF5A 1SQSA 2P4UA 4Y1RB 3G68A 3T5DA 1R27A 1E2KA 4CHGA 1SUFA 4J29A 1QH9A 1IEXA 3P2MA 1L7RA 3KWFA 1ZU4A 5SZIA 3EGXA 1TMGE 2ZT7A 3DEAA 4MO2A 1XRLA 4Q01A 4C05A 3CT6A 2Z6AA 3FTCA 1COWA 1C50A 1QB7A 2I4NA 3EXAA 1PJ8A 3HRHA 4YP1A 5HG0A 4LWQA 1IH8A 2YHSA 3FDZA 1HYGA 5CB8A 3KBOA 1JG1A 1SM4A 2ZAIA 3P26A 4RWZA 2IPXA 3PQ4A 2VPXA 4MEJA 1CKEA 4YVFA 1RQ2A 3L0PA 5E6SA 3ZDZB 3M83A 1J2EA 2CVHA 3W5BA 3F6CA 2NLOA 4GI1A 4RPJA 4YQZA 2FQXA 2O8NA 4YUYA 4DDVA 2QENA 3U49A 1QG6A 1HQYE 2W8BA 2YZMA 2JIZD 4GP9A 3WJAA 1N2GA 2IU6A 1ZJJA 2RHWA 4IQ8A 1HUQA 2OHJA 4DR5B 3IOCA 1YULA 4L4SA 4PXSA 1ISGA 3GPCA 2CMDA 4FBLA 5AM5A 3N2KA 1RQ7A 2JAWA 2DUUA 4F2WA 3HI6A 2GESA 4LRYA 3V8VA 3GGCA 4EG5A 4QJ4A 4RA9B 2QUHA 1BJTA 2VTKA 2HD4A 3ETJA 3U80A 5KWSA 2V7WA 2W5UA 4HZUB 1TRHA 3RTCA 2Q2VA 5JSQA 3I64A 4C03A 1PJBA 1WULS 4FKMA 4JOCA 4ALIA 3S40A 1E3TA 4I1PA 4TUYB 5K7SA 3RU2A 4QXAA 4BVKA 4H7FA 1A8HA 1H6AA 3I6IA 3K20A 1JDBC 4Y2JA 4YBZA 5AM1A 3VR1A 2N75A 3LLUA 4PSKA 5IDVA 1F2TA 3JR3A 2BP7B 3ZY4A 3VZQA 2O19A 2O57A 1ZGBA 2IZ7A 4O33A 2Y27A 4C4PA 5JNLA 2BF4A 3TB4A 2OO7A 5KPDA 1U6IA 5E1MA 3BT7A 1E5LA 1GSHA 1TM2A 2FP3A 2FY8A 3P2EA 4FQ8A 4G9GA 1SK9A 1BXZA 4WBSA 4ZOLA 4DUYB 4FE3A 3G3EA 3QE9Y 1GGVA 4W5TA 1OGYA 1X8JA 5AK6A 1XTPA 2AX3A 3RYHA 4ZT7A 1L5ZA 1PT5A 2DKFA 4U3JA 3D8RA 4BNDA 1SNYA 2ZJ5A 4UTRA 2XKBA 4X44A 1TAUA 1M8GA 3LK6A 3NW9A 4Z9YA 2GFQA 1ORVA 2H7XA 2WDPA 5ICSA 1XDDA 3I1FA 2G5PA 3DH0A 4JLVA 4AW9A 5IEBA 1X77A 1BX1A 3PGXA 1IWBB 3DO8A 4EVRA 3R9XA 2AC4A 4HUJA 5IVHA 1ZJ4A 4CWAA 2OLJA 2O5CA 1ELOA 1ZA1A 4TVOA 3U3RA 4UE3S 2XVMA 2FEPA 3HHPA 3STYA 1D0IA 3BGSA 3DMDA 5AKEA 2F4VB 4GGMX 1YC5A 2C9CA 4AULA 5CBKA 1TEVA 2GJKA 4PC6A 4DY6A 3KUUA 1FFHA 1ZLXA 2HHJA 1I9GA 2C95A 3L8CA 4EW6A 4OLJA 1JYSA 1X9GA 2XCIA 1D1QA 4BO7A 1X7XB 3T3DA 3W7AA 1CE8A 3SEQA 2ZJ3A 1B8PA 4YV7A 2E4VA 2MDTA 1X80B 3DPIA 2HCJB 3KPYA 1OX4A 2C9MA 5KNCA 2WJIA 3NC4A 1XZCA 2C1EA 4FT2A 4BFCA 3U5ZB 4PHCA 2VUHB 1WNTA 3WGMA 4F5WA 1OB5A 1KTVA 2ZSHA 4N65A 3UPDA 3WWEA 1LW7A 4F4DA 2IH2A 4TT3A 2HJ9A 3RV4A 2B37A 4LGMA 4IQ0A 1PR0A 2OO3A 3EZ6A 3SKVA 4UHHA 2L18A 2MWMA 2PMBA 4KXNA 5JXJA 3KT3A 1P3Y1 3K72B 4F45A 2FZCA 2D8MA 3V80A 1H2ZA 3JYHA 2PKWA 1SHUX 4PBRA 2Z43A 5EXXA 2QBYB 1ORIA 3WWOA 1DDIA 1GPUA 3BMNB 2YFYA 3MD9A 4I55A 4LHVA 5LJIA 3O4IA 1SQ0A 3C5VA 1AB6A 3HY6A 1DCTA 4Q9NA 3UWPA 4ZVUA 3SSNA 4KXXA 4KAFA 1SKAA 4Y1FA 3TL3A 2BD0A 2FEKA 2JJ1A 1TTTA 1LJLA 1X1RA 3NHAA 4JP8A 1W1UA 1U5AA 3A0RB 3C3WA 4XTRA 4C4OA 4CE6A 1KZ1A 2Q0HA 3PUZA 2C5LA 3QF4B 1CEQA 5B1SA 1GRVA 2H2GA 3TTSA 4ND6A 4V1CI 5JO0A 1NJ6A 1KETA 3RFCA 1W73A 3ZVMA 1U99A 1IXZA 3CZMA 1B7GO 2WWXA 1Y48E 3D6NB 3HY4A 4FS3A 2R11A 4O6VA 2PGOA 4RZ3A 4CM1A 5REQB 3V7FA 2AUMA 2BZGA 2C2BA 4KRGA 4C0JA 1NX9A 1CRPA 3P71T 3NHBA 1AOXA 1H2RS 2QPAA 1FX0A 4QFCA 3MAGA 3R7WA 1VIDA 2IXEA 1UBGA 2WF9A 3ROTA 3EXHB 3AF4A 4OB6A 2DZDA 4JYBA 4WEOA 5M5BA 3QPWA 2RGUA 2J5XA 3GCGA 3ZM6A 1AKEA 1D0SA 1BDBA 1G6HA 3V7WA 3ZM5A 3EVEA 2O3UA 1KEWA 1MCZA 4UUNA 2FGJA 1GQQA 2JA2A 3OSUA 2YY7A 3GG2A 4HWKA 3BFJA 1VA4A 5C8VA 2EJBA 3WYFA 4CVLA 4WACA 3MGAA 3I6YA 1OE0A 4QBHA 2Q5EA 1NBMD 2NVUB 4IDHA 5JHHB 1ODSA 1J1UA 5EQFA 1JDZA 1SCJA 3PX2A 2OAP1 1YB1A 3AFMA 4I5EA 3C74A 2P3QA 4I55F 4NZPA 1G60A 4DYHA 4WY5A 1XTJA 3BDAA 3D4IA 4H7KA 1VQ1A 3LY7A 1Z26A 4QOGA 4NONA 4HEQA 3DE2X 2XRYA 5H68A 2W6IA 5DM60 4TRRA 4YEDA 2O2ZA 5AO9A 1DKMA 1V1MB 1U9ZA 5BWNA 1SBZA 2CV0A 4UMEA 2AYYA 3H11A 4X85A 3QEMB 4IKOA 1ONBA 1MH9A 4IDNA 2C9DA 2CBGA 4HN9A 2J4DA 2RC6A 3VZBA 3W9YA 4AYXA 4BIMA 2QAGC 1B3BA 4OATA 4QZVA 3ESRA 4I9GA 1JTEA 1UJBA 3A1DA 2Q2QA 3WRWA 1N6OA 3PF9A 3I42A 1ESDA 4ZO9A 3UENA 1EVIA 2ORYA 2LVBA 1JG6A 2A5DA 2WWGA 2A9VA 2CB0A 3AQ4A 3HB4X 1ZWLA 2WM9B 2V6JA 2YWGA 5GOZA 4CZ2A 4F4FA 1RXWA 1TEHA 1P1JA 4I0WB 2AR0A 5CB0A 1K75A 4D25A 1R15A 5C80A 2J6IA 1USIA 1XFDA 1DAHA 1U8EA 2C61A 2QDKA 3WO0A 4A6EA 4EPVA 2H2FA 3EAGA 1Z6YA 2Q28A 1BWQA 1G8PA 3SJBA 3DDWA 4MZXA 1M6EX 3VV3A 3EVFA 4BKQA 1NRJB 4ZGWA 4XD2A 1W0JD 3N8KA 4RTLA 3QITA 3ZPXA 4PSVA 3ZWVA 2H1IA 4AZ3A 4D9NA 2CWWA 1Q0QA 2WQZA 1NVAA 5AUPB 1UBTS 3PJFA 4LWPA 4YTEA 4CMAA 2L42A 2DWCA 5AK4A 3IOBA 3TEMA 3USCS 4OG2A 4U2GA 3B78A 5JJIA 1G63A 2N46A 2ODBA 5E3JA 3P94A 2QJFA 4R01A 1QH1B 1FPMA 3NDJA 1Y1TA 1ZGAA 2JCXA 1PQYA 2WR8A 3P0RA 2P69A 5AM0A 3MLAA 4JCCA 4XYBA 2XNDD 2DSNA 1VLZA 2LCIA 3LC1O 1Z0JA 4QGHA 2C5GA 3A4YA 4IMJB 3TN7A 1LKZA 2C7GA 3EGDB 1CZOA 4QLBA 4U7PB 3KM0A 4PGFA 5LQSA 4HD8A 5MGNA 4AVYA 5F9HA 4F1JA 2C8KA 1L4LA 2H00A 2X6QA 2VNJA 2QI9F 2VQ6A 1O0SA 4M55A 4R84A 3IRUA 4ZQEA 3TTXA 1QV7A 1K7YA 1CS0B 3AUFA 3WP0A 3ZXXA 4B4UA 2ID9A 4HH3C 3KJXA 1JA9A 1DC3A 1USGA 3T95A 1KR5A 1E2EA 2EJVA 3ZGOA 2G67A 1CY0A 1BE8A 2PA3A 3TAHA 1OXVA 4UEKA 1XLWA 3MT9A 3G7UA 2AOWA 1ZM9A 2FYTA 4YDSA 4B6OA 3ENVA 2BHTA 1VCIA 2XWBF 3B36A 5F77A 4LHYA 5F4ZA 2LE0A 1GGJA 4YJ3B 3KQMA 1KJIA 3RSOA 5E7MA 3R0XA 2FUCA 4HDKA 5JYCA 4BNLA 3NNSA 5B4TA 3ZDQA 1E2FA 1A95A 1LNSA 2JIOA 2XVXA 3FZEA 4GPTA 4KQHA 2C4UA 4TYYA 2AQKA 2YC2C 4R6WA 2I33A 1A9PA 2NXEA 2J0SA 2P2NA 3G8YA 2GN1A 1BHSA 2QZJA 2WTAA 1U0SY 4CM9D 2Q5QA 5DOVA 1PS0A 5G4KA 5CM9C 2WB4A 2ZUWA 2PAFA 4IDEA 5CYFA 3VPGA 4D0SA 4QDOA 5KYXB 5H3LA 1RWXA 5AKZA 2JS7A 3GFFA 3PS9A 1ADCA 2YYSA 1CY8A 2PX3A 3R09A 1I32A 1WW2A 4X8LA 1V8OA 1EWTA 4ITVA 1Z4MA 2IHYA 2XXBA 3LYAA 4S2EA 2II6A 2CLSA 4LBWA 4E70A 3PCTA 3HCBA 2ZRLA 4RTKA 1HNWB 2C2WA 3SF0A 3T1YB 2OPHA 4RDIA 1BOOA 3UAXA 1EP2B 4B6GA 3HJUA 4QVKA 3KQVA 3N7TA 5IF9A 1Z5GA 1NDHA 2OFFA 3SQLA 1JLHA 3DDHA 3N2IA 3CW8X 2AXNA 3HWX1 4JBYA 3C8UA 1RQGA 3NDPA 3A0UA 1Z4KA 2EZ8A 1BDMA 5CLGA 3PHLA 4JJ7A 3DZBA 2FW7A 2A35A 3DAGA 1PR6A 5C18A 1NQOA 1TB4A 3AB7A 5LP1A 2QZZA 1GU0A 5ALVA 1I6KA 4YGXB 1SWVA 4EH1A 4WNAB 4IL5A 2EWVA 4JVNA 1YSCA 2FSPA 2ZTLA 4PTZA 1F2UA 3ZQ6A 2K87A 2Z6QA 5LWHA 3G2OA 5BNIA 5DI9A 1TM3E 5DSZA 2NQ8A 1XN4A 2IEBA 1B4DA 5T6MA 4R8KA 1QYIA 2O14A 3KJNA 3O75A 5JS2A 5JNVA 5FHRA 4AJ4A 2YUTA 3T1NA 2ZUDA 1Z16A 1L7XA 1A9XB 4W4TA 1EK5A 3RH0A 3TQOA 2QSJA 1PJAA 2ZB8A 3O4RA 5HNKA 2MYNA 1XCBA 2ZWPA 1RT9A 2B0JA 4E6EA 1NZFA 3OKAA 3OZFA 1BRMA 1QZUA 5CT4A 1AUVA 1ULTA 2BAGA 3G6KA 3SOZA 4AN4A 3EOZA 1UDBA 5K4HA 3EY9A 1FW8A 1U7PA 2EDCA 5EJ7A 1RYFA 2WUEA 5SYNA 5HOEA 2DFLA 5DASA 7REQB 3U13A 3PPYA 4EA9A 1XQYA 1OAAA 1SU8A 1RYEA 1U90A 2OT3B 2WABA 3BWBA 3HA2A 4OXIA 5B3JC 4LV5B 5HVNA 3ITEA 1WHTA 1Z0AA 2ZJ2A 3MCVA 3K0EA 4HUQB 3H5VA 3SJZA 5TC4A 3S1AB 1YS2X 1VKRA 3Q7PA 3CT4A 4XGRA 4A73A 1YCDA 2P3LA 2BSAA 1OR8A 1RLMA 2DPYA 1HLPA 4HDMA 2QUAA 4N0DA 3RS9A 4ZYWA 2FSSA 2HT6A 2P6NA 3AKDA 3BE8A 4P36A 4F8EA 2QVYX 3W2HA 4AY6A 4DIFA 4R1NA 3EGVA 3HXKA 3DBRA 5D01A 3WLFA 3JVVA 1VE9A 1Z6PA 2C58A 2G77B 1FA9A 1AGYA 1I4LD 1N0VC 2NPOA 1RBQA 1T4CB 4JLKA 2G8LA 4L16A 5FOUA 4P5EA 1DO8A 2DR2A 1CUVA 2Q5FA 2QN1A 4Q3LA 2I76A 1NSFA 1QHXA 3T3PB 2IEAA 3AZOA 3LUCA 1ZESA 4NG4A 3BXFA 3FMGA 5IN4A 5L4NA 5EP3A 4MUXA 3AUKA 1S3FA 2IDKA 4MQEB 3M4YA 4YUZA 2F8MA 1TMYA 3JQAB 4K2HA 4F5ZA 3PWSA 3P0EA 3B9RA 3Q98A 3V8EA 2IU3A 3OC0A 4LMRA 4BUCA 3F6BX 1GADO 4C2UA 3UQYS 4H3VA 3GT7A 1I0IA 3ETHA 3P9IA 1O94C 3CR8A 4UMFA 1NONA 4WXHA 3AW9A 3G9XA 2SICE 2PMEA 1T2UA 3NFRA 3PCXA 2O05A 4WH0A 4BRUA 1SXQA 3L49A 1GQRA 2YQZA 3G2JA 5KKAA 1Q15A 1AU9A 4J1QA 3C3EA 1IG0A 2XCOA 5JIBA 3MUOA 1SQ5A 3BWXA 1ILWA 3LL4A 4X24A 3V6LA 3UK0A 1YL5A 1NLUA 2DB3A 4QBIA 2WKRA 2R68A 4IIVA 1HFEL 4IEIA 4ZKEA 1MOPA 1HYEA 1H8HA 2C9YA 3FPHA 4AO7A 3AFHA 3LT5A 3FWHA 3NIWA 4Q7QA 3SS7X 2Q07A 4LTDA 3FFWA 5T7BA 1ZWKA 3PB3A 4PFKA 1XHEA 3UAYA 4UTXA 2GVNA 4UM9D 4BMXA 4KN5A 3DA8A 1KOFA 4M0CA 3GRRA 1GKLA 1S3SA 2HOQA 2X1HA 1XUOA 4H16A 4C0KA 1TYAE 1WXHA 3IO3A 4NS4A 3U3DA 3D8SA 1LK0A 1QWOA 3A25A 3FUXA 3ND9A 3ZWDA 3ZX4A 1ZO8A 5F51A 4ZN6A 2VF2A 2JPDA 2IY9A 2VXYA 3M4NA 4IMIB 1WZ2A 1UJ6A 5DH9A 3FGOA 3MNFA 4DRXA 4W7SA 1P2BA 1QSGA 1UCFA 1IEWA 1XI2A 1P17A 5BVGB 5JPDA 1HTTA 3SKXA 3PNKA 3C8MA 2BKAA 3AUAA 4DMGA 2IXDA 3CRRA 3NBQA 5KQRA 5TS2A 3GW8A 3NJ4A 4E2XA 1ZJYA 4ZEXA 4Y6LA 4LOIA 1RJDA 2Z2XA 3NHJA 5AW9A 3CFYA 3GH1A 3PLNA 2OSBA 1DIGA 2GYYA 3IYLW 4G24A 4QXMA 4C30A 4AWBA 1VP9A 4EA7A 1X1BA 4P53A 4K6GA 2QMYA 1G9XA 3OIDA 2UV8A 2WIKA 4HCJA 5D7BA 2WD7A 1DBIA 5B7NA 3H97A 5J1TB 5LLSA 2X8JA 5AVYA 3HCNA 4OB8A 4CQLA 3WDMA 2OORA 1JF8A 2CHUA 1X7YB 1HYBA 3ZWWA 5B1DA 1O77A 1K6JA 1DHTA 3RVPA 5JEEA 2RARA 1KPGA 2FX3A 4Z4QA 1HE5A 3H1BA 3OM1A 4B3FX 4YAGA 1UMDA 2GCOB 3PRYA 4UASA 4X54A 5ALRA 3BAZA 4QU0A 2XUKA 1I4DD 2A84A 4DIMA 1ORWA 4ZJUA 2VT3A 4N47A 3ZD9A 4ZCSA 5I7EA 1NUHA 2A59A 3AO0B 4FZJA 4YHBA 4HLQB 1CJKC 3A4LA 3AJ8A 4UPVA 4ALJA 1E3LA 4DM7A 2QVZX 2AI2A 4DJDC 4MK4A 2XEXA 1LV7A 2TRSB 4IHKA 3CH4B 5D2CA 1A2BA 3EZ9A 4FMPA 1I2BA 4U7TB 3HJBA 4KXWA 4S05A 3AJAA 1TK3A 4D46A 2YICA 5KYVA 2C96A 3U7RA 1MLDA 4EB6B 2IW1A 2AI1A 1NMQA 4HX2A 3EMKA 4BNYA 4KR3A 3KSRA 1GY8A 1VE3A 4NBVA 1UDAA 1SUSA 2WJ4A 3P1JA 4YBRA 1M83A 4HZGA 2R87A 2JC3A 2V8OA 1XD9A 3AX6A 3ZVRA 1U1FA 4GZ6A 3DVQX 1GQSA 1LTKA 5EUCA 5JY1A 3KSAC 2P6RA 2DR0A 3DD5A 3GVIA 5C4GB 2Y76A 2Z4RA 1KQOA 4GUAA 4AYWA 2A78A 3X1KA 2FW1A 3OD5A 5A4FS 5JNRA 3QVJA 5HF6A 1VGQA 2VHEA 1FYEA 1N6NA 3JAKB 3UJBA 4G09A 1JWAB 3P0JA 3K9HA 3ZWAA 3F5MA 4ZOEA 1FP4B 1IHOA 4OH1A 1GJRA 1EHYA 3OCZA 5E9WA 1BDHA 5DZSA 4PRLA 4HX5A 4P3OA 4QOFA 1FF9A 3HBNA 4WCFA 5ALPA 4B5LA 5CUQA 4YI5A 2DBYA 3TXYA 3V4FA 3D0QA 1DAIA 2TS1A 3KUXA 4X1KB 4ENRA 1CHNA 4GKKB 4DA9A 1Y33E 4MLPA 1MRNA 1UBEA 4CQNA 4N3AA 2FPWA 3REGA 2IS1A 2Q4BA 2NOAA 1MJFA 1CQXA 3EEBA 3GJXC 3HDTA 5M2QA 2A1IA 3OQHA 4MW2A 3Q87B 1P73A 5KTSA 2VTEA 4QG7A 2UUAB 1JHXA 3OPQA 3GYGA 4H0CA 1N1DA 4Q4CA 3QXCA 2I4MA 3ISTA 4YXWA 3K1TA 3GLHE 1I1OA 1R0LA 5I3CA 1IZZA 2BDUA 2EIXA 2QZ4A 3QFRA 4LRUA 4O29A 2D3TA 2QN6A 3KKEA 4JQCA 3TW4A 3U7IA 2CL6X 4J91A 1J33A 1WUHS 1TQDA 2D2EA 4EPYA 3RAFC 3T9BA 2FF7A 5FUVA 1Q57A 2D2XA 4IR7A 2B4RO 3VXKA 2GVZC 4IOJA 5A3RA 3PTLA 3KV3O 4EX7A 5C2JB 4H1HA 4UUOA 3ZJ5A 2Z56A 3H9UA 3QHQA 3SR4A 4AD8A 5KOJB 4R3WA 3Q3HA 4RS3A 3RU3A 4H59A 3FF1A 1QE5A 4UBLA 2JLQA 3OEHD 3ZV7A 3ZD7A 1UXGA 4I4IA 5JVDA 5AKLA 1GQ2A 2VS1A 3KC2A 3IA7A 3JASB 2OHIA 4TRMA 5KI6A 2C99A 3R0ZA 3LKBA 1Z62A 2QTBA 1W94A 2F17A 1PL0A 4PCVA 3SC2A 1NYRA 5M29A 4TLBA 3CUEF 1XZPA 2HUPA 1JEDA 2WIGA 3IESA 3GP5A 1K2VN 2QMQA 4NBLA 4O02B 1DXHA 1HT3A 2GAIA 2O2JA 4ZREA 4RDCA 3K6JA 4KQ6A 1MA3A 4M9RA 1KI6A 4Q47A 4RY2A 2I7DA 4EYKA 2UZAA 1HE3A 2Q41A 4YRFA 4EY5A 4YX9A 3RVLA 5LUAA 2NO7A 2Y68A 4UHBA 2JLUA 3A3KA 4ISCA 2BGWA 4XGQA 4DCTA 3COJA 3HNRA 5ALLA 5JCJA 3CJQA 4Y30A 2B8WA 4OI1A 4KNYA 1P44A 2VSOA 3WLJA 5BNWA 2QE7D 2PNJA 3V46A 4RJLA 1MJHA 5CEEA 3IP3A 4IOMA 3LMKA 1ZN9A 3DOCA 4NU8X 1UK7A 2Q99A 4ETMA 1ONPA 2YWRA 4EJ2A 1IXRC 5FNVA 3RHSA 2WZCA 2W6CX 2OL4A 2OZLA 2SBTA 1MABB 1WR8A 2HADA 3QY9A 3FTFA 4MP8A 1S3GA 4R1OA 1T1RA 2W83A 3THWA 1R0SA 2AJTA 3FDIA 4IAOA 3CVWA 3WQRA 4GBED 3BYZA 1Y3BE 4Y0VA 2AXPA 3KKOA 3DMRA 1FFXB 1P39A 3KDAA 1CJTC 4TTVA 1EP3B 1WDLA 3KFVA 2QMOA 1LGYA 1YZHA 1KO5A 4M4SA 3TLBA 2R9VA 5IBQA 1EUZA 3KAQA 5BR7A 5CFLA 3C3CA 3USES 5AKIA 1HM5A 1B43A 4PRKA 4DL9A 1MAWA 1PJ3A 3Q6MA 4R0VA 1E5DA 4HFRA 3OIUA 4PZDA 4BKMA 3UNXA 3TKLA 4Z53A 2J31A 2QTWB 3EXFA 3K3PA 3P9ZA 3MTJA 5CB6A 2VQSA 3DHNA 1N0WA 3LLSA 4OL9A 1PYOA 1EQUA 2B25A 3DOHA 2ZI4A 1EUQA 1R6TA 3P9PA 2CLEB 1SH7A 3AHEA 4JENA 3IERA 3PNQA 1NE7A 2IT1A 1UQTA 1DKLA 2W9XA 3N2GA 3F1KA 3HGTA 3BKXA 4D96A 3SSMA 3OJXA 2Y4NA 3Q7SA 3CMMA 2R1ZA 4LZPA 2BFDA 5LFAA 3I0NA 5F5LA 2WZBA 5B4UA 1NN3A 4LF8B 3L1KA 1AF4A 4X6YA 5H82A 4J94A 1T0HB 3PWKA 1N9KA 3STUA 3IAEA 4J1TA 4ZC1A 4JI2B 1QZZA 4F4IA 4LK3A 2FUG1 3GNQA 4JUDX 5LA6A 1B76A 2R6JA 5FP0A 1FX1A 3HCOA 4GI7A 1BWSA 1CDZA 1AUQA 2P7HA 3GA5A 1T6ZA 1PG5A 3PYLA 4LOKA 4TM8A 4TRNA 3TK1A 5LWQA 1GTRA 2EWMA 1CUZA 1OD6A 1PTJA 4MUEA 1E79D 3ZDXB 1RAAA 3LUGA 2BOVA 4K81B 3I5YA 4CTJA 2J3EA 4YP0A 4B9EA 5EPEA 5KNDA 2XRZA 2FRDA 2BCJQ 3TNJA 5E6RA 2BMJA 3CG4A 1E98A 1WA5A 4FEAA 2PLAA 2YDXA 1VCNA 1VJ1A 2A4KA 3NP9A 4KXFB 1ECGA 1P19A 3H5WA 1CULC 2FSVC 1F4VA 2BP7A 1M34A 4LSZA 4NH0A 3VSDA 4FB5A 3NPAA 3GC6A 1P7VA 1KDOA 3COPA 1XEAA 2O0KA 4PFJA 4YRGA 5A02A 3CCBA 1CB7A 1PD1A 3W9SA 1E2BA 1O97C 4N82A 1NSTA 4RETA 4C5CA 4UTPA 2W90A 3I4CA 2JCVA 4G41A 4L50A 1EGQA 2LZ0A 2FMUA 4NPAA 1VLMA 3HWRA 2NXNA 3WOVA 5CBPB 2QLBA 4O5OA 4AUNA 3JRXA 1JLMA 3WLPA 2GZHA 2QYTA 3JCZA 3OZXA 1I3CA 1YS6A 1SO8A 2R25B 4FNOA 3M3DA 4F86A 4ARSA 5EJEA 3WAJA 1TT7A 3FNHA 4GWLA 4HC4A 5LNK1 1ZL0A 2XOKA 3AHGA 4MR7A 2C4VA 1FRFS 3MILA 3TF5A 2JBAB 2XH8A 3FLAA 4CUKA 5CVDA 1PNRA 5G1NA 3UFBA 2I87A 4TSFD 5FOWA 1F4LA 1D6JA 3W5UA 4FN5A 4B7UA 4QOHA 3EIQA 3TRIA 3JQFA 5IUJC 5EUBA 4DRYA 4HYYA 1PWEA 1LPPA 3JQQA 3RJMA 1WUTA 2PX2A 5DGXA 2WEKA 3PGA1 4ZCQA 4D8XA 4EHDA 3M5PA 1QPGA 4I4NA 2RK3A 3AYZB 4BO0A 4B3DA 4JIMA 1C0IA 4L57A 4GECA 1HXHA 3KT6A 221PA 1AA9A 3V7UA 3DKPA 4XIYA 3GROA 3WGUA 4QGSA 2ZR8A 3OLZA 4UQLA 4C07A 4US1R 1OAOA 1X7XA 2BMVA 1OKKD 1EXNA 2E4WA 2Q1WA 1GGKA 4G85A 4OQFA 2OD7A 4Q05A 2VBCA 1U04A 5BYJA 2CSXA 2HM7A 4HWOA 3VSAA 4DM4A 1X80A 1PZMA 1ZZGA 2WZQA 1X1CA 2ZVPX 3BWYA 2GS9A 4P4SA 1Z07A 4R9NA 2ONJA 5KTKA 2GEDA 1DC4A 2YS6A 3WGJA 2Q5JA 4Q37A 3H1EA 3RDPA 2GHIA 2P90A 3DL2A 3HR4A 1HT0A 4IMRA 2GTIA 2JH8A 2ZDGA 3EQ9A 4G8DA 4P7JA 1NXWA 3GFVA 1XL0A 1AGPA 3DHVA 1K89A 4JA2A 4BJHB 1APBA 1LU9A 1A97A 4ZT2A 4A1FA 5J5AA 3FN4A 1Z39A 1CQPA 2VAWA 4FNAA 2GZ1A 5D5QA 1RNLA 1WP4A 2G9ZA 1J4AA 1SVUA 1VG1A 2FOIA 3A6DA 3OZCA 1YV9A 4KI7A 2NQTA 4C6TA 5A9SA 2F1IA 3FPSA 5HK9A 5EQTA 2VTBA 2IZOA 3WFJA 4YR7A 2ECPA 3D54D 1E0DA 1RSZA 4RZIA 3SNKA 5G41A 4XX0A 3TIVA 4KYUA 1NBEA 5DVZA 1GV0A 1C3XA 4P83A 3AM5A 2V4ZA 3GYBA 4FOSA 4DLWA 3K0CA 1TK2A 3TUJC 2XWPA 2LD4A 2EFYA 3PQDA 4D56A 3QENA 5EJ6A 2QTGA 1PQ4A 1YA8A 1FRZA 2C20A 5LB4A 3TO5A 4XM2A 5IAGA 1ZGGA 1MC1A 3W34A 1PR4A 1U9IC 3UHAA 3VNSA 5CA1A 3GT4A 4ZCIA 2X1MA 2O4UX 1DBWA 4UBOA 2G80A 5DM0A 2VCEA 5E0KB 4B7ZA 1PGQA 1K06A 4HV4A 4ND1A 1UK8A 1IC6A 2X2PA 1V37A 2IUEA 1G0NA 1LPAB 2KX7A 1PGPA 1LDMA 2VSXA 3D3WB 3HEAA 4HDRB 5DYWA 1WSAA 2Y1EA 3MWDB 1A69A 3EMDA 1DDOA 4DQUA 1I10A 3OICA 3QBDA 1NM5A 1WTCA 1Y42X 2I65A 4Q19A 2IIVA 2XZTA 2O8CA 3PPIA 3TSZA 4EX6A 3KOXA 1EUDA 4QUIA 2H4XA 1Y7PA 4JC0A 3HKDA 3LUJA 5J23A 5FUYA 1PGOA 5HCNA 5BV8A 4DA8A 2PKQP 5G02A 4XD7D 1FU4A 5H7XA 4DWJA 1B8OA 3CU5A 3QYAA 4JT2A 1KI1A 3HJFA 2ZYHA 1EDEA 3FSJX 4LRWA 2HU8A 4MAMA 1RHMA 1OHHD 3WIEA 4XCVA 3AFIA 5SZHB 1UPAA 4S1VA 4G0YA 4X63A 2INGX 3EOBI 3R9WA 1Q19A 3THRA 2GYWA 4O59O 3AVOA 4QHYA 1V1MA 3UKJA 3HUEA 2GN2A 5L8VA 4RH3A 3FSRA 5TGTA 2QD1A 1NV8A 1UPUA 4ND3A 5EJGA 4ZVQA 4ZEWA 3VC2A 3X1XA 4HDNA 5EKTA 3D5EA 4LFAB 2HEGA 2QVGA 1CJCA 1SZPA 2NQ2C 3OZRA 4MVJG 4PYKA 3L84A 4BMCA 3PL1A 4J16C 2FR0A 1UAAA 1FRNA 1WKCA 1B0UA 1KBZA 4IIHA 121PA 1QZ3A 1Q3TA 4CDMA 4EG8A 2WKSA 1FUIA 1X0XA 2B36A 1DE0A 1SU6A 2APJA 2EQAA 4J49A 5CCDA 3BL8A 5A5EA 5C1IA 5KTTA 1R4NB 4BNWA 4C0XA 1LA2A 4NCNA 2QJWA 4XWKA 4DSAA 3COSA 3QKRA 3H19A 3T1OA 1J00A 1DCMA 5CDFA 5ADVA 3JAWB 2YV1A 4ZQGA 2OILA 4MVJI 4IIFA 1R8SA 1XALA 3L8GA 4B79A 3MJCA 4B4DA 2B8NA 4D6XA 3VNVA 1FUKA 3D0KA 3EQ6A 4HKTA 1KMQA 5FWAA 5A3SA 5CA1F 2O48X 4C78A 4BX0A 1JTFA 4KITB 5HE9A 2NU6A 2R65A 4IIXA 4RIGA 1Z8HA 2W6NA 1L6IA 3LYUA 3WSEA 3MYRA 1QYRA 3NH6A 3B1XA 4Z4GA 3HDHA 4JUCA 3VYWA 4E5UA 1KDRA 1G4HA 4B2PA 2W6OA 4CT0A 2NU7B 4MHTA 3DAYA 2OM6A 4FHZA 4A2WA 4L0MA 5DXJA 1PV1A 4NK5A 2HIAA 4BMDA 3NHSA 3SC4A 2R6AA 2ZPAA 2FKNA 2HW8A 4I81A 1Y5RA 1ENPA 4CLOA 5IXYA 1Y8ZA 3ZZMA 3U31A 4YJ2F 4X1IB 1XRSB 1J2TA 1JJ7A 2ZUEA 3EGDA 3VC7A 3QFCA 4RESA 1IWOA 2O0JA 2VC2B 3NBXX 4K9OA 4TQUS 1JR3E 2IYXA 3G7NA 4G89A 4AY4A 3L07A 4M1KA 4ZRMA 4QYMA 1NUPA 3OPYI 1J20A 4WVFA 4E5MA 1D04A 4GI5A 4AUMA 4YCAA 1YOVB 3A10A 2VRBA 2ZJYA 4YCJA 3V7NA 5EG5A 4A92A 4BGVA 3LD9A 1PZHA 2A7XA 3KVYA 5M34A 4CXMA 4WVLA 1JDSA 4MV4A 4C3UA 3TZQA 1VL6A 2B30A 1JFRA 2MMCA 3NHKA 4KAJA 4YJ3A 5LOVB 1LD3A 1II8A 1X74A 2J5BA 3PUXA 4FONA 1ILEA 1NVWQ 2PRIA 3MT7A 3P4UA 1WVMA 4TMXA 4DCJA 4CLDA 3RAGA 1ZC4A 2E89A 3B6EA 4LNHA 2PQ0A 4TSRA 4XIIA 5ER6A 4ENWA 5CPFA 2I7VA 2QI9C 1D0VA 1NQ5A 3BRQA 1FFAA 2RMKA 1G5IA 3GJYA 4G0NA 2OCPA 1IUKA 4PE5B 4Q21A 4RQTA 2C78A 3DULA 4G26A 4ZYYA 2OHXA 3HN6A 3SYLA 2VDVE 3JD4A 1CEEA 2E2WA 1VLHA 3BGVA 3FXAA 3IIIA 2EJUA 5JTTA 1WXGA 2H8GA 4DR1B 1TUBA 3WSVA 2IDJA 3W2GA 3W7VA 1N2CB 2CFCA 2P91A 3EXIB 1OFIA 3MGBA 1NP6A 4EK9A 1ULZA 3FDFA 1GLNA 5BY2A 1ENYA 1GTSA 1YB6A 3D3EA 4B32A 1PD0A 1BZYA 1VRWA 2L17A 1J23A 5IJ9A 2CMHA 1Z2PX 3H8WA 2FWNA 3MPUA 4OK5A 3WKDA 1YJBA 4JUAA 4DMUB 4IWGA 1YFJA 4MUBA 1ATZA 4MP6A 10MHA 4KRFA 1J56A 3K53A 1YNSA 4Q6BA 2CK3D 2C8LA 2REQA 2I6FA 2FWIA 1LQTA 1A7KA 1QIHA 4POAA 3U4QA 3VYRB 5BOVA 5JYBA 2B1RA 2IITA 2ES4A 1Y8RA 2YIVX 2FG7C 1T0UA 2A6PA 2JDID 4UW9A 1QOPB 4BB0A 1GILA 5ADWA 1DS6A 1A8PA 2RBKA 3N0WA 4AL4A 3O1JC 4WIAA 1XK6A 1ZX1A 3DKKA 3L82B 3UK7A 3K32A 1IULA 1M2OB 4BMOB 4Z7OB 3QEAZ 3KOMA 1UMBA 2FMFA 5BMVB 3FF4A 3DAFA 4WECA 4MOWA 4XYEA 5DK6A 4JV5B 1U9JA 4P54A 4WNAA 1MIOB 5DWVA 2JLVA 1ZIDA 2O8FB 1JMKC 4KIFA 5KJEA 1UKVY 2CFIA 1WOYA 3ZWPA 4YJHB 4TXHA 3UAZA 3A4TA 3KL2A 4ZYVA 3WGLA 1SKBA 1UIMA 1CVRA 1XD2A 3F3KA 4KLZA 1PFVA 1P62B 3DE4X 1WXDA 4TV9F 2KLBA 5K05A 3JQCA 2WAYA 3E22A 3K0FA 3ZGLA 2ZSAA 1DNPA 2XB4A 3PWTA 1ZK0A 2GFHA 4B8WA 1ZBQA 2DPMA 3L0YA 3QTBA 3MB5A 1USVA 5JBQA 4ZVMA 3WLQA 1C1HA 1H93A 5ARBA 2P40A 3FBTA 4A5OA 3NHWA 4XLLA 4WZZA 3VRHA 4BFYA 5BQFA 2NU9A 4BJ5A 1SD2A 1YR1A 3FYUB 4XB2A 3AM1A 3FKSD 3L7CA 4DDUA 2HJRA 1Z73A 3VPFA 3AETA 4RZQA 3OEWA 1IIRA 3PGJA 2PKXA 3DGFC 3E0XA 3IT3A 3L93A 3OTHA 2NTYC 3EXG2 4U02A 4URFA 4WXEA 7REQA 4Q1VA 1W88B 2BTQA 4MS1B 4PX2A 1A9SA 1S4QA 3JY6A 2X9NA 2GJ9A 4HUQA 4BRZA 5KSOA 3ZWBA 3NWBA 5L9AA 1ADBA 1GUZA 3H0CA 3GFSA 2ZEJA 2DE0X 4ZEOA 4KHPB 2FEAA 2R8XA 3PEVA 4GG1A 4HQKA 1UM8A 3B9BA 5FR1A 4Z1MD 5AW5A 2GPJA 3L92A 2GH1A 1DUIA 2PWBA 4AS1A 4OXRA 1L9KA 1B42A 1IZYA 5ENZA 3DL7A 3IPYA 3I12A 5KOHB 1HEYA 1OREA 1OROA 1PK9A 2FSUA 2PGIA 1NW5A 3IRVA 3JQGB 4Q7LA 5ALJA 2IS6A