The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
39
|
sequence length |
120
|
structure length |
119
|
Chain Sequence |
VLGWRSFDLLLNSKNGVAAFHAFLKTEFSEENLEFWLACEEFKKIRSATKLASRAHHIFDEYIRSEAPKEVNIDHETRELTKTNLQAATTSCFDVAQGKTRTLMEKDSYPRFLKSPAYR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Molecular architecture of G{alpha}o and the structural basis for RGS16-mediated deactivation.
pubmed doi rcsb |
| molecule tags |
Signaling protein
|
| source organism |
Mus musculus
|
| molecule keywords |
Guanine nucleotide-binding protein G(o) subunit alpha
|
| total genus |
39
|
| structure length |
119
|
| sequence length |
120
|
| chains with identical sequence |
D
|
| ec nomenclature | |
| pdb deposition date | 2008-02-07 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00615 | RGS | Regulator of G protein signaling domain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 2 | Regulator of G-protein Signalling 4, domain 2 | ||
| Mainly Alpha | Orthogonal Bundle | Regulator of G-protein Signalling 4; domain 1 | Regulator of G-protein Signalling 4; domain 1 |
#chains in the Genus database with same CATH superfamily 1EZT A; 2BV1 A; 2AF0 A; 2JM5 A; 2OJ4 A; 3KRW A; 4TNB A; 1FQI A; 2IHD A; 2V4Z B; 2IK8 B; 3C7L A; 5DO9 B; 4EKD B; 3NYN A; 1EMU A; 2EBZ A; 3KRX A; 2D9J A; 2BCJ A; 2ODE B; 4TND A; 4MK0 A; 3PSC A; 2DLV A; 3NYO A; 1FQK B; 3C7K B; 1AGR E; 1FQJ B; 3CIK A; 2OWI A; 2CRP A; 2IHB B; 5HE0 A; 5HE3 A; 4PNK A; 3V5W A; 2BT2 A; 5HE1 A; 1DK8 A; 1OMW A; 1EZY A; 1CMZ A; 3PVW A; 2JNU A; 5HE2 A; 3UZT A; 2GTP C; 3PVU A; #chains in the Genus database with same CATH topology 1EZT A; 2BV1 A; 2AF0 A; 2JM5 A; 2OJ4 A; 3QYF A; 3KRW A; 4TNB A; 1FQI A; 2IHD A; 3I5Q A; 2V4Z B; 2IK8 B; 3C7L A; 5DO9 B; 4EKD B; 3NYN A; 1EMU A; 2EBZ A; 3KRX A; 2D9J A; 4HTE A; 2BCJ A; 2ODE B; 4TND A; 4MK0 A; 3PSC A; 2DLV A; 3NYO A; 1FQK B; 3C7K B; 1AGR E; 1FQJ B; 5REQ B; 3CIK A; 2OWI A; 2CRP A; 2IHB B; 5HE0 A; 5HE3 A; 4PNK A; 3V5W A; 2BT2 A; 5HE1 A; 1DK8 A; 1OMW A; 1EZY A; 1CMZ A; 3PVW A; 2JNU A; 5HE2 A; 3UZT A; 2GTP C; 3PVU A; #chains in the Genus database with same CATH homology 1EZT A; 2BV1 A; 2AF0 A; 2JM5 A; 2OJ4 A; 3QYF A; 3KRW A; 4TNB A; 1FQI A; 2IHD A; 2V4Z B; 2IK8 B; 3C7L A; 5DO9 B; 4EKD B; 3NYN A; 1EMU A; 2EBZ A; 3KRX A; 2D9J A; 2BCJ A; 2ODE B; 4TND A; 4MK0 A; 3PSC A; 2DLV A; 3NYO A; 1FQK B; 3C7K B; 1AGR E; 1FQJ B; 5REQ B; 3CIK A; 2OWI A; 2CRP A; 2IHB B; 5HE0 A; 5HE3 A; 4PNK A; 3V5W A; 2BT2 A; 5HE1 A; 1DK8 A; 1OMW A; 1EZY A; 1CMZ A; 3PVW A; 2JNU A; 5HE2 A; 3UZT A; 2GTP C; 3PVU A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
