The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
19
|
sequence length |
113
|
structure length |
113
|
Chain Sequence |
MNNHIRLRKAEGKWVIRTDSAVLGETLNAIELTEGSRDPVIYFPREDVAMVMFDKSEKVTACPLKGEASYYSIVGASGTLKDAAWSYESPKEGLEAIAGYLAFAPDCTKVGQY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Crystal structure of Protein of unknown function (DUF427) (YP_001042567.1) from RHODOBACTER SPHAEROIDES ATCC 17029 at 2.51 A resolution
rcsb |
| molecule tags |
Unknown function
|
| source organism |
Rhodobacter sphaeroides 2.4.1
|
| molecule keywords |
Uncharacterized Protein DUF427
|
| total genus |
19
|
| structure length |
113
|
| sequence length |
113
|
| chains with identical sequence |
B, C, D, E
|
| ec nomenclature | |
| pdb deposition date | 2008-06-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF04248 | NTP_transf_9 | Domain of unknown function (DUF427) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A |
#chains in the Genus database with same CATH superfamily 3DJM A; #chains in the Genus database with same CATH topology 3HCI A; 3E0M A; 3P3K A; 3EQT A; 3CEZ A; 1H7Y A; 1FWQ A; 4CI1 B; 3ZD6 A; 2QFD A; 4A2V A; 2FU5 A; 2LVL A; 5F9F A; 2QFB A; 2LOY A; 1YZ1 A; 2RQA A; 2RQB A; 3CXK A; 4CI3 B; 5F98 A; 4TZU A; 1TXJ A; 3E0O A; 5AMH A; 4V2Z A; 2RMJ A; 4V30 A; 4V31 A; 2HR9 A; 3ZD7 A; 2KV1 A; 3MAO A; 3EBM A; 3OG8 A; 3HCH A; 2W4R A; 4TZC A; 5F9H A; 1H6Q A; 2K8D A; 4V2Y A; 3LRR A; 4BPB A; 3DJM A; 3WX2 A; 4A2X A; 3HCG A; 3WX1 A; 1L1D A; 2KZN A; 4CI2 B; 2YKG A; 3GA3 A; 3NCU A; 2KWB A; 5E3H A; 1HXR A; 4TZ4 C; 3FAC A; 3HCJ A; 4AY2 A; 3LRN A; #chains in the Genus database with same CATH homology 3P3K A; 3EQT A; 1H7Y A; 1FWQ A; 3ZD6 A; 2QFD A; 4A2V A; 2FU5 A; 2LVL A; 5F9F A; 2QFB A; 2LOY A; 1YZ1 A; 2RQA A; 2RQB A; 5F98 A; 1TXJ A; 2RMJ A; 2HR9 A; 3ZD7 A; 3OG8 A; 3EBM A; 2W4R A; 5F9H A; 1H6Q A; 3LRR A; 4BPB A; 3DJM A; 4A2X A; 2YKG A; 3GA3 A; 3NCU A; 2KWB A; 5E3H A; 1HXR A; 3FAC A; 4AY2 A; 3LRN A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
