The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
105
|
structure length |
105
|
Chain Sequence |
SMEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHADSVAKRPEHNRSEALKVSCGKCGNGLGHEFLNDGPKPGQSRFSIFSSSLKFVPKGKETSA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Oxidoreductase
|
source organism |
Homo sapiens
|
publication title |
Crystal Structure of Human Methionine-R-Sulfoxide Reductase B1 (MsrB1)
rcsb |
molecule keywords |
Methionine-R-sulfoxide reductase B1
|
total genus |
20
|
structure length |
105
|
sequence length |
105
|
ec nomenclature |
ec
1.8.4.12: Peptide-methionine (R)-S-oxide reductase. |
pdb deposition date | 2010-03-24 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Peptide methionine sulfoxide reductase. |
#chains in the Genus database with same CATH superfamily 4TZ4 C; 3HCH A; 3HCG A; 2K8D A; 3HCI A; 3WX2 A; 2KV1 A; 4V30 A; 3CEZ A; 3HCJ A; 4V2Z A; 5AMH A; 4V31 A; 3MAO A; 4CI3 B; 4CI1 B; 4V2Y A; 3CXK A; 4CI2 B; 4TZU A; 3WX1 A; 2KZN A; 1L1D A; 3E0M A; 4TZC A; 3E0O A; #chains in the Genus database with same CATH topology 3ZD6 A; 2FU5 A; 3OG8 A; 4TZ4 C; 3LRR A; 1HXR A; 3HCH A; 5E3H A; 3NCU A; 2QFD A; 1H6Q A; 3HCG A; 2LOY A; 2YKG A; 2K8D A; 3HCI A; 3WX2 A; 2KV1 A; 1TXJ A; 1H7Y A; 3DJM A; 4V30 A; 3CEZ A; 3HCJ A; 4V2Z A; 2KWB A; 5AMH A; 4A2V A; 4AY2 A; 4V31 A; 1YZ1 A; 3GA3 A; 3MAO A; 5F98 A; 4CI3 B; 4CI1 B; 3EBM A; 5F9F A; 3P3K A; 4V2Y A; 1FWQ A; 2RMJ A; 2RQB A; 3CXK A; 4BPB A; 4CI2 B; 4TZU A; 3WX1 A; 2HR9 A; 2KZN A; 3LRN A; 1L1D A; 3EQT A; 2LVL A; 3E0M A; 2RQA A; 4TZC A; 5F9H A; 4A2X A; 3E0O A; 2QFB A; 3FAC A; 2W4R A; 3ZD7 A; #chains in the Genus database with same CATH homology 4TZ4 C; 3HCH A; 3HCG A; 2K8D A; 3HCI A; 3WX2 A; 2KV1 A; 4V30 A; 3CEZ A; 3HCJ A; 4V2Z A; 5AMH A; 4V31 A; 3MAO A; 4CI3 B; 4CI1 B; 4V2Y A; 3CXK A; 4CI2 B; 4TZU A; 3WX1 A; 2KZN A; 1L1D A; 3E0M A; 4TZC A; 3E0O A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...