The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
108
|
structure length |
108
|
Chain Sequence |
GPTSLCCKQCQETEITTKNEIFSLSLCGPMAAYVNPHGYVHETLTVYKASNLNLIGRPSTVHSWFPGYAWTIAQCKICASHIGWKFTATKKDMSPQKFWGLTRSALLP
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure of the human Cereblon-DDB1-lenalidomide complex reveals basis for responsiveness to thalidomide analogs
pubmed doi rcsb |
molecule tags |
Metal binding protein
|
source organism |
Mus musculus
|
molecule keywords |
Protein cereblon
|
total genus |
20
|
structure length |
108
|
sequence length |
108
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2014-07-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Complex | Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A | Peptide methionine sulfoxide reductase. |
#chains in the Genus database with same CATH superfamily 4TZ4 C; 2K8D A; 3E0O A; 3HCH A; 4CI2 B; 3E0M A; 3WX2 A; 4CI1 B; 3MAO A; 4CI3 B; 4TZU A; 4V2Z A; 3HCJ A; 3CXK A; 1L1D A; 4TZC A; 3CEZ A; 2KZN A; 5AMH A; 4V30 A; 3HCG A; 3WX1 A; 3HCI A; 4V31 A; 2KV1 A; 4V2Y A; #chains in the Genus database with same CATH topology 3GA3 A; 4TZ4 C; 2K8D A; 5F98 A; 3E0O A; 3HCH A; 2HR9 A; 4CI2 B; 3E0M A; 4A2X A; 3LRR A; 3WX2 A; 4BPB A; 3NCU A; 4CI1 B; 5F9F A; 3MAO A; 4CI3 B; 4TZU A; 4V2Z A; 2QFB A; 1HXR A; 3HCJ A; 2LVL A; 4A2V A; 3CXK A; 1L1D A; 4TZC A; 5E3H A; 3CEZ A; 2KZN A; 2QFD A; 3ZD6 A; 5F9H A; 2RQB A; 2YKG A; 2FU5 A; 2RQA A; 3OG8 A; 5AMH A; 1YZ1 A; 1TXJ A; 2W4R A; 3EBM A; 3P3K A; 1H7Y A; 3LRN A; 2LOY A; 4V30 A; 3HCG A; 2KWB A; 3DJM A; 3WX1 A; 3HCI A; 2RMJ A; 4V31 A; 1FWQ A; 2KV1 A; 1H6Q A; 4V2Y A; 3ZD7 A; 4AY2 A; 3FAC A; 3EQT A; #chains in the Genus database with same CATH homology 4TZ4 C; 2K8D A; 3E0O A; 3HCH A; 4CI2 B; 3E0M A; 3WX2 A; 4CI1 B; 3MAO A; 4CI3 B; 4TZU A; 4V2Z A; 3HCJ A; 3CXK A; 1L1D A; 4TZC A; 3CEZ A; 2KZN A; 5AMH A; 4V30 A; 3HCG A; 3WX1 A; 3HCI A; 4V31 A; 2KV1 A; 4V2Y A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...