The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
213
|
structure length |
213
|
Chain Sequence |
QDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEEIERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPELLVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMTPEVKHRVTEEAKTAFLLNIELFEELQALLTE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Discrimination between CO and O2 in Heme Oxygenase: Comparison of Static Structures and Dynamic Conformation Changes following CO Photolysis
pubmed doi rcsb |
| molecule keywords |
Heme oxygenase 1
|
| molecule tags |
Oxidoreductase
|
| source organism |
Rattus norvegicus
|
| total genus |
91
|
| structure length |
213
|
| sequence length |
213
|
| ec nomenclature |
ec
1.14.14.18: Heme oxygenase (biliverdin-producing). |
| pdb deposition date | 2012-07-23 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01126 | Heme_oxygenase | Heme oxygenase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Up-down Bundle | Heme Oxygenase; Chain A | Heme oxygenase-like |
#chains in the Genus database with same CATH superfamily 2QZC A; 2Q32 A; 1XK0 A; 2GM7 A; 1IX3 A; 2DY5 A; 1YAK A; 1VGI A; 1IW0 A; 1WNW A; 1WZD A; 1RTW A; 1IRM A; 3DDE A; 1OZR A; 1WNV A; 1TO9 B; 1WZF A; 3B5P A; 4G7U A; 1NI6 A; 4GPF A; 1P3U A; 3B5O A; 1P3T A; 4GPC A; 3TGM A; 1J02 A; 1DVE A; 2ZVU A; 4NY7 A; 1P3V A; 5BTQ A; 1TO9 A; 4WWJ A; 1WZG A; 1IW1 A; 3I8R A; 3CZY A; 4G8P A; 4WMH A; 3K4F A; 4LQX A; 4WD4 A; 1OYK A; 1IVJ A; 2RD3 A; 1IX4 A; 3I9U A; 3BJD A; 1TWN A; 1OYL A; 1OZE A; 2F2G A; 2A2M A; 1OTV A; 1WOX A; 1J77 A; 1XK3 A; 4G7P A; 1YAF A; 3HLX A; 4GOH A; 1SK7 A; 2Q4X A; 4WWZ A; 1UBB A; 1S8C A; 1WOV A; 2GM8 A; 3OQL A; 4G7L A; 3IBX A; 4G8W A; 4MEC A; 1N45 A; 1XK1 A; 1XK2 A; 2RGZ A; 1OZL A; 1Z72 A; 4G98 A; 1ULX A; 1V8X A; 1TWR A; 3MVU A; 1WWM A; 4GPH A; 1N3U A; 3MOO A; 1WNX A; 1TYH A; 2QPP A; 3I9T A; 1DVG A; 4G99 A; 1UDD A; 1OTW A; 4G8U A; 2E7E A; 4FN6 A; 4G7T A; 2QCX A; 1XJZ A; 3NO6 A; 4WX0 A; 2A6B A; 4RAJ A; 1J2C A; 1RCW A; 3RM5 A; 3HML A; 1T5P A; 2Z68 A; 1WE1 A; 2A2O A; 3HNH A; 1S13 A; 1WOW A; 3HOK A; 1OZW A; #chains in the Genus database with same CATH topology 2QZC A; 2Q32 A; 1XK0 A; 2GM7 A; 1IX3 A; 2DY5 A; 1YAK A; 1VGI A; 1IW0 A; 1WNW A; 1WZD A; 1RTW A; 1IRM A; 3DDE A; 1OZR A; 1WNV A; 1TO9 B; 1WZF A; 3B5P A; 4G7U A; 1NI6 A; 4GPF A; 1P3U A; 3B5O A; 1P3T A; 4GPC A; 3TGM A; 1J02 A; 1DVE A; 2ZVU A; 4NY7 A; 1P3V A; 5BTQ A; 1TO9 A; 4WWJ A; 1WZG A; 1IW1 A; 3I8R A; 3CZY A; 4G8P A; 4WMH A; 3K4F A; 4LQX A; 4WD4 A; 1OYK A; 1IVJ A; 2RD3 A; 1IX4 A; 3I9U A; 3BJD A; 1TWN A; 1OYL A; 1OZE A; 2F2G A; 2A2M A; 1OTV A; 1WOX A; 1J77 A; 1XK3 A; 4G7P A; 1YAF A; 3HLX A; 4GOH A; 1SK7 A; 2Q4X A; 4WWZ A; 1UBB A; 1S8C A; 1WOV A; 2GM8 A; 3OQL A; 4G7L A; 3IBX A; 4G8W A; 4MEC A; 1N45 A; 1XK1 A; 1XK2 A; 2RGZ A; 1OZL A; 1Z72 A; 4G98 A; 1ULX A; 1V8X A; 1TWR A; 3MVU A; 1WWM A; 4GPH A; 1N3U A; 3MOO A; 1WNX A; 1TYH A; 2QPP A; 3I9T A; 1DVG A; 4G99 A; 1UDD A; 1OTW A; 4G8U A; 2E7E A; 4FN6 A; 4G7T A; 2QCX A; 2LCU A; 1XJZ A; 3NO6 A; 4WX0 A; 2A6B A; 4RAJ A; 1J2C A; 1RCW A; 3RM5 A; 3HML A; 1T5P A; 2Z68 A; 1WE1 A; 2A2O A; 3HNH A; 1S13 A; 1WOW A; 3HOK A; 1OZW A; #chains in the Genus database with same CATH homology 2QZC A; 2Q32 A; 1XK0 A; 2GM7 A; 1IX3 A; 2DY5 A; 1YAK A; 1VGI A; 1IW0 A; 1WNW A; 1WZD A; 1RTW A; 1IRM A; 3DDE A; 1OZR A; 1WNV A; 1TO9 B; 1WZF A; 3B5P A; 4G7U A; 1NI6 A; 4GPF A; 1P3U A; 3B5O A; 1P3T A; 4GPC A; 3TGM A; 1J02 A; 1DVE A; 2ZVU A; 4NY7 A; 1P3V A; 5BTQ A; 1TO9 A; 4WWJ A; 1WZG A; 1IW1 A; 3I8R A; 3CZY A; 4G8P A; 4WMH A; 3K4F A; 4LQX A; 4WD4 A; 1OYK A; 1IVJ A; 2RD3 A; 1IX4 A; 3I9U A; 3BJD A; 1TWN A; 1OYL A; 1OZE A; 2F2G A; 2A2M A; 1OTV A; 1WOX A; 1J77 A; 1XK3 A; 4G7P A; 1YAF A; 3HLX A; 4GOH A; 1SK7 A; 2Q4X A; 4WWZ A; 1UBB A; 1S8C A; 1WOV A; 2GM8 A; 3OQL A; 4G7L A; 3IBX A; 4G8W A; 4MEC A; 1N45 A; 1XK1 A; 1XK2 A; 2RGZ A; 1OZL A; 1Z72 A; 4G98 A; 1ULX A; 1V8X A; 1TWR A; 3MVU A; 1WWM A; 4GPH A; 1N3U A; 3MOO A; 1WNX A; 1TYH A; 2QPP A; 3I9T A; 1DVG A; 4G99 A; 1UDD A; 1OTW A; 4G8U A; 2E7E A; 4FN6 A; 4G7T A; 2QCX A; 1XJZ A; 3NO6 A; 4WX0 A; 2A6B A; 4RAJ A; 1J2C A; 1RCW A; 3RM5 A; 3HML A; 1T5P A; 2Z68 A; 1WE1 A; 2A2O A; 3HNH A; 1S13 A; 1WOW A; 3HOK A; 1OZW A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...