The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
91
|
sequence length |
325
|
structure length |
319
|
Chain Sequence |
AHFFEGTEKLLEVWFSRQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSEASMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQKIEGFKRLDCQSAMFNDYNFVFTSFAKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Mechanism of Human S-Adenosylmethionine
Decarboxylase Proenzyme Processing as Revealed by the
Structure of the S68A Mutant.
pubmed doi rcsb |
| molecule keywords |
S-adenosylmethionine decarboxylase proenzyme
|
| molecule tags |
Lyase
|
| source organism |
Homo sapiens
|
| total genus |
91
|
| structure length |
319
|
| sequence length |
325
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
4.1.1.50: Adenosylmethionine decarboxylase. |
| pdb deposition date | 2002-09-19 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01536 | SAM_decarbox | Adenosylmethionine decarboxylase |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 4-Layer Sandwich | S-adenosylmethionine decarboxylase | S-adenosylmethionine decarboxylase |
#chains in the Genus database with same CATH superfamily 1VR7 A; 2III A; 3DZ3 A; 3EP7 A; 3DZ2 A; 3EP5 A; 3EP4 A; 1I79 A; 1TMI A; 3EPB A; 1JL0 A; 3DZ7 A; 3EP9 A; 3H0W A; 1MHM A; 3H0V A; 1I72 A; 3EP8 A; 3EP6 A; 1MSV A; 5TVO A; 3EPA A; 1I7B A; 3DZ4 A; 3DZ6 A; 3DZ5 A; 1TLU A; 1JEN A; 1I7C A; 3EP3 A; 1I7M A; #chains in the Genus database with same CATH topology 1VR7 A; 2III A; 3DZ3 A; 3EP7 A; 3DZ2 A; 3EP5 A; 3EP4 A; 1I79 A; 1TMI A; 3EPB A; 1JL0 A; 3DZ7 A; 3EP9 A; 3H0W A; 1MHM A; 3H0V A; 1I72 A; 3EP8 A; 3EP6 A; 1MSV A; 5TVO A; 3EPA A; 1I7B A; 3DZ4 A; 3DZ6 A; 3DZ5 A; 1TLU A; 1JEN A; 1I7C A; 3EP3 A; 1I7M A; #chains in the Genus database with same CATH homology 1VR7 A; 3DZ6 B; 2III A; 1I7C B; 3DZ3 A; 3EP3 B; 3DZ5 B; 1I7M B; 1JEN B; 3EP7 A; 3DZ2 A; 3EP5 A; 3DZ3 B; 3EP7 B; 3EP4 A; 3DZ2 B; 1I79 A; 1TMI A; 3EP5 B; 1JL0 A; 3EPB A; 3DZ7 A; 3EP9 A; 3H0W A; 1MHM A; 3H0V A; 1I79 B; 1I72 A; 3EPB B; 3EP4 B; 3EP8 A; 3EP9 B; 3DZ7 B; 3EP6 A; 3H0W B; 1MSV A; 1I72 B; 1MHM B; 5TVO A; 3EPA A; 1I7B A; 3H0V B; 3DZ4 A; 3EP8 B; 3DZ6 A; 3EP6 B; 5TVO B; 3DZ5 A; 1I7B B; 1TLU A; 1JEN A; 1I7C A; 3EP3 A; 3EPA B; 3DZ4 B; 1I7M A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...