3H0VB

Human adometdc with 5'-deoxy-5'-(dimethylsulfonio) adenosine
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
63
structure length
58
Chain Sequence
b'HFFEGTEKLLEVWFSRQQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords S-adenosylmethionine decarboxylase proenzyme
publication title Role of the sulfonium center in determining the ligand specificity of human s-adenosylmethionine decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 8
structure length 58
sequence length 63
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2009-04-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 3h0vB01
3H0VB 3DZ6B 3EP8B 1I72B 3EPBB 3EP9B 3EP3B 3EP4B 3DZ3B 1I7BB 1I7CB 1I7MB 3DZ5B 3DZ7B 3EP7B 1I79B 1JENB 3DZ2B 3DZ4B 5TVOB 3EP5B 1MHMB 3EP6B 3EPAB 3H0WB
chains in the Genus database with same CATH superfamily
1VKNA 3BIOA 3FD8A 1H6CA 1PU2A 1NQAO 1YDWA 2PH5A 2PKQP 3EP8B 4MVJE 4R41A 3V5NA 1E5LA 1GD1O 1RYDA 3HNPA 2IXAA 1H6BA 1A7KA 2OZPA 1MB4A 3WBBA 3MTJA 4XR4A 1GPDG 3V2UA 4O59O 5J9GA 1K3TA 4MKZA 4YDRA 5A04A 1ML3A 2YYYA 1J5PA 5T73A 4XB1A 1GR0A 1GADO 3DB2A 3PFWO 5BNTA 1YL5A 5KVSA 3EP9B 1ARZA 1DRUA 1F06A 3NTRA 3B20A 3E1KA 3V1YA 4R51A 3DZ7B 1IHXA 3IP3A 2AXQA 3GNQA 4WOJA 3HXLA 1NQOA 3K9QO 4YWJA 2FPNA 4RL6A 4Z0HO 3DBVO 3WGYA 4GMFA 3LVFO 2D2IA 3L6OO 1H6AA 5AQ1A 4XQGA 2GZ3A 4HKTA 1NWCA 3OA2A 1I7MB 3WB9A 3NTQA 3EVNA 4MJLA 3EZYA 3E82A 3OA0A 1B7GO 3PYMA 1ZNQO 3MZ0A 3TUXA 1ZH8A 5A03A 3H9EO 2R00C 3EUWA 3B1JA 4CLQA 4DPKA 4HADA 2DBVO 3WGZA 1P9LA 3OQBA 3QVXA 1JN0A 2I3GA 3LC2O 4LRTB 1I7CB 3HJAA 1GAEO 1OFGA 3O9ZA 2GYYA 5C7IO 3Q11A 1LA2A 3DTYA 1CRWG 2BHLA 3RC9A 3RC7A 4WNIA 5GZ1A 2IXBA 3EP3B 1RM0A 4TVBA 3C8MA 4MVJP 5AVOA 1VSUA 2HO5A 2DC1A 3GDOA 3WYBA 3IWCB 1DAPA 1I79B 3L0DA 1EBUA 3Q0EA 1H9AA 3KUXA 4MIOA 2GLXA 2B4TO 3QY9A 2VYVD 4KOAA 3RC1A 3DOCA 2NQTA 1YL7A 1SZJG 1DSSG 2HJSA 5EINA 1TA4A 3CIFA 3IDSA 1QMHA 3DMTC 3DZ2B 1DC4A 3RBVA 5A02A 5C7LO 1TB4A 4ZICA 3ZDFA 3VOSA 3NTOA 1NBOA 4XQCA 5GZ3A 2R00A 2O48X 1PQUA 1T4BA 4MKXA 3BTUA 4LSMA 3PQVA 3HQ4O 3PWKA 1GCUA 1DPGA 3UUWA 1RM4A 1GYPA 2PKQO 1P1HA 1YS4A 3RVDA 3L4SO 1DC5A 1U1IA 3QVWA 1P1IA 2GZ1A 4MVJH 4EW6A 3HSKA 4O8JA 4P8RA 1NX6A 1DRWA 2DAPA 4MVJD 1BRMA 1J0XO 3QW2A 1NPTO 2P2SA 1JKFA 3BTVA 5JY6A 1CERA 1P1FA 3C1AA 1JKIA 2DUUA 4R5HA 1QXSA 3CMCO 1T4DA 1P1KA 3EP5B 3QV1A 3TV1A 3NT2A 4DBVO 3H0VB 1E7MA 3WYCA 2CZCA 3LC7O 2QZ9A 3PWSA 1S7CA 1H9BA 4FB5A 1P1JA 4XRGA 1E7YA 4INAA 3EP4B 3DMTA 3OHSX 3PYXA 3E5RA 2VYVA 4IQ8A 3UW3A 4MIYA 1I32A 3FHLA 1JENB 3BTSA 1MHMB 3E9MA 1H94A 3LC1O 4PG4A 1TLTA 1VC2A 2POQX 1OZAA 2NVWA 4WNCA 2Q49A 3WBFA 5KVQA 5DDIP 5JYFA 2EJWA 1Q7GA 3PZRA 1C3VA 4MVJM 1E77A 3VAZA 4DPLA 5M6DA 1RM5A 5C7OO 3GPDG 1NVMB 4IQ0A 2GD1O 3PYLA 1QMIA 2X5JO 1CF2O 4MVJF 1PS8A 5A06A 1I33A 3I23A 4PG7A 3NT5A 3INGA 4MVJA 4MVJG 5JYEA 2BH9A 4O89A 5EIOA 4H3VA 1NQ5A 5GZ6A 3WGOA 1MC4A 3F4LA 3Q1LA 3IJPA 3U3XA 4MIEA 3B1KA 2X5KO 2EP5A 1E5QA 4LRSB 2VYNA 1EVJA 4GPD1 1DC6A 1DC3A 4XQEA 3ZJXA 3E18A 2DPGA 1HDGO 2HKIA 1DBVO 3DZ5B 3RC2A 4XB2A 1H93A 3K73O 1RYEA 2X0NA 3JSAA 3QVSA 4PLPA 3H0WB 1VKOA 4QX6A 4DPMA 3EPBB 3WGQA 3CPSA 2G17A 3EC7A 4MINA 4N54A 3ABIA 4O63O 1OBFO 1PQPA 3KSDO 1IHYA 1PR3A 4R3WA 3ZCXA 1YWGO 2VYND 3Q2IA 5EERA 3EPAB 3CINA 4GMGA 4PG5A 4LGVA 2Q4EA 5JYAA 3Q2KA 4R4JA 4ZHSA 4BOYA 1YL6A 3QVTA 1VSVA 1EBFA 1GL3A 2O4UX 4GQAA 3IWDB 3K2BA 5EESA 1QKIA 3KGDA 3M2TA 1LC3A 4DIBA 4PG6A 3DZ4B 5TVOB 3KSZO 2Q22A 4II7A 2B4RO 1LC0A 3EP6B 3RCBA 4R3NA 1H6DA 4R54A 1TVEA 4AK1A 1I72B 1XYGA 2H63A 3DR3A 3DO5A 2XF8A 3IWBB 2I3AA 2CVOA 4R5MA 3NT4A 2PKRA 2YV3A 2I5PO 1I7BB 1DIHA 1VM6A 4PG8A 5CEFA 3TW3A 3STHA 3EP7B 3MOIA 1NWHA 1DRVA 4NHEA 4K9DA 4F3YA 1H2HA 2G82A 1RM3A 3DZ6B 3CEAA 3DAPA 1U8FO 1XEAA 1Q2XA 2EP7A 3DZ3B 4L8VA 4MVJI 1FF9A 4L9RA 1UYJA 3TUTA 3TZ6A 4JN6B 5JW6A 2GZ2A 1GYQA 4XQ9A 3GFGA 3KV3O 3E6AA 5A05A 3PZBA
chains in the Genus database with same CATH topology
1I7CA 1VR7A 1I7MA 3H0VB 3DZ5A 1TLUA 3DZ7A 3DZ6B 3EP8B 3EP7A 1I72B 3EPBB 3DZ2A 3DZ4A 3EP9B 1JENA 1I79A 3EP5A 5TVOA 3EP3B 1MHMA 3EP4B 3EP6A 3EPAA 1TMIA 3H0WA 3DZ3B 1I7BB 3H0VA 1I7CB 1I7MB 3DZ6A 3DZ5B 3DZ7B 3EP8A 1I72A 3EPBA 1MSVA 1JL0A 3EP7B 3EP9A 1JENB 1I79B 3DZ2B 2IIIA 3DZ4B 3EP3A 3H0WB 5TVOB 3EP5B 3EP4A 1MHMB 3DZ3A 3EP6B 3EPAB 1I7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0V B;  3DZ6 B;  3EP8 B;  1I72 B;  3EPB B;  3EP9 B;  3EP3 B;  3EP4 B;  3DZ3 B;  1I7B B;  1I7C B;  1I7M B;  3DZ5 B;  3DZ7 B;  3EP7 B;  1I79 B;  1JEN B;  3DZ2 B;  3DZ4 B;  5TVO B;  3EP5 B;  1MHM B;  3EP6 B;  3EPA B;  3H0W B; 
#chains in the Genus database with same CATH topology
 1VKN A;  3BIO A;  3FD8 A;  1H6C A;  1PU2 A;  1NQA O;  1YDW A;  2PH5 A;  2PKQ P;  3EP8 B;  4MVJ E;  4R41 A;  3V5N A;  1E5L A;  1GD1 O;  1RYD A;  3HNP A;  2IXA A;  1H6B A;  1A7K A;  2OZP A;  1MB4 A;  3WBB A;  3MTJ A;  4XR4 A;  1GPD G;  3V2U A;  4O59 O;  5J9G A;  1K3T A;  4MKZ A;  4YDR A;  5A04 A;  1ML3 A;  2YYY A;  1J5P A;  5T73 A;  4XB1 A;  1GR0 A;  1GAD O;  3DB2 A;  3PFW O;  5BNT A;  1YL5 A;  5KVS A;  3EP9 B;  1ARZ A;  1DRU A;  1F06 A;  3NTR A;  3B20 A;  3E1K A;  3V1Y A;  4R51 A;  3DZ7 B;  1IHX A;  3IP3 A;  2AXQ A;  3GNQ A;  4WOJ A;  3HXL A;  1NQO A;  3K9Q O;  4YWJ A;  2FPN A;  4RL6 A;  4Z0H O;  3DBV O;  3WGY A;  4GMF A;  3LVF O;  2D2I A;  3L6O O;  1H6A A;  5AQ1 A;  4XQG A;  2GZ3 A;  4HKT A;  1NWC A;  3OA2 A;  1I7M B;  3WB9 A;  3NTQ A;  3EVN A;  4MJL A;  3EZY A;  3E82 A;  3OA0 A;  1B7G O;  3PYM A;  1ZNQ O;  3MZ0 A;  3TUX A;  1ZH8 A;  5A03 A;  3H9E O;  2R00 C;  3EUW A;  3B1J A;  4CLQ A;  4DPK A;  4HAD A;  2DBV O;  3WGZ A;  1P9L A;  3OQB A;  3QVX A;  1JN0 A;  2I3G A;  3LC2 O;  4LRT B;  1I7C B;  3HJA A;  1GAE O;  1OFG A;  3O9Z A;  2GYY A;  5C7I O;  3Q11 A;  1LA2 A;  3DTY A;  1CRW G;  2BHL A;  3RC9 A;  3RC7 A;  4WNI A;  5GZ1 A;  2IXB A;  3EP3 B;  1RM0 A;  4TVB A;  3C8M A;  4MVJ P;  5AVO A;  1VSU A;  2HO5 A;  2DC1 A;  3GDO A;  3WYB A;  3IWC B;  1DAP A;  1I79 B;  3L0D A;  1EBU A;  3Q0E A;  1H9A A;  3KUX A;  4MIO A;  2GLX A;  2B4T O;  3QY9 A;  2VYV D;  4KOA A;  3RC1 A;  3DOC A;  2NQT A;  1YL7 A;  1SZJ G;  1DSS G;  2HJS A;  5EIN A;  1TA4 A;  3CIF A;  3IDS A;  1QMH A;  3DMT C;  3DZ2 B;  1DC4 A;  3RBV A;  5A02 A;  5C7L O;  1TB4 A;  4ZIC A;  3ZDF A;  3VOS A;  3NTO A;  1NBO A;  4XQC A;  5GZ3 A;  2R00 A;  2O48 X;  1PQU A;  1T4B A;  4MKX A;  3BTU A;  4LSM A;  3PQV A;  3HQ4 O;  3PWK A;  1GCU A;  1DPG A;  3UUW A;  1RM4 A;  1GYP A;  2PKQ O;  1P1H A;  1YS4 A;  3RVD A;  3L4S O;  1DC5 A;  1U1I A;  3QVW A;  1P1I A;  2GZ1 A;  4MVJ H;  4EW6 A;  3HSK A;  4O8J A;  4P8R A;  1NX6 A;  1DRW A;  2DAP A;  4MVJ D;  1BRM A;  1J0X O;  3QW2 A;  1NPT O;  2P2S A;  1JKF A;  3BTV A;  5JY6 A;  1CER A;  1P1F A;  3C1A A;  1JKI A;  2DUU A;  4R5H A;  1QXS A;  3CMC O;  1T4D A;  1P1K A;  3EP5 B;  3QV1 A;  3TV1 A;  3NT2 A;  4DBV O;  3H0V B;  1E7M A;  3WYC A;  2CZC A;  3LC7 O;  2QZ9 A;  3PWS A;  1S7C A;  1H9B A;  4FB5 A;  1P1J A;  4XRG A;  1E7Y A;  4INA A;  3EP4 B;  3DMT A;  3OHS X;  3PYX A;  3E5R A;  2VYV A;  4IQ8 A;  3UW3 A;  4MIY A;  1I32 A;  3FHL A;  1JEN B;  3BTS A;  1MHM B;  3E9M A;  1H94 A;  3LC1 O;  4PG4 A;  1TLT A;  1VC2 A;  2POQ X;  1OZA A;  2NVW A;  4WNC A;  2Q49 A;  3WBF A;  5KVQ A;  5DDI P;  5JYF A;  2EJW A;  1Q7G A;  3PZR A;  1C3V A;  4MVJ M;  1E77 A;  3VAZ A;  4DPL A;  5M6D A;  1RM5 A;  5C7O O;  3GPD G;  1NVM B;  4IQ0 A;  2GD1 O;  3PYL A;  1QMI A;  2X5J O;  1CF2 O;  4MVJ F;  1PS8 A;  5A06 A;  1I33 A;  3I23 A;  4PG7 A;  3NT5 A;  3ING A;  4MVJ A;  4MVJ G;  5JYE A;  2BH9 A;  4O89 A;  5EIO A;  4H3V A;  1NQ5 A;  5GZ6 A;  3WGO A;  1MC4 A;  3F4L A;  3Q1L A;  3IJP A;  3U3X A;  4MIE A;  3B1K A;  2X5K O;  2EP5 A;  1E5Q A;  4LRS B;  2VYN A;  1EVJ A;  4GPD 1;  1DC6 A;  1DC3 A;  4XQE A;  3ZJX A;  3E18 A;  2DPG A;  1HDG O;  2HKI A;  1DBV O;  3DZ5 B;  3RC2 A;  4XB2 A;  1H93 A;  3K73 O;  1RYE A;  2X0N A;  3JSA A;  3QVS A;  4PLP A;  3H0W B;  1VKO A;  4QX6 A;  4DPM A;  3EPB B;  3WGQ A;  3CPS A;  2G17 A;  3EC7 A;  4MIN A;  4N54 A;  3ABI A;  4O63 O;  1OBF O;  1PQP A;  3KSD O;  1IHY A;  1PR3 A;  4R3W A;  3ZCX A;  1YWG O;  2VYN D;  3Q2I A;  5EER A;  3EPA B;  3CIN A;  4GMG A;  4PG5 A;  4LGV A;  2Q4E A;  5JYA A;  3Q2K A;  4R4J A;  4ZHS A;  4BOY A;  1YL6 A;  3QVT A;  1VSV A;  1EBF A;  1GL3 A;  2O4U X;  4GQA A;  3IWD B;  3K2B A;  5EES A;  1QKI A;  3KGD A;  3M2T A;  1LC3 A;  4DIB A;  4PG6 A;  3DZ4 B;  5TVO B;  3KSZ O;  2Q22 A;  4II7 A;  2B4R O;  1LC0 A;  3EP6 B;  3RCB A;  4R3N A;  1H6D A;  4R54 A;  1TVE A;  4AK1 A;  1I72 B;  1XYG A;  2H63 A;  3DR3 A;  3DO5 A;  2XF8 A;  3IWB B;  2I3A A;  2CVO A;  4R5M A;  3NT4 A;  2PKR A;  2YV3 A;  2I5P O;  1I7B B;  1DIH A;  1VM6 A;  4PG8 A;  5CEF A;  3TW3 A;  3STH A;  3EP7 B;  3MOI A;  1NWH A;  1DRV A;  4NHE A;  4K9D A;  4F3Y A;  1H2H A;  2G82 A;  1RM3 A;  3DZ6 B;  3CEA A;  3DAP A;  1U8F O;  1XEA A;  1Q2X A;  2EP7 A;  3DZ3 B;  4L8V A;  4MVJ I;  1FF9 A;  4L9R A;  1UYJ A;  3TUT A;  3TZ6 A;  4JN6 B;  5JW6 A;  2GZ2 A;  1GYQ A;  4XQ9 A;  3GFG A;  3KV3 O;  3E6A A;  5A05 A;  3PZB A; 
#chains in the Genus database with same CATH homology
 1I7C A;  1VR7 A;  1I7M A;  3H0V B;  3DZ5 A;  1TLU A;  3DZ7 A;  3DZ6 B;  3EP8 B;  3EP7 A;  1I72 B;  3EPB B;  3DZ2 A;  3DZ4 A;  3EP9 B;  1JEN A;  1I79 A;  3EP5 A;  5TVO A;  3EP3 B;  1MHM A;  3EP4 B;  3EP6 A;  3EPA A;  1TMI A;  3H0W A;  3DZ3 B;  1I7B B;  3H0V A;  1I7C B;  1I7M B;  3DZ6 A;  3DZ5 B;  3DZ7 B;  3EP8 A;  1I72 A;  3EPB A;  1MSV A;  1JL0 A;  3EP7 B;  3EP9 A;  1JEN B;  1I79 B;  3DZ2 B;  2III A;  3DZ4 B;  3EP3 A;  3H0W B;  5TVO B;  3EP5 B;  3EP4 A;  1MHM B;  3DZ3 A;  3EP6 B;  3EPA B;  1I7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...