1I7CB

Human s-adenosylmethionine decarboxylase with covalently bound pyruvoyl group and complexed with methylglyoxal bis-(guanylhydrazone)
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
64
structure length
61
Chain Sequence
AHFFEGTEKLLEVWFSRQQPQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The structural basis for substrate specificity and inhibition of human S-adenosylmethionine decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords S-ADENOSYLMETHIONINE DECARBOXYLASE BETA CHAIN
total genus 9
structure length 61
sequence length 64
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2001-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 1i7cB01
3H0WB 1I7MB 5TVOB 3DZ5B 1I7BB 3EP8B 3DZ3B 3EPBB 3H0VB 3EP6B 3EP9B 1I79B 1JENB 1MHMB 3DZ4B 1I7CB 3EP3B 3DZ7B 3EP7B 3EP5B 3DZ2B 3EPAB 3DZ6B 3EP4B 1I72B
chains in the Genus database with same CATH superfamily
3Q1LA 3H0WB 1C3VA 3DO5A 3Q2IA 4P8RA 2VYND 2GZ2A 3RBVA 2GYYA 4R5MA 3WGQA 4AK1A 4F3YA 3DBVO 3LVFO 3K9QO 3WBFA 4XRGA 1FF9A 1K3TA 3WBBA 5A02A 3E6AA 4PG8A 3STHA 1J0XO 1CF2O 4O63O 4PG5A 3KGDA 1TVEA 3EP4B 3WGYA 5C7LO 4GPD1 2EP5A 3IJPA 3WGZA 3E1KA 2I3GA 3CPSA 1GYQA 4MIOA 5A03A 3BTVA 2FPNA 1S7CA 4R54A 1PQUA 5C7OO 4II7A 1OZAA 1YL6A 5JYFA 1I7MB 3C8MA 4PLPA 3NT2A 3EP8B 4MIYA 4MKXA 3DZ3B 3UUWA 4GMGA 3DOCA 3CMCO 1NVMB 3HSKA 4H3VA 1NQOA 1JENB 1NWHA 2YYYA 1RM0A 1DBVO 2EJWA 2BH9A 4KOAA 4YWJA 3M2TA 3K73O 5EERA 1I7BB 1P1HA 4WNIA 4PG6A 1I33A 3V5NA 4R51A 3MTJA 3B20A 4LGVA 1ML3A 3QY9A 1TA4A 2DBVO 3IWCB 1U1IA 2OZPA 3VAZA 5A04A 3RC1A 2DUUA 3UW3A 2O48X 4DPMA 1H93A 5A05A 4DPLA 1EBFA 4DIBA 3IWDB 3PYXA 1UYJA 5A06A 3QVTA 2GD1O 5M6DA 3EPBB 1GCUA 1I79B 3PFWO 3HJAA 4HKTA 1DC5A 1MB4A 2NQTA 3ABIA 4IQ0A 3EP3B 1P1KA 3KSZO 3DZ7B 3TUXA 2QZ9A 1LC3A 4XQEA 1VM6A 1JKFA 3EUWA 1GAEO 2I3AA 3GPDG 1E5LA 5JYAA 4MIEA 1TB4A 3FD8A 1TLTA 1DIHA 1P1IA 2GZ3A 3IDSA 4INAA 1J5PA 3NT4A 2O4UX 1VC2A 2XF8A 4XQ9A 4ZICA 1P9LA 3NTRA 1XYGA 3PYMA 3EP7B 3CIFA 4XQCA 4Z0HO 3DZ2B 2X5KO 3TW3A 2GZ1A 2B4TO 3DZ5B 2Q22A 1QKIA 2PH5A 1I32A 1YWGO 2I5PO 3GNQA 3ZCXA 4XQGA 1NBOA 1H6BA 4MVJE 3DZ4B 1EVJA 4HADA 1GR0A 4CLQA 3KV3O 4DBVO 1GADO 4MVJM 4LSMA 1HDGO 1NPTO 3V1YA 2Q49A 5C7IO 4EW6A 4IQ8A 3DMTA 5GZ3A 2DC1A 3QVWA 3DB2A 2DPGA 3E9MA 1MHMB 4MKZA 3MOIA 1JKIA 3RC7A 5AQ1A 3LC7O 3EPAB 2DAPA 3H9EO 1YS4A 1E7MA 2NVWA 4MVJH 5KVQA 3DZ6B 2VYNA 1H94A 1H6AA 1GD1O 3OQBA 3GFGA 2POQX 3KUXA 4QX6A 4TVBA 1PS8A 1DRVA 3RCBA 3BTSA 1QXSA 3QW2A 1SZJG 1T4DA 2X5JO 3Q0EA 1H6CA 3EVNA 3GDOA 3EP5B 1CRWG 3LC1O 1I72B 1OBFO 3I23A 3ZJXA 5KVSA 4WNCA 1T4BA 4R5HA 4WOJA 1F06A 1NQ5A 3U3XA 1OFGA 2G82A 5BNTA 3TV1A 4ZHSA 3B1KA 2EP7A 5CEFA 3QVSA 1E7YA 3KSDO 3NTOA 4PG7A 4GMFA 1RYDA 2D2IA 1EBUA 4MVJF 3LC2O 3DTYA 3OA0A 4LRTB 1YL5A 3E5RA 3O9ZA 1RYEA 3RC2A 2VYVA 1IHXA 1B7GO 2PKQP 3VOSA 3EZYA 1E77A 1DPGA 3HNPA 3PZBA 4DPKA 3QVXA 4BOYA 1VKNA 3L4SO 3QV1A 4XR4A 2P2SA 5EESA 1PR3A 3Q11A 2B4RO 3PYLA 1RM4A 5EIOA 4R4JA 4L9RA 1MC4A 3NTQA 1NX6A 3EC7A 4PG4A 4L8VA 3PZRA 1LA2A 4MJLA 4O59O 1P1JA 2CVOA 2H63A 3JSAA 3L6OO 4K9DA 1DC3A 4LRSB 4MVJG 3OA2A 1E5QA 2Q4EA 3CEAA 4R3NA 1JN0A 2R00C 5TVOB 3TUTA 3FHLA 1NWCA 3TZ6A 1CERA 2YV3A 1PQPA 1GL3A 2AXQA 4XB1A 1H2HA 4O89A 3RC9A 2G17A 4MVJI 4XB2A 5AVOA 3PQVA 4N54A 3IWBB 3E82A 1P1FA 1DRUA 3E18A 3MZ0A 3C1AA 3PWSA 3BTUA 3DR3A 3PWKA 3WYBA 2HO5A 1BRMA 3NT5A 5JW6A 3Q2KA 1VSVA 2BHLA 3B1JA 2PKQO 3DAPA 1IHYA 1H9AA 1GPDG 1YL7A 2R00A 3H0VB 3HXLA 5T73A 3IP3A 2IXBA 4O8JA 1XEAA 1Q2XA 3K2BA 1Q7GA 1A7KA 5JY6A 4FB5A 5JYEA 1LC0A 1U8FO 1YDWA 2VYVD 3OHSX 3CINA 4RL6A 1DC6A 3F4LA 1RM5A 4MVJP 1ARZA 2IXAA 5J9GA 3ZDFA 3HQ4O 1DC4A 2X0NA 1VKOA 1NQAO 4MVJD 3RVDA 1I7CB 4MVJA 4R3WA 3INGA 2PKRA 5GZ1A 3DMTC 1H6DA 3L0DA 5GZ6A 1VSUA 1GYPA 1DAPA 1ZNQO 3V2UA 1QMIA 2HJSA 3WB9A 1RM3A 3BIOA 3EP6B 1DSSG 1QMHA 3EP9B 5EINA 1ZH8A 2CZCA 3WGOA 2HKIA 1H9BA 1DRWA 4GQAA 4YDRA 3WYCA 4NHEA 1PU2A 4MINA 4JN6B 2GLXA 4R41A 5DDIP
chains in the Genus database with same CATH topology
3H0WB 1I7MB 3DZ2A 3EPAA 5TVOB 1TMIA 3DZ5B 1I7BB 3EP8B 1TLUA 1I7CA 3DZ3B 3EP3A 3EPBB 1I79A 1MHMA 3DZ4A 3H0VB 2IIIA 3DZ3A 1JL0A 3EP6B 3EP9B 3H0VA 1I79B 1JENA 3EP8A 1I7BA 3EP6A 1JENB 1MHMB 3DZ4B 3DZ5A 3EP9A 3EP4A 3H0WA 3DZ6A 3EPBA 1I7CB 3EP3B 5TVOA 3DZ7B 3EP7B 3EP5A 1VR7A 3EP5B 3DZ2B 3EP7A 3DZ7A 1MSVA 1I7MA 3EPAB 1I72A 3DZ6B 3EP4B 1I72B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H0W B;  1I7M B;  5TVO B;  3DZ5 B;  1I7B B;  3EP8 B;  3DZ3 B;  3EPB B;  3H0V B;  3EP6 B;  3EP9 B;  1I79 B;  1JEN B;  1MHM B;  3DZ4 B;  1I7C B;  3EP3 B;  3DZ7 B;  3EP7 B;  3EP5 B;  3DZ2 B;  3EPA B;  3DZ6 B;  3EP4 B;  1I72 B; 
#chains in the Genus database with same CATH topology
 3Q1L A;  3H0W B;  1C3V A;  3DO5 A;  3Q2I A;  4P8R A;  2VYN D;  2GZ2 A;  3RBV A;  2GYY A;  4R5M A;  3WGQ A;  4AK1 A;  4F3Y A;  3DBV O;  3LVF O;  3K9Q O;  3WBF A;  4XRG A;  1FF9 A;  1K3T A;  3WBB A;  5A02 A;  3E6A A;  4PG8 A;  3STH A;  1J0X O;  1CF2 O;  4O63 O;  4PG5 A;  3KGD A;  1TVE A;  3EP4 B;  3WGY A;  5C7L O;  4GPD 1;  2EP5 A;  3IJP A;  3WGZ A;  3E1K A;  2I3G A;  3CPS A;  1GYQ A;  4MIO A;  5A03 A;  3BTV A;  2FPN A;  1S7C A;  4R54 A;  1PQU A;  5C7O O;  4II7 A;  1OZA A;  1YL6 A;  5JYF A;  1I7M B;  3C8M A;  4PLP A;  3NT2 A;  3EP8 B;  4MIY A;  4MKX A;  3DZ3 B;  3UUW A;  4GMG A;  3DOC A;  3CMC O;  1NVM B;  3HSK A;  4H3V A;  1NQO A;  1JEN B;  1NWH A;  2YYY A;  1RM0 A;  1DBV O;  2EJW A;  2BH9 A;  4KOA A;  4YWJ A;  3M2T A;  3K73 O;  5EER A;  1I7B B;  1P1H A;  4WNI A;  4PG6 A;  1I33 A;  3V5N A;  4R51 A;  3MTJ A;  3B20 A;  4LGV A;  1ML3 A;  3QY9 A;  1TA4 A;  2DBV O;  3IWC B;  1U1I A;  2OZP A;  3VAZ A;  5A04 A;  3RC1 A;  2DUU A;  3UW3 A;  2O48 X;  4DPM A;  1H93 A;  5A05 A;  4DPL A;  1EBF A;  4DIB A;  3IWD B;  3PYX A;  1UYJ A;  5A06 A;  3QVT A;  2GD1 O;  5M6D A;  3EPB B;  1GCU A;  1I79 B;  3PFW O;  3HJA A;  4HKT A;  1DC5 A;  1MB4 A;  2NQT A;  3ABI A;  4IQ0 A;  3EP3 B;  1P1K A;  3KSZ O;  3DZ7 B;  3TUX A;  2QZ9 A;  1LC3 A;  4XQE A;  1VM6 A;  1JKF A;  3EUW A;  1GAE O;  2I3A A;  3GPD G;  1E5L A;  5JYA A;  4MIE A;  1TB4 A;  3FD8 A;  1TLT A;  1DIH A;  1P1I A;  2GZ3 A;  3IDS A;  4INA A;  1J5P A;  3NT4 A;  2O4U X;  1VC2 A;  2XF8 A;  4XQ9 A;  4ZIC A;  1P9L A;  3NTR A;  1XYG A;  3PYM A;  3EP7 B;  3CIF A;  4XQC A;  4Z0H O;  3DZ2 B;  2X5K O;  3TW3 A;  2GZ1 A;  2B4T O;  3DZ5 B;  2Q22 A;  1QKI A;  2PH5 A;  1I32 A;  1YWG O;  2I5P O;  3GNQ A;  3ZCX A;  4XQG A;  1NBO A;  1H6B A;  4MVJ E;  3DZ4 B;  1EVJ A;  4HAD A;  1GR0 A;  4CLQ A;  3KV3 O;  4DBV O;  1GAD O;  4MVJ M;  4LSM A;  1HDG O;  1NPT O;  3V1Y A;  2Q49 A;  5C7I O;  4EW6 A;  4IQ8 A;  3DMT A;  5GZ3 A;  2DC1 A;  3QVW A;  3DB2 A;  2DPG A;  3E9M A;  1MHM B;  4MKZ A;  3MOI A;  1JKI A;  3RC7 A;  5AQ1 A;  3LC7 O;  3EPA B;  2DAP A;  3H9E O;  1YS4 A;  1E7M A;  2NVW A;  4MVJ H;  5KVQ A;  3DZ6 B;  2VYN A;  1H94 A;  1H6A A;  1GD1 O;  3OQB A;  3GFG A;  2POQ X;  3KUX A;  4QX6 A;  4TVB A;  1PS8 A;  1DRV A;  3RCB A;  3BTS A;  1QXS A;  3QW2 A;  1SZJ G;  1T4D A;  2X5J O;  3Q0E A;  1H6C A;  3EVN A;  3GDO A;  3EP5 B;  1CRW G;  3LC1 O;  1I72 B;  1OBF O;  3I23 A;  3ZJX A;  5KVS A;  4WNC A;  1T4B A;  4R5H A;  4WOJ A;  1F06 A;  1NQ5 A;  3U3X A;  1OFG A;  2G82 A;  5BNT A;  3TV1 A;  4ZHS A;  3B1K A;  2EP7 A;  5CEF A;  3QVS A;  1E7Y A;  3KSD O;  3NTO A;  4PG7 A;  4GMF A;  1RYD A;  2D2I A;  1EBU A;  4MVJ F;  3LC2 O;  3DTY A;  3OA0 A;  4LRT B;  1YL5 A;  3E5R A;  3O9Z A;  1RYE A;  3RC2 A;  2VYV A;  1IHX A;  1B7G O;  2PKQ P;  3VOS A;  3EZY A;  1E77 A;  1DPG A;  3HNP A;  3PZB A;  4DPK A;  3QVX A;  4BOY A;  1VKN A;  3L4S O;  3QV1 A;  4XR4 A;  2P2S A;  5EES A;  1PR3 A;  3Q11 A;  2B4R O;  3PYL A;  1RM4 A;  5EIO A;  4R4J A;  4L9R A;  1MC4 A;  3NTQ A;  1NX6 A;  3EC7 A;  4PG4 A;  4L8V A;  3PZR A;  1LA2 A;  4MJL A;  4O59 O;  1P1J A;  2CVO A;  2H63 A;  3JSA A;  3L6O O;  4K9D A;  1DC3 A;  4LRS B;  4MVJ G;  3OA2 A;  1E5Q A;  2Q4E A;  3CEA A;  4R3N A;  1JN0 A;  2R00 C;  5TVO B;  3TUT A;  3FHL A;  1NWC A;  3TZ6 A;  1CER A;  2YV3 A;  1PQP A;  1GL3 A;  2AXQ A;  4XB1 A;  1H2H A;  4O89 A;  3RC9 A;  2G17 A;  4MVJ I;  4XB2 A;  5AVO A;  3PQV A;  4N54 A;  3IWB B;  3E82 A;  1P1F A;  1DRU A;  3E18 A;  3MZ0 A;  3C1A A;  3PWS A;  3BTU A;  3DR3 A;  3PWK A;  3WYB A;  2HO5 A;  1BRM A;  3NT5 A;  5JW6 A;  3Q2K A;  1VSV A;  2BHL A;  3B1J A;  2PKQ O;  3DAP A;  1IHY A;  1H9A A;  1GPD G;  1YL7 A;  2R00 A;  3H0V B;  3HXL A;  5T73 A;  3IP3 A;  2IXB A;  4O8J A;  1XEA A;  1Q2X A;  3K2B A;  1Q7G A;  1A7K A;  5JY6 A;  4FB5 A;  5JYE A;  1LC0 A;  1U8F O;  1YDW A;  2VYV D;  3OHS X;  3CIN A;  4RL6 A;  1DC6 A;  3F4L A;  1RM5 A;  4MVJ P;  1ARZ A;  2IXA A;  5J9G A;  3ZDF A;  3HQ4 O;  1DC4 A;  2X0N A;  1VKO A;  1NQA O;  4MVJ D;  3RVD A;  1I7C B;  4MVJ A;  4R3W A;  3ING A;  2PKR A;  5GZ1 A;  3DMT C;  1H6D A;  3L0D A;  5GZ6 A;  1VSU A;  1GYP A;  1DAP A;  1ZNQ O;  3V2U A;  1QMI A;  2HJS A;  3WB9 A;  1RM3 A;  3BIO A;  3EP6 B;  1DSS G;  1QMH A;  3EP9 B;  5EIN A;  1ZH8 A;  2CZC A;  3WGO A;  2HKI A;  1H9B A;  1DRW A;  4GQA A;  4YDR A;  3WYC A;  4NHE A;  1PU2 A;  4MIN A;  4JN6 B;  2GLX A;  4R41 A;  5DDI P; 
#chains in the Genus database with same CATH homology
 3H0W B;  1I7M B;  3DZ2 A;  3EPA A;  5TVO B;  1TMI A;  3DZ5 B;  1I7B B;  3EP8 B;  1TLU A;  1I7C A;  3DZ3 B;  3EP3 A;  3EPB B;  1I79 A;  1MHM A;  3DZ4 A;  3H0V B;  2III A;  3DZ3 A;  1JL0 A;  3EP6 B;  3EP9 B;  3H0V A;  1I79 B;  1JEN A;  3EP8 A;  1I7B A;  3EP6 A;  1JEN B;  1MHM B;  3DZ4 B;  3DZ5 A;  3EP9 A;  3EP4 A;  3H0W A;  3DZ6 A;  3EPB A;  1I7C B;  3EP3 B;  5TVO A;  3DZ7 B;  3EP7 B;  3EP5 A;  1VR7 A;  3EP5 B;  3DZ2 B;  3EP7 A;  3DZ7 A;  1MSV A;  1I7M A;  3EPA B;  1I72 A;  3DZ6 B;  3EP4 B;  1I72 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...