The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
161
|
structure length |
161
|
Chain Sequence |
DPSAEAQPIVGSDLDDQLHGTLLGEEISGGGGADQLYGYGGGDLLDGGAGRDRLTGGEGADTFRFALREDSQRSAAGTFSDLILDFDPTQDKLDVSALGFTGLGNGYAGTLAVSVSDDGTRTYLKSYETDAEGRSFEVSLQGNHAAALSADNILFATPVPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| publication title |
Structural and Functional Characterization of the R-modules in Alginate C-5 Epimerases AlgE4 and AlgE6 from Azotobacter vinelandii
pubmed doi rcsb |
| molecule keywords |
Poly(beta-D-mannuronate) C5 epimerase 6
|
| molecule tags |
Isomerase
|
| source organism |
Azotobacter vinelandii
|
| total genus |
46
|
| structure length |
161
|
| sequence length |
161
|
| ec nomenclature |
ec
5.1.3.37: Mannuronan 5-epimerase. |
| pdb deposition date | 2014-02-18 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF00353 | HemolysinCabind | RTX calcium-binding nonapeptide repeat (4 copies) |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | 2 Solenoid | Alkaline Protease, subunit P, domain 1 | Serralysin-like metalloprotease, C-terminal |
#chains in the Genus database with same CATH superfamily 3LA9 A; 1SRP A; 1JIW P; 1OM6 A; 3HBV P; 3HB2 P; 5CXL A; 5CVW A; 3WP8 A; 5D7W A; 1K7I A; 3NTN A; 3VI1 A; 2AGM A; 1GO8 P; 2QUB A; 1K7Q A; 2YO0 A; 2ZJ6 A; 3S6L A; 3LAA A; 1AF0 A; 1SAT A; 3A70 A; 1KAP P; 1O0Q A; 3HDA P; 4I35 A; 2ZVD A; 1P9H A; 1OMJ A; 2ZJ7 A; 1SMP A; 2Z8Z A; 2Z8X A; 1OM8 A; 2QUA A; 1G9K A; 2XQH A; 1AKL A; 1GO7 P; 3U1R A; 1H71 P; 1OM7 A; 3ULT A; 1K7G A; 3HBU P; 1O0T A; 3A6Z A; 2YO1 A; 2ML2 A; #chains in the Genus database with same CATH topology 3LA9 A; 1SRP A; 1JIW P; 1OM6 A; 3HBV P; 3HB2 P; 5CXL A; 5CVW A; 3WP8 A; 5D7W A; 1K7I A; 3NTN A; 3VI1 A; 2AGM A; 1GO8 P; 2QUB A; 1K7Q A; 2YO0 A; 2ZJ6 A; 3S6L A; 4DT5 A; 3LAA A; 1AF0 A; 1SAT A; 3A70 A; 1KAP P; 1O0Q A; 3HDA P; 4I35 A; 2ZVD A; 1P9H A; 1OMJ A; 2ZJ7 A; 1SMP A; 2Z8Z A; 2Z8X A; 1OM8 A; 2QUA A; 1G9K A; 2XQH A; 1AKL A; 1GO7 P; 3U1R A; 1H71 P; 1OM7 A; 3ULT A; 1K7G A; 3HBU P; 1O0T A; 3A6Z A; 2YO1 A; 2ML2 A; #chains in the Genus database with same CATH homology 3LA9 A; 1SRP A; 1JIW P; 1OM6 A; 3HBV P; 3HB2 P; 5CXL A; 5CVW A; 3WP8 A; 5D7W A; 1K7I A; 3NTN A; 3VI1 A; 2AGM A; 1GO8 P; 2QUB A; 1K7Q A; 2YO0 A; 2ZJ6 A; 3S6L A; 3LAA A; 1AF0 A; 1SAT A; 3A70 A; 1KAP P; 1O0Q A; 3HDA P; 4I35 A; 2ZVD A; 1P9H A; 1OMJ A; 2ZJ7 A; 1SMP A; 2Z8Z A; 2Z8X A; 1OM8 A; 2QUA A; 1G9K A; 2XQH A; 1AKL A; 1GO7 P; 3U1R A; 1H71 P; 1OM7 A; 3ULT A; 1K7G A; 3HBU P; 1O0T A; 3A6Z A; 2YO1 A; 2ML2 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
