1GO8P

The metzincin's methionine: prtc m226l mutant
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
460
structure length
460
Chain Sequence
TSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSILSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords PROTEASE C
publication title Crystal Structure of a Complex between Pseudomonas Aeruginosa Alkaline Protease and its Cognate Inhibitor: Inhibition by a Zinc-NH2 Coordinative Bond
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 162
structure length 460
sequence length 460
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1go8P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1go8P02
1IADA 2PJTA 1B3DA 4JA1A 1D8FA 3EDHA 1I76A 2X7MA 3LA9A 3KHIA 2OW0A 5BOTA 3E8RA 2K2GA 2OW9A 3HDAP 1MMBA 2D1NA 3WV2A 5I3MA 3LAAA 1ZXVA 2WO8A 3AYKA 5H8XA 4AIGA 3OHLA 3G42A 3HYGA 4IUWA 3LJGA 1SLMA 3B8ZA 1R54A 2AYKA 1IAAA 4XM8A 1SATA 2YIGA 2KRJA 1QJJA 4WZVA 1FM1A 2Y6CA 5B5PA 5L79A 1ATLA 1OO9A 4JP4A 1J7NA 1GE7A 1CQRA 3ELMA 1FBLA 4FXYP 2MZHA 4GUYA 1CIZA 4PKQA 1D5JA 3HY7A 4CTHA 3KMCA 5I2ZA 2ERQA 1C3IA 1A85A 5D2BA 1OM6A 1GKDA 4GR0A 1CAQA 1KAPP 1YCMA 2DW2A 1SU3A 1WNIA 4AUOA 3BA0A 1PWWA 1UEAA 1GO8P 3LGPA 2J0TA 3DNGA 3F18A 3HBVP 3K7LA 2TCLA 4H30A 2E2DA 2DDFA 2OXZA 3EHYA 1RM8A 1BKCE 1BUVM 1H71P 1ND1A 4IN9A 1KBCA 1G9KA 2O3EA 1R55A 1O0QA 1UMTA 2HU6A 3HBUP 1IAGA 2USNA 4L63A 1OS2A 5D1UA 5D7WA 1PWUA 2YO1A 1QIBA 4PKWA 1FLSA 2YB9A 1JIZA 5B5OA 1IACA 5D1TA 3S6LA 3DPEA 4J4MA 1CGFA 1R1HA 2OI0A 4FVLA 4JQGA 4DF9A 2OXWA 3KRYA 1KUKA 3LQBA 5CXLA 1JANA 3I7GA 3LIRA 4GR8A 5D1SA 1CGLA 456CA 2ZJ7A 1CK7A 4AXQA 2QUAA 4HX3A 1JKYA 1O0TA 3EDZA 4GQLA 1OM8A 2RJQA 4PKRA 3LJZA 1GO7P 3F19A 5CUHA 1BZSA 2CLTA 4PKVA 4GWMA 1DMTA 3P1VA 1SMPA 1QICA 2OY2A 5CXAA 1XURA 1XFWA 2JSDA 1Y8JA 1IAEA 1C7KA 1Y93A 1D7XA 3LMCA 3VTGA 2YO0A 4WKEA 5I12A 2I47A 3NX7A 1K7QA 2Y6DA 3G5CA 4WKIA 1R1IA 1HOVA 1GE5A 1ZTQA 1PWQA 4ON1A 3O2XA 3P24A 3L0TA 5I0LA 3ZVSA 3ZUKA 4PKTA 3KEJA 4H76A 3F15A 1KUHA 1JAPA 4DV8A 3O64A 1KUFA 1OS9A 1CGEA 3TS4A 2DDYA 2N8RA 2ZJ6A 2RJPA 3A70A 4ZR5A 3I7IA 1IABA 4IJOA 3Q2HA 4WF6A 1AF0A 3TSKA 2OXUA 1JH1A 1Y0VA 5BPAA 830CA 3A6ZA 3EDGA 1JK3A 1XFVA 4H82A 1RMZA 3LE9A 3LEAA 1EUBA 1SLNA 3LIKA 1JJ9A 1D8MA 1PWPA 1BKCI 2POJA 4I03A 2D1OA 3NTNA 2V4BA 2JNPA 1XUDA 1HFSA 4QKZA 4GR3A 4AYKA 3LILA 2DW1A 3HB2P 1YP1A 2K9CA 3GBOA 1ZVXA 1ZXCA 3KWVC 1ROSA 2AIGP 4H49A 3TVCA 2OW2A 1ASTA 5CZMA 1S4BP 2QPJA 1K7IA 4DD8A 2ML2A 3V96B 2FV9A 1UTTA 966CA 4G0DA 3LJTA 2JIHA 1BKCA 3USNA 2L0RA 1QJIA 1GKCA 3WV1A 1HV5A 3RTSA 4DPEA 2OVZA 4WK7A 2ERPA 4XM6A 5LABA 4ILWD 1XFXA 4JIJA 2Z2DA 1XFUA 3DL1A 1MMPA 2CKIA 3U1RA 2MZEA 1BSWA 1YOUA 1HFCA 3AIGA 1XUCA 3LUNA 2W13A 3LK8A 2XS3A 1XFYA 1JAQA 2W12A 4H3XA 4I35A 1EAKA 3B92A 5L7FA 3EWJA 3SHIA 1GXDA 5BOYA 1G4KA 2O36A 1Z3JA 2OVXA 2X3BA 3TT4A 4EFSA 2FV5A 1USNA 2JT5A 2W15A 3LKAA 1L6JA 1P9HA 2A8HA 1I1IP 1MNCA 3EHXA 3RTTA 5JMYA 4FU4A 1HY7A 3ULTA 1MMRA 3DWBA 1G49A 4A3WA 3WP8A 1CXVA 3AYUA 2MZIA 4XM7A 4PKUA 2MLSA 4GWNA 2WO9A 4XCTA 1AKLA 2WOAA 1BM6A 2SRTA 3MA2A 4H2EA 1EB6A 1JIWP 4H1QA 1HTDA 1DTHA 1OM7A 1BQOA 4FXQA 5I43A 3L0VA 3DPFA 2EROA 1B8YA 3F1AA 2ZVDA 3B2ZA 2XS4A 2OZRA 2DW0A 3DSLA 1G05A 3LUMA 1UTZA 3KEKA 5I4OA 1SRPA 3WV3A 1QIAA 3EDIA 4L6TA 2E3XA 1ZS0A 3F16A 3ZXHA 3LQ0A 4PKSA 3K7NA 2X3AA 2W14A 2Z8ZA 2QUBA 1KUIA 5CVWA 1Q3AA 3Q2GA 3KECA 2OW1A 2OY4A 2X3CA 4R3VA 4G9LA 1OMJA 3VI1A 1A86A 3CKIA 1AYKA 1G12A 4JPAA 2JT6A 1JAOA 1XFZA 1GE6A 1KUGA 2AGMA 1R1JA 3N2UA 3OHOA 4HMAA 5D3CA 3F17A 2J83A 1ZP5A 2XQHA 3UVCA 1I73A 1C8TA 4A7BA 2Z8XA 1YQYA 1BUDA 1QUAA 2W0DA 1BIWA 1K7GA 4GF1A 4H84A 1UMSA 1MMQA 1BQQM 3HDBA 3KMEA 4Q1LA 3N2VA 2MLRA 4L19A 4XBHA 3HY9A 1PWVA
chains in the Genus database with same CATH superfamily
1IADA 2PJTA 1B3DA 4JA1A 1D8FA 3EDHA 1I76A 2X7MA 3LA9A 3KHIA 2OW0A 5BOTA 3E8RA 2K2GA 2OW9A 3HDAP 1MMBA 2D1NA 3WV2A 5I3MA 3LAAA 1ZXVA 2WO8A 3AYKA 5H8XA 4AIGA 3OHLA 3G42A 3HYGA 4IUWA 3LJGA 1SLMA 3B8ZA 1R54A 2AYKA 1IAAA 4XM8A 1SATA 2YIGA 2KRJA 1QJJA 4WZVA 1FM1A 2Y6CA 5B5PA 5L79A 1ATLA 1OO9A 4JP4A 1J7NA 1GE7A 1CQRA 3ELMA 1FBLA 4FXYP 2MZHA 4GUYA 1CIZA 4PKQA 1D5JA 3HY7A 4CTHA 3KMCA 5I2ZA 2ERQA 1C3IA 1A85A 5D2BA 1OM6A 1GKDA 4GR0A 1CAQA 1KAPP 1YCMA 2DW2A 1SU3A 1WNIA 4AUOA 3BA0A 1XM5A 1PWWA 1UEAA 1GO8P 3LGPA 2J0TA 3DNGA 3F18A 3HBVP 3K7LA 2TCLA 4H30A 2E2DA 2DDFA 2OXZA 3EHYA 1RM8A 1BKCE 3DTEA 1BUVM 1H71P 1ND1A 4IN9A 1KBCA 1G9KA 2O3EA 1R55A 1O0QA 1UMTA 2HU6A 3HBUP 1IAGA 2USNA 4L63A 1OS2A 5D1UA 5D7WA 1PWUA 2YO1A 1QIBA 1OZ9A 1FLSA 2YB9A 4PKWA 1JIZA 5B5OA 1IACA 5D1TA 3S6LA 3DPEA 4J4MA 1CGFA 1R1HA 2OI0A 4FVLA 4JQGA 4DF9A 2OXWA 3KRYA 1KUKA 3LQBA 5CXLA 1JANA 3I7GA 3LIRA 4GR8A 5D1SA 1CGLA 456CA 2ZJ7A 1CK7A 4AXQA 2QUAA 4HX3A 1JKYA 1O0TA 3EDZA 4GQLA 1OM8A 2RJQA 4PKRA 3LJZA 1GO7P 3F19A 5CUHA 1BZSA 2CLTA 4PKVA 4GWMA 1DMTA 3DTKA 3P1VA 1SMPA 1QICA 2OY2A 5CXAA 1XURA 1XFWA 2JSDA 1Y8JA 1IAEA 1C7KA 1Y93A 1D7XA 3LMCA 3VTGA 2YO0A 4WKEA 5I12A 2I47A 3NX7A 1K7QA 2Y6DA 3G5CA 4WKIA 1R1IA 1HOVA 1GE5A 1ZTQA 1PWQA 4ON1A 3O2XA 3P24A 3L0TA 5I0LA 3ZVSA 3ZUKA 4PKTA 3KEJA 4H76A 3F15A 1KUHA 1JAPA 4DV8A 3O64A 1KUFA 1OS9A 1CGEA 3TS4A 2DDYA 2N8RA 2ZJ6A 2RJPA 3A70A 4ZR5A 3I7IA 1IABA 4IJOA 3Q2HA 4WF6A 1AF0A 3TSKA 2OXUA 1JH1A 1Y0VA 5BPAA 830CA 3A6ZA 3EDGA 1JK3A 1XFVA 4H82A 1RMZA 3LE9A 3LEAA 1EUBA 1SLNA 3LIKA 1JJ9A 1D8MA 1PWPA 1BKCI 2POJA 4I03A 2D1OA 3NTNA 2V4BA 2JNPA 1XUDA 1HFSA 4QKZA 4GR3A 4AYKA 3LILA 2DW1A 3HB2P 1YP1A 2K9CA 3GBOA 1ZVXA 1ZXCA 3KWVC 1ROSA 2AIGP 4H49A 3TVCA 2OW2A 1ASTA 5CZMA 1S4BP 2QPJA 1K7IA 4DD8A 2ML2A 3V96B 2FV9A 1UTTA 966CA 4G0DA 3LJTA 2JIHA 1BKCA 3USNA 2L0RA 1QJIA 1GKCA 3WV1A 1HV5A 3RTSA 4DPEA 2OVZA 4WK7A 2ERPA 4XM6A 2YUFA 5LABA 4ILWD 1XFXA 4JIJA 2Z2DA 1XFUA 3DL1A 1MMPA 2CKIA 3U1RA 2MZEA 1BSWA 1YOUA 1HFCA 3AIGA 1XUCA 3LUNA 2W13A 3LK8A 2XS3A 1XFYA 1JAQA 2W12A 4H3XA 4I35A 1EAKA 3B92A 5L7FA 3EWJA 3SHIA 1GXDA 5BOYA 1G4KA 2O36A 1Z3JA 2OVXA 2X3BA 3TT4A 4EFSA 2FV5A 1USNA 2JT5A 2W15A 3LKAA 1L6JA 1P9HA 2A8HA 1I1IP 1MNCA 3EHXA 3RTTA 1XAXA 5JMYA 4FU4A 1HY7A 3ULTA 1MMRA 3DWBA 1G49A 1TVIA 4A3WA 3WP8A 1CXVA 3AYUA 2MZIA 4XM7A 4PKUA 2MLSA 4GWNA 2WO9A 4XCTA 1AKLA 2WOAA 1BM6A 2SRTA 3MA2A 4H2EA 1EB6A 1JIWP 4H1QA 1HTDA 1DTHA 1OM7A 1BQOA 4FXQA 5I43A 3L0VA 3DPFA 2EROA 1B8YA 3F1AA 2ZVDA 3B2ZA 2XS4A 2OZRA 2DW0A 3DSLA 1G05A 3LUMA 1UTZA 3KEKA 5I4OA 1SRPA 3WV3A 1QIAA 3EDIA 4L6TA 2E3XA 1ZS0A 3F16A 3ZXHA 3LQ0A 4PKSA 3K7NA 2X3AA 4L7AA 2W14A 2Z8ZA 2QUBA 1KUIA 5CVWA 1Q3AA 3Q2GA 3KECA 2OW1A 2OY4A 2X3CA 4R3VA 4G9LA 1OMJA 3VI1A 1A86A 3CKIA 1AYKA 1G12A 4JPAA 2JT6A 1JAOA 1XFZA 1GE6A 1KUGA 2AGMA 1R1JA 3N2UA 3OHOA 4HMAA 5D3CA 3F17A 2J83A 1ZP5A 2XQHA 3UVCA 1I73A 3DTIA 1C8TA 4A7BA 2Z8XA 4DT5A 1YQYA 1BUDA 1QUAA 2W0DA 1BIWA 1K7GA 4GF1A 4H84A 1UMSA 1MMQA 1BQQM 3HDBA 3KMEA 4Q1LA 3N2VA 2MLRA 4L19A 4XBHA 3HY9A 1PWVA
chains in the Genus database with same CATH topology
1IADA 2PJTA 1B3DA 4JA1A 1D8FA 3EDHA 1I76A 2X7MA 3LA9A 3KHIA 2OW0A 5BOTA 3E8RA 2K2GA 2OW9A 3HDAP 1MMBA 2D1NA 3WV2A 5I3MA 3LAAA 1ZXVA 2WO8A 3AYKA 5H8XA 4AIGA 3OHLA 3G42A 3HYGA 4IUWA 3LJGA 1SLMA 3B8ZA 1R54A 2AYKA 1IAAA 4XM8A 1SATA 2YIGA 2KRJA 1QJJA 4WZVA 1FM1A 2Y6CA 5B5PA 5L79A 1ATLA 1OO9A 4JP4A 1J7NA 1GE7A 1CQRA 3ELMA 1FBLA 4FXYP 2MZHA 4GUYA 1CIZA 4PKQA 1D5JA 3HY7A 4CTHA 3KMCA 5I2ZA 2ERQA 1C3IA 1A85A 5D2BA 1OM6A 1GKDA 4GR0A 1CAQA 1KAPP 1YCMA 2DW2A 1SU3A 1WNIA 4AUOA 3BA0A 1PWWA 1UEAA 1GO8P 3LGPA 2J0TA 3DNGA 3F18A 3HBVP 3K7LA 2TCLA 4H30A 2E2DA 2DDFA 2OXZA 3EHYA 1RM8A 1BKCE 3DTEA 1BUVM 1H71P 1ND1A 4IN9A 1KBCA 1G9KA 2O3EA 1R55A 1O0QA 1UMTA 2HU6A 3HBUP 1IAGA 2USNA 4L63A 1OS2A 5D1UA 5D7WA 1PWUA 2YO1A 1QIBA 4PKWA 1FLSA 2YB9A 1JIZA 5B5OA 1IACA 5D1TA 3S6LA 3DPEA 4J4MA 1CGFA 1R1HA 2OI0A 4FVLA 4JQGA 4DF9A 2OXWA 3KRYA 1KUKA 3LQBA 5CXLA 1JANA 3I7GA 3LIRA 4GR8A 5D1SA 1CGLA 456CA 2ZJ7A 1CK7A 4AXQA 2QUAA 4HX3A 1JKYA 1O0TA 3EDZA 4GQLA 1OM8A 2RJQA 4PKRA 3LJZA 1GO7P 3F19A 5CUHA 1BZSA 2CLTA 4PKVA 4GWMA 1DMTA 3DTKA 3P1VA 1SMPA 1QICA 2OY2A 5CXAA 1XURA 1XFWA 2JSDA 1Y8JA 1IAEA 1C7KA 1Y93A 1D7XA 3LMCA 3VTGA 2YO0A 4WKEA 5I12A 2I47A 3NX7A 1K7QA 2Y6DA 3G5CA 4WKIA 1R1IA 1HOVA 1GE5A 1ZTQA 1PWQA 4ON1A 3O2XA 3P24A 3L0TA 5I0LA 3ZVSA 3ZUKA 4PKTA 3KEJA 4H76A 3F15A 1KUHA 1JAPA 4DV8A 3O64A 1KUFA 1OS9A 1CGEA 3TS4A 2DDYA 2N8RA 2ZJ6A 2RJPA 3A70A 4ZR5A 3I7IA 1IABA 4IJOA 3Q2HA 4WF6A 1AF0A 3TSKA 2OXUA 1JH1A 1Y0VA 5BPAA 830CA 3A6ZA 3EDGA 1JK3A 1XFVA 4H82A 1RMZA 3LE9A 3LEAA 1EUBA 1SLNA 3LIKA 1JJ9A 1D8MA 1PWPA 1BKCI 2POJA 4I03A 2D1OA 3NTNA 2V4BA 2JNPA 1XUDA 1HFSA 4QKZA 4GR3A 4AYKA 3LILA 2DW1A 3HB2P 1YP1A 2K9CA 3GBOA 1ZVXA 1ZXCA 3KWVC 1ROSA 2AIGP 4H49A 3TVCA 2OW2A 1ASTA 5CZMA 1S4BP 2QPJA 1K7IA 4DD8A 2ML2A 3V96B 2FV9A 1UTTA 966CA 4G0DA 3LJTA 2JIHA 1BKCA 3USNA 2L0RA 1QJIA 1GKCA 3WV1A 1HV5A 3RTSA 4DPEA 2OVZA 4WK7A 2ERPA 4XM6A 2YUFA 5LABA 4ILWD 1XFXA 4JIJA 2Z2DA 1XFUA 3DL1A 1MMPA 2CKIA 3U1RA 2MZEA 1BSWA 1YOUA 1HFCA 3AIGA 1XUCA 3LUNA 2W13A 3LK8A 2XS3A 1XFYA 1JAQA 2W12A 4H3XA 4I35A 1EAKA 3B92A 5L7FA 3EWJA 3SHIA 1GXDA 5BOYA 1G4KA 2O36A 1Z3JA 2OVXA 2X3BA 3TT4A 4EFSA 2FV5A 1USNA 2JT5A 2W15A 3LKAA 1L6JA 1P9HA 2A8HA 1I1IP 1MNCA 3EHXA 3RTTA 5JMYA 4FU4A 1HY7A 3ULTA 1MMRA 3DWBA 1G49A 4A3WA 3WP8A 1CXVA 3AYUA 2MZIA 4XM7A 4PKUA 2MLSA 4GWNA 2WO9A 4XCTA 1AKLA 2WOAA 1BM6A 2SRTA 3MA2A 4H2EA 1EB6A 1JIWP 4H1QA 1HTDA 1DTHA 1OM7A 1BQOA 4FXQA 5I43A 3L0VA 3DPFA 2EROA 1B8YA 3F1AA 2ZVDA 3B2ZA 2XS4A 2OZRA 2DW0A 3DSLA 1G05A 3LUMA 1UTZA 3KEKA 5I4OA 1SRPA 3WV3A 1QIAA 3EDIA 4L6TA 2E3XA 1ZS0A 3F16A 3ZXHA 3LQ0A 4PKSA 3K7NA 2X3AA 4L7AA 2W14A 2Z8ZA 2QUBA 1KUIA 5CVWA 1Q3AA 3Q2GA 3KECA 2OW1A 2OY4A 2X3CA 4R3VA 4G9LA 1OMJA 3VI1A 1A86A 3CKIA 1AYKA 1G12A 4JPAA 2JT6A 1JAOA 1XFZA 1GE6A 1KUGA 2AGMA 1R1JA 3N2UA 3OHOA 4HMAA 5D3CA 3F17A 2J83A 1ZP5A 2XQHA 3UVCA 1I73A 3DTIA 1C8TA 4A7BA 2Z8XA 1YQYA 1BUDA 1QUAA 2W0DA 1BIWA 1K7GA 4GF1A 4H84A 1UMSA 1MMQA 1BQQM 3HDBA 3KMEA 4Q1LA 3N2VA 2MLRA 4L19A 4XBHA 3HY9A 1PWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IAD A;  2PJT A;  1B3D A;  4JA1 A;  1D8F A;  3EDH A;  1I76 A;  2X7M A;  3LA9 A;  3KHI A;  2OW0 A;  5BOT A;  3E8R A;  2K2G A;  2OW9 A;  3HDA P;  1MMB A;  2D1N A;  3WV2 A;  5I3M A;  3LAA A;  1ZXV A;  2WO8 A;  3AYK A;  5H8X A;  4AIG A;  3OHL A;  3G42 A;  3HYG A;  4IUW A;  3LJG A;  1SLM A;  3B8Z A;  1R54 A;  2AYK A;  1IAA A;  4XM8 A;  1SAT A;  2YIG A;  2KRJ A;  1QJJ A;  4WZV A;  1FM1 A;  2Y6C A;  5B5P A;  5L79 A;  1ATL A;  1OO9 A;  4JP4 A;  1J7N A;  1GE7 A;  1CQR A;  3ELM A;  1FBL A;  4FXY P;  2MZH A;  4GUY A;  1CIZ A;  4PKQ A;  1D5J A;  3HY7 A;  4CTH A;  3KMC A;  5I2Z A;  2ERQ A;  1C3I A;  1A85 A;  5D2B A;  1OM6 A;  1GKD A;  4GR0 A;  1CAQ A;  1KAP P;  1YCM A;  2DW2 A;  1SU3 A;  1WNI A;  4AUO A;  3BA0 A;  1PWW A;  1UEA A;  1GO8 P;  3LGP A;  2J0T A;  3DNG A;  3F18 A;  3HBV P;  3K7L A;  2TCL A;  4H30 A;  2E2D A;  2DDF A;  2OXZ A;  3EHY A;  1RM8 A;  1BKC E;  1BUV M;  1H71 P;  1ND1 A;  4IN9 A;  1KBC A;  1G9K A;  2O3E A;  1R55 A;  1O0Q A;  1UMT A;  2HU6 A;  3HBU P;  1IAG A;  2USN A;  4L63 A;  1OS2 A;  5D1U A;  5D7W A;  1PWU A;  2YO1 A;  1QIB A;  4PKW A;  1FLS A;  2YB9 A;  1JIZ A;  5B5O A;  1IAC A;  5D1T A;  3S6L A;  3DPE A;  4J4M A;  1CGF A;  1R1H A;  2OI0 A;  4FVL A;  4JQG A;  4DF9 A;  2OXW A;  3KRY A;  1KUK A;  3LQB A;  5CXL A;  1JAN A;  3I7G A;  3LIR A;  4GR8 A;  5D1S A;  1CGL A;  456C A;  2ZJ7 A;  1CK7 A;  4AXQ A;  2QUA A;  4HX3 A;  1JKY A;  1O0T A;  3EDZ A;  4GQL A;  1OM8 A;  2RJQ A;  4PKR A;  3LJZ A;  1GO7 P;  3F19 A;  5CUH A;  1BZS A;  2CLT A;  4PKV A;  4GWM A;  1DMT A;  3P1V A;  1SMP A;  1QIC A;  2OY2 A;  5CXA A;  1XUR A;  1XFW A;  2JSD A;  1Y8J A;  1IAE A;  1C7K A;  1Y93 A;  1D7X A;  3LMC A;  3VTG A;  2YO0 A;  4WKE A;  5I12 A;  2I47 A;  3NX7 A;  1K7Q A;  2Y6D A;  3G5C A;  4WKI A;  1R1I A;  1HOV A;  1GE5 A;  1ZTQ A;  1PWQ A;  4ON1 A;  3O2X A;  3P24 A;  3L0T A;  5I0L A;  3ZVS A;  3ZUK A;  4PKT A;  3KEJ A;  4H76 A;  3F15 A;  1KUH A;  1JAP A;  4DV8 A;  3O64 A;  1KUF A;  1OS9 A;  1CGE A;  3TS4 A;  2DDY A;  2N8R A;  2ZJ6 A;  2RJP A;  3A70 A;  4ZR5 A;  3I7I A;  1IAB A;  4IJO A;  3Q2H A;  4WF6 A;  1AF0 A;  3TSK A;  2OXU A;  1JH1 A;  1Y0V A;  5BPA A;  830C A;  3A6Z A;  3EDG A;  1JK3 A;  1XFV A;  4H82 A;  1RMZ A;  3LE9 A;  3LEA A;  1EUB A;  1SLN A;  3LIK A;  1JJ9 A;  1D8M A;  1PWP A;  1BKC I;  2POJ A;  4I03 A;  2D1O A;  3NTN A;  2V4B A;  2JNP A;  1XUD A;  1HFS A;  4QKZ A;  4GR3 A;  4AYK A;  3LIL A;  2DW1 A;  3HB2 P;  1YP1 A;  2K9C A;  3GBO A;  1ZVX A;  1ZXC A;  3KWV C;  1ROS A;  2AIG P;  4H49 A;  3TVC A;  2OW2 A;  1AST A;  5CZM A;  1S4B P;  2QPJ A;  1K7I A;  4DD8 A;  2ML2 A;  3V96 B;  2FV9 A;  1UTT A;  966C A;  4G0D A;  3LJT A;  2JIH A;  1BKC A;  3USN A;  2L0R A;  1QJI A;  1GKC A;  3WV1 A;  1HV5 A;  3RTS A;  4DPE A;  2OVZ A;  4WK7 A;  2ERP A;  4XM6 A;  5LAB A;  4ILW D;  1XFX A;  4JIJ A;  2Z2D A;  1XFU A;  3DL1 A;  1MMP A;  2CKI A;  3U1R A;  2MZE A;  1BSW A;  1YOU A;  1HFC A;  3AIG A;  1XUC A;  3LUN A;  2W13 A;  3LK8 A;  2XS3 A;  1XFY A;  1JAQ A;  2W12 A;  4H3X A;  4I35 A;  1EAK A;  3B92 A;  5L7F A;  3EWJ A;  3SHI A;  1GXD A;  5BOY A;  1G4K A;  2O36 A;  1Z3J A;  2OVX A;  2X3B A;  3TT4 A;  4EFS A;  2FV5 A;  1USN A;  2JT5 A;  2W15 A;  3LKA A;  1L6J A;  1P9H A;  2A8H A;  1I1I P;  1MNC A;  3EHX A;  3RTT A;  5JMY A;  4FU4 A;  1HY7 A;  3ULT A;  1MMR A;  3DWB A;  1G49 A;  4A3W A;  3WP8 A;  1CXV A;  3AYU A;  2MZI A;  4XM7 A;  4PKU A;  2MLS A;  4GWN A;  2WO9 A;  4XCT A;  1AKL A;  2WOA A;  1BM6 A;  2SRT A;  3MA2 A;  4H2E A;  1EB6 A;  1JIW P;  4H1Q A;  1HTD A;  1DTH A;  1OM7 A;  1BQO A;  4FXQ A;  5I43 A;  3L0V A;  3DPF A;  2ERO A;  1B8Y A;  3F1A A;  2ZVD A;  3B2Z A;  2XS4 A;  2OZR A;  2DW0 A;  3DSL A;  1G05 A;  3LUM A;  1UTZ A;  3KEK A;  5I4O A;  1SRP A;  3WV3 A;  1QIA A;  3EDI A;  4L6T A;  2E3X A;  1ZS0 A;  3F16 A;  3ZXH A;  3LQ0 A;  4PKS A;  3K7N A;  2X3A A;  2W14 A;  2Z8Z A;  2QUB A;  1KUI A;  5CVW A;  1Q3A A;  3Q2G A;  3KEC A;  2OW1 A;  2OY4 A;  2X3C A;  4R3V A;  4G9L A;  1OMJ A;  3VI1 A;  1A86 A;  3CKI A;  1AYK A;  1G12 A;  4JPA A;  2JT6 A;  1JAO A;  1XFZ A;  1GE6 A;  1KUG A;  2AGM A;  1R1J A;  3N2U A;  3OHO A;  4HMA A;  5D3C A;  3F17 A;  2J83 A;  1ZP5 A;  2XQH A;  3UVC A;  1I73 A;  1C8T A;  4A7B A;  2Z8X A;  1YQY A;  1BUD A;  1QUA A;  2W0D A;  1BIW A;  1K7G A;  4GF1 A;  4H84 A;  1UMS A;  1MMQ A;  1BQQ M;  3HDB A;  3KME A;  4Q1L A;  3N2V A;  2MLR A;  4L19 A;  4XBH A;  3HY9 A;  1PWV A; 
#chains in the Genus database with same CATH topology
 1IAD A;  2PJT A;  1B3D A;  4JA1 A;  1D8F A;  3EDH A;  1I76 A;  2X7M A;  3LA9 A;  3KHI A;  2OW0 A;  5BOT A;  3E8R A;  2K2G A;  2OW9 A;  3HDA P;  1MMB A;  2D1N A;  3WV2 A;  5I3M A;  3LAA A;  1ZXV A;  2WO8 A;  3AYK A;  5H8X A;  4AIG A;  3OHL A;  3G42 A;  3HYG A;  4IUW A;  3LJG A;  1SLM A;  3B8Z A;  1R54 A;  2AYK A;  1IAA A;  4XM8 A;  1SAT A;  2YIG A;  2KRJ A;  1QJJ A;  4WZV A;  1FM1 A;  2Y6C A;  5B5P A;  5L79 A;  1ATL A;  1OO9 A;  4JP4 A;  1J7N A;  1GE7 A;  1CQR A;  3ELM A;  1FBL A;  4FXY P;  2MZH A;  4GUY A;  1CIZ A;  4PKQ A;  1D5J A;  3HY7 A;  4CTH A;  3KMC A;  5I2Z A;  2ERQ A;  1C3I A;  1A85 A;  5D2B A;  1OM6 A;  1GKD A;  4GR0 A;  1CAQ A;  1KAP P;  1YCM A;  2DW2 A;  1SU3 A;  1WNI A;  4AUO A;  3BA0 A;  1XM5 A;  1PWW A;  1UEA A;  1GO8 P;  3LGP A;  2J0T A;  3DNG A;  3F18 A;  3HBV P;  3K7L A;  2TCL A;  4H30 A;  2E2D A;  2DDF A;  2OXZ A;  3EHY A;  1RM8 A;  1BKC E;  3DTE A;  1BUV M;  1H71 P;  1ND1 A;  4IN9 A;  1KBC A;  1G9K A;  2O3E A;  1R55 A;  1O0Q A;  1UMT A;  2HU6 A;  3HBU P;  1IAG A;  2USN A;  4L63 A;  1OS2 A;  5D1U A;  5D7W A;  1PWU A;  2YO1 A;  1QIB A;  1OZ9 A;  1FLS A;  2YB9 A;  4PKW A;  1JIZ A;  5B5O A;  1IAC A;  5D1T A;  3S6L A;  3DPE A;  4J4M A;  1CGF A;  1R1H A;  2OI0 A;  4FVL A;  4JQG A;  4DF9 A;  2OXW A;  3KRY A;  1KUK A;  3LQB A;  5CXL A;  1JAN A;  3I7G A;  3LIR A;  4GR8 A;  5D1S A;  1CGL A;  456C A;  2ZJ7 A;  1CK7 A;  4AXQ A;  2QUA A;  4HX3 A;  1JKY A;  1O0T A;  3EDZ A;  4GQL A;  1OM8 A;  2RJQ A;  4PKR A;  3LJZ A;  1GO7 P;  3F19 A;  5CUH A;  1BZS A;  2CLT A;  4PKV A;  4GWM A;  1DMT A;  3DTK A;  3P1V A;  1SMP A;  1QIC A;  2OY2 A;  5CXA A;  1XUR A;  1XFW A;  2JSD A;  1Y8J A;  1IAE A;  1C7K A;  1Y93 A;  1D7X A;  3LMC A;  3VTG A;  2YO0 A;  4WKE A;  5I12 A;  2I47 A;  3NX7 A;  1K7Q A;  2Y6D A;  3G5C A;  4WKI A;  1R1I A;  1HOV A;  1GE5 A;  1ZTQ A;  1PWQ A;  4ON1 A;  3O2X A;  3P24 A;  3L0T A;  5I0L A;  3ZVS A;  3ZUK A;  4PKT A;  3KEJ A;  4H76 A;  3F15 A;  1KUH A;  1JAP A;  4DV8 A;  3O64 A;  1KUF A;  1OS9 A;  1CGE A;  3TS4 A;  2DDY A;  2N8R A;  2ZJ6 A;  2RJP A;  3A70 A;  4ZR5 A;  3I7I A;  1IAB A;  4IJO A;  3Q2H A;  4WF6 A;  1AF0 A;  3TSK A;  2OXU A;  1JH1 A;  1Y0V A;  5BPA A;  830C A;  3A6Z A;  3EDG A;  1JK3 A;  1XFV A;  4H82 A;  1RMZ A;  3LE9 A;  3LEA A;  1EUB A;  1SLN A;  3LIK A;  1JJ9 A;  1D8M A;  1PWP A;  1BKC I;  2POJ A;  4I03 A;  2D1O A;  3NTN A;  2V4B A;  2JNP A;  1XUD A;  1HFS A;  4QKZ A;  4GR3 A;  4AYK A;  3LIL A;  2DW1 A;  3HB2 P;  1YP1 A;  2K9C A;  3GBO A;  1ZVX A;  1ZXC A;  3KWV C;  1ROS A;  2AIG P;  4H49 A;  3TVC A;  2OW2 A;  1AST A;  5CZM A;  1S4B P;  2QPJ A;  1K7I A;  4DD8 A;  2ML2 A;  3V96 B;  2FV9 A;  1UTT A;  966C A;  4G0D A;  3LJT A;  2JIH A;  1BKC A;  3USN A;  2L0R A;  1QJI A;  1GKC A;  3WV1 A;  1HV5 A;  3RTS A;  4DPE A;  2OVZ A;  4WK7 A;  2ERP A;  4XM6 A;  2YUF A;  5LAB A;  4ILW D;  1XFX A;  4JIJ A;  2Z2D A;  1XFU A;  3DL1 A;  1MMP A;  2CKI A;  3U1R A;  2MZE A;  1BSW A;  1YOU A;  1HFC A;  3AIG A;  1XUC A;  3LUN A;  2W13 A;  3LK8 A;  2XS3 A;  1XFY A;  1JAQ A;  2W12 A;  4H3X A;  4I35 A;  1EAK A;  3B92 A;  5L7F A;  3EWJ A;  3SHI A;  1GXD A;  5BOY A;  1G4K A;  2O36 A;  1Z3J A;  2OVX A;  2X3B A;  3TT4 A;  4EFS A;  2FV5 A;  1USN A;  2JT5 A;  2W15 A;  3LKA A;  1L6J A;  1P9H A;  2A8H A;  1I1I P;  1MNC A;  3EHX A;  3RTT A;  1XAX A;  5JMY A;  4FU4 A;  1HY7 A;  3ULT A;  1MMR A;  3DWB A;  1G49 A;  1TVI A;  4A3W A;  3WP8 A;  1CXV A;  3AYU A;  2MZI A;  4XM7 A;  4PKU A;  2MLS A;  4GWN A;  2WO9 A;  4XCT A;  1AKL A;  2WOA A;  1BM6 A;  2SRT A;  3MA2 A;  4H2E A;  1EB6 A;  1JIW P;  4H1Q A;  1HTD A;  1DTH A;  1OM7 A;  1BQO A;  4FXQ A;  5I43 A;  3L0V A;  3DPF A;  2ERO A;  1B8Y A;  3F1A A;  2ZVD A;  3B2Z A;  2XS4 A;  2OZR A;  2DW0 A;  3DSL A;  1G05 A;  3LUM A;  1UTZ A;  3KEK A;  5I4O A;  1SRP A;  3WV3 A;  1QIA A;  3EDI A;  4L6T A;  2E3X A;  1ZS0 A;  3F16 A;  3ZXH A;  3LQ0 A;  4PKS A;  3K7N A;  2X3A A;  4L7A A;  2W14 A;  2Z8Z A;  2QUB A;  1KUI A;  5CVW A;  1Q3A A;  3Q2G A;  3KEC A;  2OW1 A;  2OY4 A;  2X3C A;  4R3V A;  4G9L A;  1OMJ A;  3VI1 A;  1A86 A;  3CKI A;  1AYK A;  1G12 A;  4JPA A;  2JT6 A;  1JAO A;  1XFZ A;  1GE6 A;  1KUG A;  2AGM A;  1R1J A;  3N2U A;  3OHO A;  4HMA A;  5D3C A;  3F17 A;  2J83 A;  1ZP5 A;  2XQH A;  3UVC A;  1I73 A;  3DTI A;  1C8T A;  4A7B A;  2Z8X A;  4DT5 A;  1YQY A;  1BUD A;  1QUA A;  2W0D A;  1BIW A;  1K7G A;  4GF1 A;  4H84 A;  1UMS A;  1MMQ A;  1BQQ M;  3HDB A;  3KME A;  4Q1L A;  3N2V A;  2MLR A;  4L19 A;  4XBH A;  3HY9 A;  1PWV A; 
#chains in the Genus database with same CATH homology
 1IAD A;  2PJT A;  1B3D A;  4JA1 A;  1D8F A;  3EDH A;  1I76 A;  2X7M A;  3LA9 A;  3KHI A;  2OW0 A;  5BOT A;  3E8R A;  2K2G A;  2OW9 A;  3HDA P;  1MMB A;  2D1N A;  3WV2 A;  5I3M A;  3LAA A;  1ZXV A;  2WO8 A;  3AYK A;  5H8X A;  4AIG A;  3OHL A;  3G42 A;  3HYG A;  4IUW A;  3LJG A;  1SLM A;  3B8Z A;  1R54 A;  2AYK A;  1IAA A;  4XM8 A;  1SAT A;  2YIG A;  2KRJ A;  1QJJ A;  4WZV A;  1FM1 A;  2Y6C A;  5B5P A;  5L79 A;  1ATL A;  1OO9 A;  4JP4 A;  1J7N A;  1GE7 A;  1CQR A;  3ELM A;  1FBL A;  4FXY P;  2MZH A;  4GUY A;  1CIZ A;  4PKQ A;  1D5J A;  3HY7 A;  4CTH A;  3KMC A;  5I2Z A;  2ERQ A;  1C3I A;  1A85 A;  5D2B A;  1OM6 A;  1GKD A;  4GR0 A;  1CAQ A;  1KAP P;  1YCM A;  2DW2 A;  1SU3 A;  1WNI A;  4AUO A;  3BA0 A;  1PWW A;  1UEA A;  1GO8 P;  3LGP A;  2J0T A;  3DNG A;  3F18 A;  3HBV P;  3K7L A;  2TCL A;  4H30 A;  2E2D A;  2DDF A;  2OXZ A;  3EHY A;  1RM8 A;  1BKC E;  3DTE A;  1BUV M;  1H71 P;  1ND1 A;  4IN9 A;  1KBC A;  1G9K A;  2O3E A;  1R55 A;  1O0Q A;  1UMT A;  2HU6 A;  3HBU P;  1IAG A;  2USN A;  4L63 A;  1OS2 A;  5D1U A;  5D7W A;  1PWU A;  2YO1 A;  1QIB A;  4PKW A;  1FLS A;  2YB9 A;  1JIZ A;  5B5O A;  1IAC A;  5D1T A;  3S6L A;  3DPE A;  4J4M A;  1CGF A;  1R1H A;  2OI0 A;  4FVL A;  4JQG A;  4DF9 A;  2OXW A;  3KRY A;  1KUK A;  3LQB A;  5CXL A;  1JAN A;  3I7G A;  3LIR A;  4GR8 A;  5D1S A;  1CGL A;  456C A;  2ZJ7 A;  1CK7 A;  4AXQ A;  2QUA A;  4HX3 A;  1JKY A;  1O0T A;  3EDZ A;  4GQL A;  1OM8 A;  2RJQ A;  4PKR A;  3LJZ A;  1GO7 P;  3F19 A;  5CUH A;  1BZS A;  2CLT A;  4PKV A;  4GWM A;  1DMT A;  3DTK A;  3P1V A;  1SMP A;  1QIC A;  2OY2 A;  5CXA A;  1XUR A;  1XFW A;  2JSD A;  1Y8J A;  1IAE A;  1C7K A;  1Y93 A;  1D7X A;  3LMC A;  3VTG A;  2YO0 A;  4WKE A;  5I12 A;  2I47 A;  3NX7 A;  1K7Q A;  2Y6D A;  3G5C A;  4WKI A;  1R1I A;  1HOV A;  1GE5 A;  1ZTQ A;  1PWQ A;  4ON1 A;  3O2X A;  3P24 A;  3L0T A;  5I0L A;  3ZVS A;  3ZUK A;  4PKT A;  3KEJ A;  4H76 A;  3F15 A;  1KUH A;  1JAP A;  4DV8 A;  3O64 A;  1KUF A;  1OS9 A;  1CGE A;  3TS4 A;  2DDY A;  2N8R A;  2ZJ6 A;  2RJP A;  3A70 A;  4ZR5 A;  3I7I A;  1IAB A;  4IJO A;  3Q2H A;  4WF6 A;  1AF0 A;  3TSK A;  2OXU A;  1JH1 A;  1Y0V A;  5BPA A;  830C A;  3A6Z A;  3EDG A;  1JK3 A;  1XFV A;  4H82 A;  1RMZ A;  3LE9 A;  3LEA A;  1EUB A;  1SLN A;  3LIK A;  1JJ9 A;  1D8M A;  1PWP A;  1BKC I;  2POJ A;  4I03 A;  2D1O A;  3NTN A;  2V4B A;  2JNP A;  1XUD A;  1HFS A;  4QKZ A;  4GR3 A;  4AYK A;  3LIL A;  2DW1 A;  3HB2 P;  1YP1 A;  2K9C A;  3GBO A;  1ZVX A;  1ZXC A;  3KWV C;  1ROS A;  2AIG P;  4H49 A;  3TVC A;  2OW2 A;  1AST A;  5CZM A;  1S4B P;  2QPJ A;  1K7I A;  4DD8 A;  2ML2 A;  3V96 B;  2FV9 A;  1UTT A;  966C A;  4G0D A;  3LJT A;  2JIH A;  1BKC A;  3USN A;  2L0R A;  1QJI A;  1GKC A;  3WV1 A;  1HV5 A;  3RTS A;  4DPE A;  2OVZ A;  4WK7 A;  2ERP A;  4XM6 A;  2YUF A;  5LAB A;  4ILW D;  1XFX A;  4JIJ A;  2Z2D A;  1XFU A;  3DL1 A;  1MMP A;  2CKI A;  3U1R A;  2MZE A;  1BSW A;  1YOU A;  1HFC A;  3AIG A;  1XUC A;  3LUN A;  2W13 A;  3LK8 A;  2XS3 A;  1XFY A;  1JAQ A;  2W12 A;  4H3X A;  4I35 A;  1EAK A;  3B92 A;  5L7F A;  3EWJ A;  3SHI A;  1GXD A;  5BOY A;  1G4K A;  2O36 A;  1Z3J A;  2OVX A;  2X3B A;  3TT4 A;  4EFS A;  2FV5 A;  1USN A;  2JT5 A;  2W15 A;  3LKA A;  1L6J A;  1P9H A;  2A8H A;  1I1I P;  1MNC A;  3EHX A;  3RTT A;  5JMY A;  4FU4 A;  1HY7 A;  3ULT A;  1MMR A;  3DWB A;  1G49 A;  4A3W A;  3WP8 A;  1CXV A;  3AYU A;  2MZI A;  4XM7 A;  4PKU A;  2MLS A;  4GWN A;  2WO9 A;  4XCT A;  1AKL A;  2WOA A;  1BM6 A;  2SRT A;  3MA2 A;  4H2E A;  1EB6 A;  1JIW P;  4H1Q A;  1HTD A;  1DTH A;  1OM7 A;  1BQO A;  4FXQ A;  5I43 A;  3L0V A;  3DPF A;  2ERO A;  1B8Y A;  3F1A A;  2ZVD A;  3B2Z A;  2XS4 A;  2OZR A;  2DW0 A;  3DSL A;  1G05 A;  3LUM A;  1UTZ A;  3KEK A;  5I4O A;  1SRP A;  3WV3 A;  1QIA A;  3EDI A;  4L6T A;  2E3X A;  1ZS0 A;  3F16 A;  3ZXH A;  3LQ0 A;  4PKS A;  3K7N A;  2X3A A;  4L7A A;  2W14 A;  2Z8Z A;  2QUB A;  1KUI A;  5CVW A;  1Q3A A;  3Q2G A;  3KEC A;  2OW1 A;  2OY4 A;  2X3C A;  4R3V A;  4G9L A;  1OMJ A;  3VI1 A;  1A86 A;  3CKI A;  1AYK A;  1G12 A;  4JPA A;  2JT6 A;  1JAO A;  1XFZ A;  1GE6 A;  1KUG A;  2AGM A;  1R1J A;  3N2U A;  3OHO A;  4HMA A;  5D3C A;  3F17 A;  2J83 A;  1ZP5 A;  2XQH A;  3UVC A;  1I73 A;  3DTI A;  1C8T A;  4A7B A;  2Z8X A;  1YQY A;  1BUD A;  1QUA A;  2W0D A;  1BIW A;  1K7G A;  4GF1 A;  4H84 A;  1UMS A;  1MMQ A;  1BQQ M;  3HDB A;  3KME A;  4Q1L A;  3N2V A;  2MLR A;  4L19 A;  4XBH A;  3HY9 A;  1PWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...