1GO8P

The metzincin's methionine: prtc m226l mutant
Total Genus 162
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
162
sequence length
460
structure length
460
Chain Sequence
TSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSILSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PROTEASE C
publication title Crystal Structure of a Complex between Pseudomonas Aeruginosa Alkaline Protease and its Cognate Inhibitor: Inhibition by a Zinc-NH2 Coordinative Bond
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 162
structure length 460
sequence length 460
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2001-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 1go8P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 1go8P02
4WK7A 3B2ZA 4XCTA 4GR0A 4QKZA 2OW0A 3F15A 1CK7A 1MNCA 1HV5A 2RJPA 3P24A 4AUOA 1BZSA 3O64A 2QPJA 3LKAA 1C8TA 1GXDA 3NTNA 5I12A 4WKEA 1GKCA 2OY2A 3BA0A 2J0TA 1JAPA 1R1JA 3LQ0A 3SHIA 3LK8A 1MMPA 2Z8ZA 5I4OA 1GE7A 3RTSA 1K7QA 1GO7P 1I76A 4XM7A 1EAKA 1GKDA 3EDHA 3B8ZA 3E8RA 2ZVDA 2ML2A 1XFWA 5I3MA 1XUDA 1SRPA 3DWBA 4Q1LA 3L0VA 2CLTA 2WOAA 1CGLA 5B5OA 2K2GA 4ON1A 2JSDA 3G42A 2DW1A 5CXLA 2PJTA 1BKCE 4JIJA 1G12A 2X3AA 3KMEA 2DDYA 3Q2GA 4EFSA 3LJGA 1O0QA 2JT6A 5CUHA 3DPEA 2MLSA 1XFVA 5L7FA 1IACA 3HYGA 1RMZA 3K7NA 4H49A 1HFSA 1BQQM 2JNPA 1SMPA 1AKLA 4GR3A 2OXZA 3TS4A 4H84A 1XFUA 4PKQA 3DSLA 1EB6A 2W14A 1ZP5A 3F1AA 1K7GA 1BSWA 1ZXVA 3EWJA 3KEJA 4GWNA 1O0TA 3F18A 1KUIA 1H71P 4WKIA 2OW2A 1MMBA 1R1IA 2POJA 1B8YA 4H3XA 1C7KA 3EHXA 2ZJ7A 1R1HA 1Q3AA 3HBUP 2AIGP 4WF6A 1Y8JA 4ZR5A 3ZXHA 1JK3A 5I0LA 2W15A 1UTZA 3AYKA 1OS9A 2QUBA 1S4BP 1XFXA 3OHLA 1G4KA 5D7WA 1KBCA 1KUHA 1SLNA 5I2ZA 1USNA 3HDBA 3KRYA 2MZHA 3LJTA 3TVCA 4L63A 4IN9A 2L0RA 3HDAP 3LILA 3EDIA 830CA 1G9KA 4HX3A 3N2UA 1CGEA 1MMRA 4R3VA 1ZXCA 3HY7A 2WO9A 3KMCA 1DMTA 2O3EA 4FU4A 1XFYA 3LIKA 2OZRA 2E3XA 1K7IA 3UVCA 4A3WA 3LUNA 1PWQA 3VI1A 1PWVA 1D8MA 3LUMA 1A86A 1QIBA 1J7NA 4H1QA 1OS2A 1BUVM 2J83A 3LA9A 3LE9A 2AYKA 3OHOA 3DL1A 3KEKA 1GO8P 1Y93A 4HMAA 1IAEA 1ZTQA 1OM8A 4DV8A 3USNA 3WV1A 1B3DA 3HBVP 2MZEA 3KECA 4XBHA 2E2DA 3LMCA 1JIZA 1G05A 1AYKA 5D1UA 1P9HA 2JIHA 3RTTA 4AYKA 1CQRA 3S6LA 2EROA 2O36A 4JP4A 2WO8A 1BKCA 1IAAA 1IADA 1SATA 1GE5A 1HY7A 5CVWA 2TCLA 4PKRA 3ELMA 4G9LA 4PKSA 2OXUA 1SLMA 2X3CA 3V96B 2SRTA 1GE6A 3KHIA 4GQLA 2DDFA 4J4MA 5I43A 1JKYA 1L6JA 3LEAA 1AF0A 3LIRA 5BPAA 2ERQA 2OVXA 5BOTA 3F16A 3U1RA 1Y0VA 2OVZA 1ZVXA 4FXQA 1PWUA 1Z3JA 2Y6CA 1WNIA 5H8XA 2X7MA 4JA1A 1RM8A 2XS4A 4PKVA 4ILWD 2W12A 3O2XA 1KUGA 1UTTA 4WZVA 4L6TA 1BQOA 1FBLA 1QJIA 1HFCA 2OW1A 3LQBA 5B5PA 3ZUKA 3CKIA 3I7GA 3ZVSA 3TT4A 4IUWA 1CGFA 1JIWP 2Z8XA 1R54A 3WV3A 1JANA 1D8FA 2ERPA 5D2BA 4GUYA 1QIAA 1ROSA 1FLSA 2JT5A 3LGPA 2USNA 2YO0A 3AYUA 2N8RA 4H30A 1C3IA 3N2VA 1KAPP 1D5JA 2DW2A 5D1TA 3AIGA 2V4BA 2I47A 4I35A 1PWPA 2OW9A 1XFZA 2DW0A 4DPEA 3G5CA 4AIGA 3HY9A 1XURA 4IJOA 1CXVA 3EDZA 1JJ9A 5CXAA 4H2EA 3EDGA 3I7IA 3A70A 1YQYA 1IAGA 5CZMA 4FVLA 1QJJA 4XM8A 2QUAA 1CIZA 5BOYA 4L19A 3HB2P 3K7LA 1OO9A 3B92A 2OI0A 1JAQA 3KWVC 3F17A 1KUFA 1ASTA 3DNGA 2CKIA 4I03A 2FV9A 2MLRA 2AGMA 4JQGA 3LJZA 1ATLA 3GBOA 1QICA 1EUBA 2YIGA 2HU6A 4PKWA 3DPFA 4GR8A 1SU3A 2D1NA 4GF1A 1YCMA 2OY4A 3WV2A 3L0TA 4CTHA 4G0DA 1UEAA 1JAOA 1HOVA 2RJQA 1XUCA 1CAQA 3WP8A 2YB9A 3A6ZA 1UMTA 2D1OA 2X3BA 3NX7A 1DTHA 3P1VA 1BM6A 4DF9A 2XQHA 1ND1A 1A85A 4GWMA 2OXWA 1ZS0A 3ULTA 1D7XA 2W13A 1FM1A 1BIWA 4FXYP 3Q2HA 2Z2DA 1BUDA 2Y6DA 2A8HA 1UMSA 1R55A 3F19A 2MZIA 2ZJ6A 4JPAA 3VTGA 1QUAA 4H76A 456CA 5L79A 1HTDA 3MA2A 4H82A 3EHYA 1YP1A 966CA 4AXQA 1YOUA 1I73A 1IABA 2YO1A 5JMYA 1JH1A 4DD8A 1MMQA 2K9CA 3LAAA 4A7BA 1OMJA 5D1SA 1PWWA 1OM6A 1G49A 2XS3A 3TSKA 2FV5A 2W0DA 4PKUA 4PKTA 1I1IP 1BKCI 5D3CA 1KUKA 5LABA 2KRJA 4XM6A 1OM7A
chains in the Genus database with same CATH superfamily
4WK7A 3B2ZA 4XCTA 4GR0A 4QKZA 2OW0A 3F15A 1CK7A 1MNCA 1HV5A 2RJPA 3P24A 4AUOA 1BZSA 3O64A 2QPJA 3LKAA 1C8TA 1GXDA 3NTNA 5I12A 4WKEA 1GKCA 2OY2A 3BA0A 2J0TA 1JAPA 1R1JA 3LQ0A 3SHIA 3LK8A 1MMPA 2Z8ZA 5I4OA 1GE7A 3RTSA 1K7QA 2YUFA 1GO7P 1I76A 4XM7A 1EAKA 1GKDA 3EDHA 3B8ZA 3E8RA 2ZVDA 2ML2A 1XFWA 5I3MA 1XUDA 1SRPA 3DWBA 4Q1LA 3L0VA 2CLTA 2WOAA 1CGLA 5B5OA 2K2GA 4ON1A 2JSDA 3G42A 2DW1A 5CXLA 2PJTA 1BKCE 4JIJA 1G12A 2X3AA 3KMEA 2DDYA 3Q2GA 4EFSA 3LJGA 1O0QA 2JT6A 5CUHA 3DPEA 2MLSA 1XFVA 5L7FA 1IACA 3HYGA 1RMZA 3K7NA 4H49A 1HFSA 1BQQM 2JNPA 1SMPA 1AKLA 4GR3A 2OXZA 3TS4A 1TVIA 4H84A 1XFUA 4PKQA 3DSLA 1EB6A 2W14A 1ZP5A 3F1AA 1K7GA 1BSWA 1ZXVA 3EWJA 3KEJA 4GWNA 1O0TA 3F18A 1KUIA 1H71P 4WKIA 2OW2A 1MMBA 1R1IA 2POJA 1B8YA 4H3XA 1C7KA 3EHXA 2ZJ7A 1R1HA 1Q3AA 3HBUP 2AIGP 4WF6A 1OZ9A 1Y8JA 4ZR5A 3ZXHA 1JK3A 5I0LA 2W15A 1UTZA 3AYKA 1OS9A 2QUBA 1S4BP 1XM5A 1XFXA 3OHLA 1G4KA 5D7WA 1KBCA 1KUHA 1SLNA 5I2ZA 1USNA 3HDBA 3KRYA 2MZHA 3LJTA 3TVCA 4L63A 4IN9A 2L0RA 3HDAP 3LILA 3EDIA 830CA 1G9KA 4HX3A 3N2UA 1CGEA 1MMRA 4R3VA 1ZXCA 3HY7A 2WO9A 3KMCA 1DMTA 2O3EA 4FU4A 1XFYA 3LIKA 2OZRA 2E3XA 1K7IA 3UVCA 4A3WA 3LUNA 1PWQA 3VI1A 1PWVA 1D8MA 3LUMA 1A86A 1QIBA 1J7NA 4H1QA 1OS2A 1BUVM 2J83A 3LA9A 3LE9A 2AYKA 3OHOA 3DL1A 3KEKA 1GO8P 1Y93A 4HMAA 1IAEA 1ZTQA 1OM8A 4DV8A 3USNA 3WV1A 1B3DA 3HBVP 2MZEA 3KECA 4XBHA 2E2DA 3LMCA 1JIZA 1G05A 1AYKA 5D1UA 1P9HA 2JIHA 3RTTA 4AYKA 1CQRA 3S6LA 2EROA 2O36A 4JP4A 2WO8A 1BKCA 1IAAA 1IADA 1SATA 1GE5A 1HY7A 5CVWA 2TCLA 4PKRA 3ELMA 4G9LA 4PKSA 2OXUA 1SLMA 2X3CA 3V96B 2SRTA 1GE6A 3KHIA 4GQLA 2DDFA 4J4MA 5I43A 1JKYA 1L6JA 3LEAA 1AF0A 3LIRA 5BPAA 2ERQA 2OVXA 5BOTA 3F16A 3U1RA 1Y0VA 2OVZA 1ZVXA 4FXQA 1PWUA 1Z3JA 2Y6CA 1WNIA 5H8XA 2X7MA 4JA1A 1RM8A 2XS4A 4PKVA 4ILWD 2W12A 3O2XA 1KUGA 1UTTA 4WZVA 4L6TA 1BQOA 1FBLA 1QJIA 1HFCA 2OW1A 3LQBA 5B5PA 3DTKA 3ZUKA 3CKIA 1XAXA 3I7GA 3TT4A 3ZVSA 4IUWA 1CGFA 1JIWP 2Z8XA 1R54A 3DTEA 3WV3A 1JANA 1D8FA 2ERPA 5D2BA 4GUYA 1QIAA 1ROSA 1FLSA 2JT5A 3LGPA 2USNA 2YO0A 3AYUA 2N8RA 4H30A 1C3IA 3N2VA 1KAPP 1D5JA 2DW2A 5D1TA 3AIGA 2V4BA 2I47A 4I35A 1PWPA 2OW9A 1XFZA 2DW0A 4DPEA 3G5CA 4AIGA 3HY9A 1XURA 4IJOA 1CXVA 3EDZA 1JJ9A 5CXAA 4L7AA 4H2EA 3EDGA 3I7IA 3A70A 1YQYA 1IAGA 5CZMA 4FVLA 1QJJA 4XM8A 2QUAA 1CIZA 5BOYA 4L19A 3HB2P 3K7LA 1OO9A 3B92A 2OI0A 1JAQA 3KWVC 3F17A 1KUFA 1ASTA 3DNGA 2CKIA 4I03A 2FV9A 2MLRA 2AGMA 4JQGA 3LJZA 1ATLA 3GBOA 1QICA 1EUBA 2YIGA 2HU6A 4PKWA 3DPFA 4GR8A 1SU3A 2D1NA 4GF1A 1YCMA 2OY4A 3WV2A 3L0TA 4CTHA 4G0DA 1UEAA 1JAOA 1HOVA 2RJQA 1XUCA 1CAQA 3WP8A 2YB9A 3A6ZA 1UMTA 2D1OA 2X3BA 3NX7A 1DTHA 3P1VA 1BM6A 4DF9A 2XQHA 1ND1A 1A85A 4GWMA 2OXWA 1ZS0A 3ULTA 1D7XA 2W13A 1FM1A 1BIWA 4FXYP 3Q2HA 2Z2DA 1BUDA 2Y6DA 2A8HA 1UMSA 1R55A 3F19A 2MZIA 2ZJ6A 4JPAA 3VTGA 1QUAA 4H76A 456CA 5L79A 3DTIA 1HTDA 3MA2A 4H82A 3EHYA 1YP1A 966CA 4AXQA 1YOUA 1I73A 1IABA 2YO1A 5JMYA 1JH1A 4DD8A 1MMQA 2K9CA 3LAAA 4A7BA 1OMJA 5D1SA 1PWWA 1OM6A 1G49A 2XS3A 3TSKA 2FV5A 2W0DA 4PKUA 4PKTA 1I1IP 4DT5A 1BKCI 5D3CA 1KUKA 5LABA 2KRJA 4XM6A 1OM7A
chains in the Genus database with same CATH topology
4WK7A 3B2ZA 4XCTA 4GR0A 4QKZA 2OW0A 3F15A 1CK7A 1MNCA 1HV5A 2RJPA 3P24A 4AUOA 1BZSA 3O64A 2QPJA 3LKAA 1C8TA 1GXDA 3NTNA 5I12A 4WKEA 1GKCA 2OY2A 3BA0A 2J0TA 1JAPA 1R1JA 3LQ0A 3SHIA 3LK8A 1MMPA 2Z8ZA 5I4OA 1GE7A 3RTSA 1K7QA 2YUFA 1GO7P 1I76A 4XM7A 1EAKA 1GKDA 3EDHA 3B8ZA 3E8RA 2ZVDA 2ML2A 1XFWA 5I3MA 1XUDA 1SRPA 3DWBA 4Q1LA 3L0VA 2CLTA 2WOAA 1CGLA 5B5OA 2K2GA 4ON1A 2JSDA 3G42A 2DW1A 5CXLA 2PJTA 1BKCE 4JIJA 1G12A 2X3AA 3KMEA 2DDYA 3Q2GA 4EFSA 3LJGA 1O0QA 2JT6A 5CUHA 3DPEA 2MLSA 1XFVA 5L7FA 1IACA 3HYGA 1RMZA 3K7NA 4H49A 1HFSA 1BQQM 2JNPA 1SMPA 1AKLA 4GR3A 2OXZA 3TS4A 4H84A 1XFUA 4PKQA 3DSLA 1EB6A 2W14A 1ZP5A 3F1AA 1K7GA 1BSWA 1ZXVA 3EWJA 3KEJA 4GWNA 1O0TA 3F18A 1KUIA 1H71P 4WKIA 2OW2A 1MMBA 1R1IA 2POJA 1B8YA 4H3XA 1C7KA 3EHXA 2ZJ7A 1R1HA 1Q3AA 3HBUP 2AIGP 4WF6A 1Y8JA 4ZR5A 3ZXHA 1JK3A 5I0LA 2W15A 1UTZA 3AYKA 1OS9A 2QUBA 1S4BP 1XFXA 3OHLA 1G4KA 5D7WA 1KBCA 1KUHA 1SLNA 5I2ZA 1USNA 3HDBA 3KRYA 2MZHA 3LJTA 3TVCA 4L63A 4IN9A 2L0RA 3HDAP 3LILA 3EDIA 830CA 1G9KA 4HX3A 3N2UA 1CGEA 1MMRA 4R3VA 1ZXCA 3HY7A 2WO9A 3KMCA 1DMTA 2O3EA 4FU4A 1XFYA 3LIKA 2OZRA 2E3XA 1K7IA 3UVCA 4A3WA 3LUNA 1PWQA 3VI1A 1PWVA 1D8MA 3LUMA 1A86A 1QIBA 1J7NA 4H1QA 1OS2A 1BUVM 2J83A 3LA9A 3LE9A 2AYKA 3OHOA 3DL1A 3KEKA 1GO8P 1Y93A 4HMAA 1IAEA 1ZTQA 1OM8A 4DV8A 3USNA 3WV1A 1B3DA 3HBVP 2MZEA 3KECA 4XBHA 2E2DA 3LMCA 1JIZA 1G05A 1AYKA 5D1UA 1P9HA 2JIHA 3RTTA 4AYKA 1CQRA 3S6LA 2EROA 2O36A 4JP4A 2WO8A 1BKCA 1IAAA 1IADA 1SATA 1GE5A 1HY7A 5CVWA 2TCLA 4PKRA 3ELMA 4G9LA 4PKSA 2OXUA 1SLMA 2X3CA 3V96B 2SRTA 1GE6A 3KHIA 4GQLA 2DDFA 4J4MA 5I43A 1JKYA 1L6JA 3LEAA 1AF0A 3LIRA 5BPAA 2ERQA 2OVXA 5BOTA 3F16A 3U1RA 1Y0VA 2OVZA 1ZVXA 4FXQA 1PWUA 1Z3JA 2Y6CA 1WNIA 5H8XA 2X7MA 4JA1A 1RM8A 2XS4A 4PKVA 4ILWD 2W12A 3O2XA 1KUGA 1UTTA 4WZVA 4L6TA 1BQOA 1FBLA 1QJIA 1HFCA 2OW1A 3LQBA 5B5PA 3DTKA 3ZUKA 3CKIA 3I7GA 3ZVSA 3TT4A 4IUWA 1CGFA 1JIWP 2Z8XA 1R54A 3DTEA 3WV3A 1JANA 1D8FA 2ERPA 5D2BA 4GUYA 1QIAA 1ROSA 1FLSA 2JT5A 3LGPA 2USNA 2YO0A 3AYUA 2N8RA 4H30A 1C3IA 3N2VA 1KAPP 1D5JA 2DW2A 5D1TA 3AIGA 2V4BA 2I47A 4I35A 1PWPA 2OW9A 1XFZA 2DW0A 4DPEA 3G5CA 4AIGA 3HY9A 1XURA 4IJOA 1CXVA 3EDZA 1JJ9A 5CXAA 4L7AA 4H2EA 3EDGA 3I7IA 3A70A 1YQYA 1IAGA 5CZMA 4FVLA 1QJJA 4XM8A 2QUAA 1CIZA 5BOYA 4L19A 3HB2P 3K7LA 1OO9A 3B92A 2OI0A 1JAQA 3KWVC 3F17A 1KUFA 1ASTA 3DNGA 2CKIA 4I03A 2FV9A 2MLRA 2AGMA 4JQGA 3LJZA 1ATLA 3GBOA 1QICA 1EUBA 2YIGA 2HU6A 4PKWA 3DPFA 4GR8A 1SU3A 2D1NA 4GF1A 1YCMA 2OY4A 3WV2A 3L0TA 4CTHA 4G0DA 1UEAA 1JAOA 1HOVA 2RJQA 1XUCA 1CAQA 3WP8A 2YB9A 3A6ZA 1UMTA 2D1OA 2X3BA 3NX7A 1DTHA 3P1VA 1BM6A 4DF9A 2XQHA 1ND1A 1A85A 4GWMA 2OXWA 1ZS0A 3ULTA 1D7XA 2W13A 1FM1A 1BIWA 4FXYP 3Q2HA 2Z2DA 1BUDA 2Y6DA 2A8HA 1UMSA 1R55A 3F19A 2MZIA 2ZJ6A 4JPAA 3VTGA 1QUAA 4H76A 456CA 5L79A 3DTIA 1HTDA 3MA2A 4H82A 3EHYA 1YP1A 966CA 4AXQA 1YOUA 1I73A 1IABA 2YO1A 5JMYA 1JH1A 4DD8A 1MMQA 2K9CA 3LAAA 4A7BA 1OMJA 5D1SA 1PWWA 1OM6A 1G49A 2XS3A 3TSKA 2FV5A 2W0DA 4PKUA 4PKTA 1I1IP 1BKCI 5D3CA 1KUKA 5LABA 2KRJA 4XM6A 1OM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WK7 A;  3B2Z A;  4XCT A;  4GR0 A;  4QKZ A;  2OW0 A;  3F15 A;  1CK7 A;  1MNC A;  1HV5 A;  2RJP A;  3P24 A;  4AUO A;  1BZS A;  3O64 A;  2QPJ A;  3LKA A;  1C8T A;  1GXD A;  3NTN A;  5I12 A;  4WKE A;  1GKC A;  2OY2 A;  3BA0 A;  2J0T A;  1JAP A;  1R1J A;  3LQ0 A;  3SHI A;  3LK8 A;  1MMP A;  2Z8Z A;  5I4O A;  1GE7 A;  3RTS A;  1K7Q A;  1GO7 P;  1I76 A;  4XM7 A;  1EAK A;  1GKD A;  3EDH A;  3B8Z A;  3E8R A;  2ZVD A;  2ML2 A;  1XFW A;  5I3M A;  1XUD A;  1SRP A;  3DWB A;  4Q1L A;  3L0V A;  2CLT A;  2WOA A;  1CGL A;  5B5O A;  2K2G A;  4ON1 A;  2JSD A;  3G42 A;  2DW1 A;  5CXL A;  2PJT A;  1BKC E;  4JIJ A;  1G12 A;  2X3A A;  3KME A;  2DDY A;  3Q2G A;  4EFS A;  3LJG A;  1O0Q A;  2JT6 A;  5CUH A;  3DPE A;  2MLS A;  1XFV A;  5L7F A;  1IAC A;  3HYG A;  1RMZ A;  3K7N A;  4H49 A;  1HFS A;  1BQQ M;  2JNP A;  1SMP A;  1AKL A;  4GR3 A;  2OXZ A;  3TS4 A;  4H84 A;  1XFU A;  4PKQ A;  3DSL A;  1EB6 A;  2W14 A;  1ZP5 A;  3F1A A;  1K7G A;  1BSW A;  1ZXV A;  3EWJ A;  3KEJ A;  4GWN A;  1O0T A;  3F18 A;  1KUI A;  1H71 P;  4WKI A;  2OW2 A;  1MMB A;  1R1I A;  2POJ A;  1B8Y A;  4H3X A;  1C7K A;  3EHX A;  2ZJ7 A;  1R1H A;  1Q3A A;  3HBU P;  2AIG P;  4WF6 A;  1Y8J A;  4ZR5 A;  3ZXH A;  1JK3 A;  5I0L A;  2W15 A;  1UTZ A;  3AYK A;  1OS9 A;  2QUB A;  1S4B P;  1XFX A;  3OHL A;  1G4K A;  5D7W A;  1KBC A;  1KUH A;  1SLN A;  5I2Z A;  1USN A;  3HDB A;  3KRY A;  2MZH A;  3LJT A;  3TVC A;  4L63 A;  4IN9 A;  2L0R A;  3HDA P;  3LIL A;  3EDI A;  830C A;  1G9K A;  4HX3 A;  3N2U A;  1CGE A;  1MMR A;  4R3V A;  1ZXC A;  3HY7 A;  2WO9 A;  3KMC A;  1DMT A;  2O3E A;  4FU4 A;  1XFY A;  3LIK A;  2OZR A;  2E3X A;  1K7I A;  3UVC A;  4A3W A;  3LUN A;  1PWQ A;  3VI1 A;  1PWV A;  1D8M A;  3LUM A;  1A86 A;  1QIB A;  1J7N A;  4H1Q A;  1OS2 A;  1BUV M;  2J83 A;  3LA9 A;  3LE9 A;  2AYK A;  3OHO A;  3DL1 A;  3KEK A;  1GO8 P;  1Y93 A;  4HMA A;  1IAE A;  1ZTQ A;  1OM8 A;  4DV8 A;  3USN A;  3WV1 A;  1B3D A;  3HBV P;  2MZE A;  3KEC A;  4XBH A;  2E2D A;  3LMC A;  1JIZ A;  1G05 A;  1AYK A;  5D1U A;  1P9H A;  2JIH A;  3RTT A;  4AYK A;  1CQR A;  3S6L A;  2ERO A;  2O36 A;  4JP4 A;  2WO8 A;  1BKC A;  1IAA A;  1IAD A;  1SAT A;  1GE5 A;  1HY7 A;  5CVW A;  2TCL A;  4PKR A;  3ELM A;  4G9L A;  4PKS A;  2OXU A;  1SLM A;  2X3C A;  3V96 B;  2SRT A;  1GE6 A;  3KHI A;  4GQL A;  2DDF A;  4J4M A;  5I43 A;  1JKY A;  1L6J A;  3LEA A;  1AF0 A;  3LIR A;  5BPA A;  2ERQ A;  2OVX A;  5BOT A;  3F16 A;  3U1R A;  1Y0V A;  2OVZ A;  1ZVX A;  4FXQ A;  1PWU A;  1Z3J A;  2Y6C A;  1WNI A;  5H8X A;  2X7M A;  4JA1 A;  1RM8 A;  2XS4 A;  4PKV A;  4ILW D;  2W12 A;  3O2X A;  1KUG A;  1UTT A;  4WZV A;  4L6T A;  1BQO A;  1FBL A;  1QJI A;  1HFC A;  2OW1 A;  3LQB A;  5B5P A;  3ZUK A;  3CKI A;  3I7G A;  3ZVS A;  3TT4 A;  4IUW A;  1CGF A;  1JIW P;  2Z8X A;  1R54 A;  3WV3 A;  1JAN A;  1D8F A;  2ERP A;  5D2B A;  4GUY A;  1QIA A;  1ROS A;  1FLS A;  2JT5 A;  3LGP A;  2USN A;  2YO0 A;  3AYU A;  2N8R A;  4H30 A;  1C3I A;  3N2V A;  1KAP P;  1D5J A;  2DW2 A;  5D1T A;  3AIG A;  2V4B A;  2I47 A;  4I35 A;  1PWP A;  2OW9 A;  1XFZ A;  2DW0 A;  4DPE A;  3G5C A;  4AIG A;  3HY9 A;  1XUR A;  4IJO A;  1CXV A;  3EDZ A;  1JJ9 A;  5CXA A;  4H2E A;  3EDG A;  3I7I A;  3A70 A;  1YQY A;  1IAG A;  5CZM A;  4FVL A;  1QJJ A;  4XM8 A;  2QUA A;  1CIZ A;  5BOY A;  4L19 A;  3HB2 P;  3K7L A;  1OO9 A;  3B92 A;  2OI0 A;  1JAQ A;  3KWV C;  3F17 A;  1KUF A;  1AST A;  3DNG A;  2CKI A;  4I03 A;  2FV9 A;  2MLR A;  2AGM A;  4JQG A;  3LJZ A;  1ATL A;  3GBO A;  1QIC A;  1EUB A;  2YIG A;  2HU6 A;  4PKW A;  3DPF A;  4GR8 A;  1SU3 A;  2D1N A;  4GF1 A;  1YCM A;  2OY4 A;  3WV2 A;  3L0T A;  4CTH A;  4G0D A;  1UEA A;  1JAO A;  1HOV A;  2RJQ A;  1XUC A;  1CAQ A;  3WP8 A;  2YB9 A;  3A6Z A;  1UMT A;  2D1O A;  2X3B A;  3NX7 A;  1DTH A;  3P1V A;  1BM6 A;  4DF9 A;  2XQH A;  1ND1 A;  1A85 A;  4GWM A;  2OXW A;  1ZS0 A;  3ULT A;  1D7X A;  2W13 A;  1FM1 A;  1BIW A;  4FXY P;  3Q2H A;  2Z2D A;  1BUD A;  2Y6D A;  2A8H A;  1UMS A;  1R55 A;  3F19 A;  2MZI A;  2ZJ6 A;  4JPA A;  3VTG A;  1QUA A;  4H76 A;  456C A;  5L79 A;  1HTD A;  3MA2 A;  4H82 A;  3EHY A;  1YP1 A;  966C A;  4AXQ A;  1YOU A;  1I73 A;  1IAB A;  2YO1 A;  5JMY A;  1JH1 A;  4DD8 A;  1MMQ A;  2K9C A;  3LAA A;  4A7B A;  1OMJ A;  5D1S A;  1PWW A;  1OM6 A;  1G49 A;  2XS3 A;  3TSK A;  2FV5 A;  2W0D A;  4PKU A;  4PKT A;  1I1I P;  1BKC I;  5D3C A;  1KUK A;  5LAB A;  2KRJ A;  4XM6 A;  1OM7 A; 
#chains in the Genus database with same CATH topology
 4WK7 A;  3B2Z A;  4XCT A;  4GR0 A;  4QKZ A;  2OW0 A;  3F15 A;  1CK7 A;  1MNC A;  1HV5 A;  2RJP A;  3P24 A;  4AUO A;  1BZS A;  3O64 A;  2QPJ A;  3LKA A;  1C8T A;  1GXD A;  3NTN A;  5I12 A;  4WKE A;  1GKC A;  2OY2 A;  3BA0 A;  2J0T A;  1JAP A;  1R1J A;  3LQ0 A;  3SHI A;  3LK8 A;  1MMP A;  2Z8Z A;  5I4O A;  1GE7 A;  3RTS A;  1K7Q A;  2YUF A;  1GO7 P;  1I76 A;  4XM7 A;  1EAK A;  1GKD A;  3EDH A;  3B8Z A;  3E8R A;  2ZVD A;  2ML2 A;  1XFW A;  5I3M A;  1XUD A;  1SRP A;  3DWB A;  4Q1L A;  3L0V A;  2CLT A;  2WOA A;  1CGL A;  5B5O A;  2K2G A;  4ON1 A;  2JSD A;  3G42 A;  2DW1 A;  5CXL A;  2PJT A;  1BKC E;  4JIJ A;  1G12 A;  2X3A A;  3KME A;  2DDY A;  3Q2G A;  4EFS A;  3LJG A;  1O0Q A;  2JT6 A;  5CUH A;  3DPE A;  2MLS A;  1XFV A;  5L7F A;  1IAC A;  3HYG A;  1RMZ A;  3K7N A;  4H49 A;  1HFS A;  1BQQ M;  2JNP A;  1SMP A;  1AKL A;  4GR3 A;  2OXZ A;  3TS4 A;  1TVI A;  4H84 A;  1XFU A;  4PKQ A;  3DSL A;  1EB6 A;  2W14 A;  1ZP5 A;  3F1A A;  1K7G A;  1BSW A;  1ZXV A;  3EWJ A;  3KEJ A;  4GWN A;  1O0T A;  3F18 A;  1KUI A;  1H71 P;  4WKI A;  2OW2 A;  1MMB A;  1R1I A;  2POJ A;  1B8Y A;  4H3X A;  1C7K A;  3EHX A;  2ZJ7 A;  1R1H A;  1Q3A A;  3HBU P;  2AIG P;  4WF6 A;  1OZ9 A;  1Y8J A;  4ZR5 A;  3ZXH A;  1JK3 A;  5I0L A;  2W15 A;  1UTZ A;  3AYK A;  1OS9 A;  2QUB A;  1S4B P;  1XM5 A;  1XFX A;  3OHL A;  1G4K A;  5D7W A;  1KBC A;  1KUH A;  1SLN A;  5I2Z A;  1USN A;  3HDB A;  3KRY A;  2MZH A;  3LJT A;  3TVC A;  4L63 A;  4IN9 A;  2L0R A;  3HDA P;  3LIL A;  3EDI A;  830C A;  1G9K A;  4HX3 A;  3N2U A;  1CGE A;  1MMR A;  4R3V A;  1ZXC A;  3HY7 A;  2WO9 A;  3KMC A;  1DMT A;  2O3E A;  4FU4 A;  1XFY A;  3LIK A;  2OZR A;  2E3X A;  1K7I A;  3UVC A;  4A3W A;  3LUN A;  1PWQ A;  3VI1 A;  1PWV A;  1D8M A;  3LUM A;  1A86 A;  1QIB A;  1J7N A;  4H1Q A;  1OS2 A;  1BUV M;  2J83 A;  3LA9 A;  3LE9 A;  2AYK A;  3OHO A;  3DL1 A;  3KEK A;  1GO8 P;  1Y93 A;  4HMA A;  1IAE A;  1ZTQ A;  1OM8 A;  4DV8 A;  3USN A;  3WV1 A;  1B3D A;  3HBV P;  2MZE A;  3KEC A;  4XBH A;  2E2D A;  3LMC A;  1JIZ A;  1G05 A;  1AYK A;  5D1U A;  1P9H A;  2JIH A;  3RTT A;  4AYK A;  1CQR A;  3S6L A;  2ERO A;  2O36 A;  4JP4 A;  2WO8 A;  1BKC A;  1IAA A;  1IAD A;  1SAT A;  1GE5 A;  1HY7 A;  5CVW A;  2TCL A;  4PKR A;  3ELM A;  4G9L A;  4PKS A;  2OXU A;  1SLM A;  2X3C A;  3V96 B;  2SRT A;  1GE6 A;  3KHI A;  4GQL A;  2DDF A;  4J4M A;  5I43 A;  1JKY A;  1L6J A;  3LEA A;  1AF0 A;  3LIR A;  5BPA A;  2ERQ A;  2OVX A;  5BOT A;  3F16 A;  3U1R A;  1Y0V A;  2OVZ A;  1ZVX A;  4FXQ A;  1PWU A;  1Z3J A;  2Y6C A;  1WNI A;  5H8X A;  2X7M A;  4JA1 A;  1RM8 A;  2XS4 A;  4PKV A;  4ILW D;  2W12 A;  3O2X A;  1KUG A;  1UTT A;  4WZV A;  4L6T A;  1BQO A;  1FBL A;  1QJI A;  1HFC A;  2OW1 A;  3LQB A;  5B5P A;  3DTK A;  3ZUK A;  3CKI A;  1XAX A;  3I7G A;  3TT4 A;  3ZVS A;  4IUW A;  1CGF A;  1JIW P;  2Z8X A;  1R54 A;  3DTE A;  3WV3 A;  1JAN A;  1D8F A;  2ERP A;  5D2B A;  4GUY A;  1QIA A;  1ROS A;  1FLS A;  2JT5 A;  3LGP A;  2USN A;  2YO0 A;  3AYU A;  2N8R A;  4H30 A;  1C3I A;  3N2V A;  1KAP P;  1D5J A;  2DW2 A;  5D1T A;  3AIG A;  2V4B A;  2I47 A;  4I35 A;  1PWP A;  2OW9 A;  1XFZ A;  2DW0 A;  4DPE A;  3G5C A;  4AIG A;  3HY9 A;  1XUR A;  4IJO A;  1CXV A;  3EDZ A;  1JJ9 A;  5CXA A;  4L7A A;  4H2E A;  3EDG A;  3I7I A;  3A70 A;  1YQY A;  1IAG A;  5CZM A;  4FVL A;  1QJJ A;  4XM8 A;  2QUA A;  1CIZ A;  5BOY A;  4L19 A;  3HB2 P;  3K7L A;  1OO9 A;  3B92 A;  2OI0 A;  1JAQ A;  3KWV C;  3F17 A;  1KUF A;  1AST A;  3DNG A;  2CKI A;  4I03 A;  2FV9 A;  2MLR A;  2AGM A;  4JQG A;  3LJZ A;  1ATL A;  3GBO A;  1QIC A;  1EUB A;  2YIG A;  2HU6 A;  4PKW A;  3DPF A;  4GR8 A;  1SU3 A;  2D1N A;  4GF1 A;  1YCM A;  2OY4 A;  3WV2 A;  3L0T A;  4CTH A;  4G0D A;  1UEA A;  1JAO A;  1HOV A;  2RJQ A;  1XUC A;  1CAQ A;  3WP8 A;  2YB9 A;  3A6Z A;  1UMT A;  2D1O A;  2X3B A;  3NX7 A;  1DTH A;  3P1V A;  1BM6 A;  4DF9 A;  2XQH A;  1ND1 A;  1A85 A;  4GWM A;  2OXW A;  1ZS0 A;  3ULT A;  1D7X A;  2W13 A;  1FM1 A;  1BIW A;  4FXY P;  3Q2H A;  2Z2D A;  1BUD A;  2Y6D A;  2A8H A;  1UMS A;  1R55 A;  3F19 A;  2MZI A;  2ZJ6 A;  4JPA A;  3VTG A;  1QUA A;  4H76 A;  456C A;  5L79 A;  3DTI A;  1HTD A;  3MA2 A;  4H82 A;  3EHY A;  1YP1 A;  966C A;  4AXQ A;  1YOU A;  1I73 A;  1IAB A;  2YO1 A;  5JMY A;  1JH1 A;  4DD8 A;  1MMQ A;  2K9C A;  3LAA A;  4A7B A;  1OMJ A;  5D1S A;  1PWW A;  1OM6 A;  1G49 A;  2XS3 A;  3TSK A;  2FV5 A;  2W0D A;  4PKU A;  4PKT A;  1I1I P;  4DT5 A;  1BKC I;  5D3C A;  1KUK A;  5LAB A;  2KRJ A;  4XM6 A;  1OM7 A; 
#chains in the Genus database with same CATH homology
 4WK7 A;  3B2Z A;  4XCT A;  4GR0 A;  4QKZ A;  2OW0 A;  3F15 A;  1CK7 A;  1MNC A;  1HV5 A;  2RJP A;  3P24 A;  4AUO A;  1BZS A;  3O64 A;  2QPJ A;  3LKA A;  1C8T A;  1GXD A;  3NTN A;  5I12 A;  4WKE A;  1GKC A;  2OY2 A;  3BA0 A;  2J0T A;  1JAP A;  1R1J A;  3LQ0 A;  3SHI A;  3LK8 A;  1MMP A;  2Z8Z A;  5I4O A;  1GE7 A;  3RTS A;  1K7Q A;  2YUF A;  1GO7 P;  1I76 A;  4XM7 A;  1EAK A;  1GKD A;  3EDH A;  3B8Z A;  3E8R A;  2ZVD A;  2ML2 A;  1XFW A;  5I3M A;  1XUD A;  1SRP A;  3DWB A;  4Q1L A;  3L0V A;  2CLT A;  2WOA A;  1CGL A;  5B5O A;  2K2G A;  4ON1 A;  2JSD A;  3G42 A;  2DW1 A;  5CXL A;  2PJT A;  1BKC E;  4JIJ A;  1G12 A;  2X3A A;  3KME A;  2DDY A;  3Q2G A;  4EFS A;  3LJG A;  1O0Q A;  2JT6 A;  5CUH A;  3DPE A;  2MLS A;  1XFV A;  5L7F A;  1IAC A;  3HYG A;  1RMZ A;  3K7N A;  4H49 A;  1HFS A;  1BQQ M;  2JNP A;  1SMP A;  1AKL A;  4GR3 A;  2OXZ A;  3TS4 A;  4H84 A;  1XFU A;  4PKQ A;  3DSL A;  1EB6 A;  2W14 A;  1ZP5 A;  3F1A A;  1K7G A;  1BSW A;  1ZXV A;  3EWJ A;  3KEJ A;  4GWN A;  1O0T A;  3F18 A;  1KUI A;  1H71 P;  4WKI A;  2OW2 A;  1MMB A;  1R1I A;  2POJ A;  1B8Y A;  4H3X A;  1C7K A;  3EHX A;  2ZJ7 A;  1R1H A;  1Q3A A;  3HBU P;  2AIG P;  4WF6 A;  1Y8J A;  4ZR5 A;  3ZXH A;  1JK3 A;  5I0L A;  2W15 A;  1UTZ A;  3AYK A;  1OS9 A;  2QUB A;  1S4B P;  1XFX A;  3OHL A;  1G4K A;  5D7W A;  1KBC A;  1KUH A;  1SLN A;  5I2Z A;  1USN A;  3HDB A;  3KRY A;  2MZH A;  3LJT A;  3TVC A;  4L63 A;  4IN9 A;  2L0R A;  3HDA P;  3LIL A;  3EDI A;  830C A;  1G9K A;  4HX3 A;  3N2U A;  1CGE A;  1MMR A;  4R3V A;  1ZXC A;  3HY7 A;  2WO9 A;  3KMC A;  1DMT A;  2O3E A;  4FU4 A;  1XFY A;  3LIK A;  2OZR A;  2E3X A;  1K7I A;  3UVC A;  4A3W A;  3LUN A;  1PWQ A;  3VI1 A;  1PWV A;  1D8M A;  3LUM A;  1A86 A;  1QIB A;  1J7N A;  4H1Q A;  1OS2 A;  1BUV M;  2J83 A;  3LA9 A;  3LE9 A;  2AYK A;  3OHO A;  3DL1 A;  3KEK A;  1GO8 P;  1Y93 A;  4HMA A;  1IAE A;  1ZTQ A;  1OM8 A;  4DV8 A;  3USN A;  3WV1 A;  1B3D A;  3HBV P;  2MZE A;  3KEC A;  4XBH A;  2E2D A;  3LMC A;  1JIZ A;  1G05 A;  1AYK A;  5D1U A;  1P9H A;  2JIH A;  3RTT A;  4AYK A;  1CQR A;  3S6L A;  2ERO A;  2O36 A;  4JP4 A;  2WO8 A;  1BKC A;  1IAA A;  1IAD A;  1SAT A;  1GE5 A;  1HY7 A;  5CVW A;  2TCL A;  4PKR A;  3ELM A;  4G9L A;  4PKS A;  2OXU A;  1SLM A;  2X3C A;  3V96 B;  2SRT A;  1GE6 A;  3KHI A;  4GQL A;  2DDF A;  4J4M A;  5I43 A;  1JKY A;  1L6J A;  3LEA A;  1AF0 A;  3LIR A;  5BPA A;  2ERQ A;  2OVX A;  5BOT A;  3F16 A;  3U1R A;  1Y0V A;  2OVZ A;  1ZVX A;  4FXQ A;  1PWU A;  1Z3J A;  2Y6C A;  1WNI A;  5H8X A;  2X7M A;  4JA1 A;  1RM8 A;  2XS4 A;  4PKV A;  4ILW D;  2W12 A;  3O2X A;  1KUG A;  1UTT A;  4WZV A;  4L6T A;  1BQO A;  1FBL A;  1QJI A;  1HFC A;  2OW1 A;  3LQB A;  5B5P A;  3DTK A;  3ZUK A;  3CKI A;  3I7G A;  3ZVS A;  3TT4 A;  4IUW A;  1CGF A;  1JIW P;  2Z8X A;  1R54 A;  3DTE A;  3WV3 A;  1JAN A;  1D8F A;  2ERP A;  5D2B A;  4GUY A;  1QIA A;  1ROS A;  1FLS A;  2JT5 A;  3LGP A;  2USN A;  2YO0 A;  3AYU A;  2N8R A;  4H30 A;  1C3I A;  3N2V A;  1KAP P;  1D5J A;  2DW2 A;  5D1T A;  3AIG A;  2V4B A;  2I47 A;  4I35 A;  1PWP A;  2OW9 A;  1XFZ A;  2DW0 A;  4DPE A;  3G5C A;  4AIG A;  3HY9 A;  1XUR A;  4IJO A;  1CXV A;  3EDZ A;  1JJ9 A;  5CXA A;  4L7A A;  4H2E A;  3EDG A;  3I7I A;  3A70 A;  1YQY A;  1IAG A;  5CZM A;  4FVL A;  1QJJ A;  4XM8 A;  2QUA A;  1CIZ A;  5BOY A;  4L19 A;  3HB2 P;  3K7L A;  1OO9 A;  3B92 A;  2OI0 A;  1JAQ A;  3KWV C;  3F17 A;  1KUF A;  1AST A;  3DNG A;  2CKI A;  4I03 A;  2FV9 A;  2MLR A;  2AGM A;  4JQG A;  3LJZ A;  1ATL A;  3GBO A;  1QIC A;  1EUB A;  2YIG A;  2HU6 A;  4PKW A;  3DPF A;  4GR8 A;  1SU3 A;  2D1N A;  4GF1 A;  1YCM A;  2OY4 A;  3WV2 A;  3L0T A;  4CTH A;  4G0D A;  1UEA A;  1JAO A;  1HOV A;  2RJQ A;  1XUC A;  1CAQ A;  3WP8 A;  2YB9 A;  3A6Z A;  1UMT A;  2D1O A;  2X3B A;  3NX7 A;  1DTH A;  3P1V A;  1BM6 A;  4DF9 A;  2XQH A;  1ND1 A;  1A85 A;  4GWM A;  2OXW A;  1ZS0 A;  3ULT A;  1D7X A;  2W13 A;  1FM1 A;  1BIW A;  4FXY P;  3Q2H A;  2Z2D A;  1BUD A;  2Y6D A;  2A8H A;  1UMS A;  1R55 A;  3F19 A;  2MZI A;  2ZJ6 A;  4JPA A;  3VTG A;  1QUA A;  4H76 A;  456C A;  5L79 A;  3DTI A;  1HTD A;  3MA2 A;  4H82 A;  3EHY A;  1YP1 A;  966C A;  4AXQ A;  1YOU A;  1I73 A;  1IAB A;  2YO1 A;  5JMY A;  1JH1 A;  4DD8 A;  1MMQ A;  2K9C A;  3LAA A;  4A7B A;  1OMJ A;  5D1S A;  1PWW A;  1OM6 A;  1G49 A;  2XS3 A;  3TSK A;  2FV5 A;  2W0D A;  4PKU A;  4PKT A;  1I1I P;  1BKC I;  5D3C A;  1KUK A;  5LAB A;  2KRJ A;  4XM6 A;  1OM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...