3HBUP

Prtc methionine mutants: m226h desy
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIHSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Secreted protease C
total genus 158
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hbuP01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hbuP02
2MLRA 1GKDA 4FU4A 3LJTA 3Q2HA 2MZHA 2OZRA 3BA0A 4AXQA 1AF0A 3L0TA 1HTDA 2CLTA 1ASTA 1B8YA 2USNA 2HU6A 2OXWA 1IAAA 1JAOA 4R3VA 3O64A 1ATLA 2Y6CA 3WV1A 2D1NA 2J0TA 3EHYA 966CA 1UMSA 1MMPA 3LA9A 3ZVSA 1OM6A 2OW1A 1FBLA 1OO9A 456CA 2AYKA 1G9KA 1CQRA 1JIWP 4FXQA 1CAQA 4IUWA 3DPFA 1G49A 4GF1A 2MZEA 1GKCA 2OW9A 4JP4A 1HOVA 1GE5A 2I47A 4A3WA 3I7GA 3LILA 4H76A 1CXVA 1YCMA 3NTNA 1KUFA 3S6LA 1O0QA 4PKVA 3F15A 1A86A 2Z8ZA 3LKAA 5B5OA 1J7NA 2ZVDA 3NX7A 2YO1A 1D8FA 3WP8A 1XFWA 4PKWA 1JJ9A 1I1IP 2OW0A 1JH1A 4JQGA 2JIHA 4G0DA 1K7IA 5CXLA 1S4BP 2D1OA 4WF6A 4EFSA 5JMYA 5L79A 1AYKA 5CZMA 3LMCA 3ZXHA 1G4KA 4DV8A 2W12A 5D1TA 1CGFA 2FV9A 1ROSA 3K7LA 1CGLA 3KMCA 1MMBA 2W14A 1CIZA 2DW2A 3KMEA 1DMTA 2X3BA 1PWQA 1UEAA 3U1RA 3TS4A 2ZJ6A 2X3AA 4A7BA 1B3DA 1CK7A 4JPAA 1PWVA 3LQBA 3HBUP 2A8HA 4FXYP 1PWPA 2WOAA 1BKCI 4PKUA 1GE6A 1BM6A 1K7GA 5BOYA 1SRPA 1YQYA 1QIBA 3SHIA 1IAEA 3EDHA 5H8XA 1IABA 5CXAA 1QJJA 2FV5A 1BKCE 1R1JA 3LIKA 4DF9A 3DSLA 1QJIA 2V4BA 2K2GA 1IACA 1JAQA 4DPEA 4H84A 3MA2A 1OS2A 3KEJA 1RMZA 3DNGA 2O3EA 1OM7A 1D7XA 3DPEA 3UVCA 1G05A 2W13A 2RJQA 4GR8A 1Y93A 3AYKA 1BQQM 2J83A 2W15A 5I0LA 4WZVA 3GBOA 2L0RA 1ZXCA 5L7FA 3G5CA 1GE7A 1H71P 1HY7A 2YO0A 4GWNA 5D2BA 1R55A 3AYUA 1BQOA 2SRTA 4H49A 3LIRA 4H3XA 3K7NA 1JANA 2OVXA 3F18A 2OW2A 5I3MA 3ZUKA 4GUYA 1PWUA 2QPJA 3LUMA 4PKSA 3EDIA 4WKEA 1CGEA 3KEKA 4GWMA 3HBVP 1MMQA 3LJGA 1SATA 3F19A 1Q3AA 1UTZA 4JIJA 3V96B 1KAPP 2Y6DA 1K7QA 3DWBA 2OVZA 4QKZA 2XQHA 4WKIA 1R1IA 2E2DA 3P1VA 1QICA 2OI0A 1HV5A 1EB6A 2ML2A 2JT6A 2POJA 1Z3JA 1JK3A 1YP1A 5I2ZA 1XUCA 1XUDA 3HB2P 3TVCA 1BZSA 1D8MA 1BUDA 3HDAP 1FM1A 3A6ZA 4ON1A 3WV3A 1BUVM 1JKYA 1KUGA 3WV2A 2K9CA 3F16A 1SMPA 1MMRA 3LE9A 1C3IA 3LAAA 3LUNA 4IJOA 1WNIA 3CKIA 4J4MA 1XFVA 4DD8A 3TSKA 1ZP5A 830CA 1KBCA 1UTTA 4ILWD 4AYKA 3A70A 1FLSA 4H2EA 1IADA 3EDZA 1ZS0A 2W0DA 3I7IA 3F17A 3ELMA 5D3CA 4IN9A 2DW1A 1EUBA 4HMAA 1QUAA 3LEAA 2X7MA 3B92A 5LABA 3P24A 3KECA 4GR3A 1KUIA 1Y8JA 5B5PA 1C7KA 1RM8A 1C8TA 2QUAA 2PJTA 1HFCA 1BKCA 5CVWA 2RJPA 5BPAA 2O36A 1G12A 2CKIA 3KWVC 4FVLA 1JIZA 1D5JA 1HFSA 2EROA 1SLMA 1I76A 3EWJA 2MLSA 3L0VA 1GO7P 3EHXA 3DL1A 4H82A 4WK7A 1XFUA 2TCLA 1DTHA 2JT5A 3F1AA 1PWWA 3B8ZA 3VTGA 5I43A 3LQ0A 2DDFA 4HX3A 1P9HA 3KRYA 4L6TA 2Z8XA 1XFZA 1BSWA 2YIGA 2X3CA 4I03A 3N2UA 4Q1LA 3TT4A 1ZVXA 1QIAA 1BIWA 5D1SA 3VI1A 5I4OA 2OXZA 3LJZA 1SLNA 5D7WA 1Y0VA 4GR0A 4AUOA 2JNPA 3HYGA 3EDGA 2AIGP 1XFXA 4L63A 1IAGA 3LGPA 1XURA 4G9LA 1L6JA 1ZTQA 4XCTA 2ERQA 3N2VA 2MZIA 3G42A 2QUBA 1JAPA 2E3XA 4L19A 4PKQA 3USNA 1KUKA 2Z2DA 3RTSA 4ZR5A 1OM8A 2OY4A 2KRJA 4AIGA 4CTHA 3AIGA 3ULTA 3OHOA 2OY2A 2XS4A 1SU3A 2DW0A 2DDYA 1ZXVA 3HDBA 4PKTA 1GXDA 1YOUA 4XM8A 2YB9A 1USNA 5BOTA 3RTTA 4I35A 4JA1A 2XS3A 2AGMA 1AKLA 5I12A 3KHIA 3HY7A 5CUHA 1OMJA 3O2XA 1XFYA 1R1HA 1UMTA 3LK8A 4PKRA 4H1QA 2WO9A 3HY9A 1EAKA 1R54A 2ZJ7A 1MNCA 1A85A 4XBHA 3E8RA 1ND1A 2WO8A 2OXUA 5D1UA 3Q2GA 4XM7A 1O0TA 4XM6A 4H30A 1I73A 3OHLA 2ERPA 4GQLA 1KUHA 1GO8P 1OS9A 2N8RA 2JSDA 3B2ZA
chains in the Genus database with same CATH superfamily
2MLRA 1GKDA 4FU4A 3LJTA 2YUFA 2MZHA 3Q2HA 2OZRA 3BA0A 4AXQA 1AF0A 3L0TA 1HTDA 2CLTA 1ASTA 1B8YA 2USNA 2HU6A 2OXWA 1IAAA 1JAOA 4R3VA 3O64A 1ATLA 2Y6CA 3WV1A 2D1NA 2J0TA 3EHYA 966CA 1UMSA 1MMPA 3LA9A 3ZVSA 1OM6A 2OW1A 1FBLA 1OO9A 456CA 2AYKA 1G9KA 1CQRA 1JIWP 4FXQA 1CAQA 4IUWA 3DPFA 1G49A 4GF1A 2MZEA 1GKCA 2OW9A 4JP4A 1HOVA 1GE5A 2I47A 4A3WA 3I7GA 3LILA 4H76A 1CXVA 1YCMA 3NTNA 1KUFA 3S6LA 1O0QA 4PKVA 3F15A 1A86A 2Z8ZA 3LKAA 5B5OA 1J7NA 2ZVDA 3NX7A 2YO1A 1D8FA 3WP8A 1XFWA 4PKWA 1JJ9A 1I1IP 2OW0A 1JH1A 4JQGA 2JIHA 4G0DA 1K7IA 5CXLA 1S4BP 2D1OA 4WF6A 4EFSA 5JMYA 5L79A 1AYKA 5CZMA 3LMCA 3ZXHA 1G4KA 4DV8A 2W12A 5D1TA 1CGFA 2FV9A 1ROSA 3K7LA 1CGLA 3KMCA 1MMBA 2W14A 1CIZA 2DW2A 3KMEA 1DMTA 2X3BA 1PWQA 1UEAA 3U1RA 3TS4A 2ZJ6A 2X3AA 4A7BA 1B3DA 1CK7A 4JPAA 1PWVA 3LQBA 3HBUP 2A8HA 4FXYP 1PWPA 2WOAA 1BKCI 3DTKA 4PKUA 1GE6A 1BM6A 1K7GA 5BOYA 4DT5A 1SRPA 3DTIA 1YQYA 1QIBA 3SHIA 1IAEA 3EDHA 5H8XA 1IABA 5CXAA 1QJJA 2FV5A 1BKCE 1R1JA 3LIKA 4DF9A 3DSLA 1QJIA 2V4BA 2K2GA 1IACA 1JAQA 4DPEA 4H84A 3MA2A 1OS2A 3KEJA 1RMZA 3DNGA 2O3EA 1OM7A 1D7XA 3DPEA 3UVCA 1G05A 2W13A 2RJQA 4GR8A 1Y93A 3AYKA 1BQQM 2J83A 2W15A 5I0LA 4WZVA 3GBOA 2L0RA 1ZXCA 5L7FA 3G5CA 1GE7A 1H71P 1HY7A 2YO0A 4GWNA 5D2BA 1R55A 3AYUA 1BQOA 2SRTA 4H49A 3LIRA 4H3XA 3K7NA 1JANA 2OVXA 3F18A 2OW2A 5I3MA 3ZUKA 4GUYA 1PWUA 2QPJA 3LUMA 4PKSA 3EDIA 4WKEA 1CGEA 3KEKA 4GWMA 3HBVP 1MMQA 3LJGA 1SATA 3F19A 1Q3AA 1UTZA 4JIJA 3V96B 1KAPP 2Y6DA 1K7QA 3DWBA 2OVZA 4QKZA 2XQHA 4WKIA 1R1IA 2E2DA 3P1VA 1QICA 2OI0A 1HV5A 1EB6A 2ML2A 2JT6A 2POJA 1Z3JA 1JK3A 1YP1A 5I2ZA 1XUCA 1XUDA 3HB2P 3TVCA 1BZSA 1D8MA 1BUDA 3HDAP 1FM1A 3A6ZA 4ON1A 3WV3A 1BUVM 1JKYA 1KUGA 3WV2A 2K9CA 3F16A 1SMPA 1MMRA 3LE9A 1C3IA 3LAAA 3LUNA 4IJOA 1WNIA 3CKIA 4J4MA 1XFVA 4DD8A 3TSKA 1ZP5A 830CA 1KBCA 1UTTA 4ILWD 4AYKA 3A70A 1FLSA 4H2EA 1XAXA 1IADA 3EDZA 1ZS0A 2W0DA 3I7IA 3F17A 3ELMA 5D3CA 4IN9A 2DW1A 1EUBA 4HMAA 1QUAA 3LEAA 2X7MA 3B92A 5LABA 3P24A 3KECA 4GR3A 1KUIA 1Y8JA 5B5PA 1C7KA 1RM8A 1C8TA 2QUAA 2PJTA 1HFCA 1BKCA 5CVWA 2RJPA 5BPAA 2O36A 1G12A 2CKIA 3KWVC 4FVLA 1JIZA 1D5JA 1HFSA 2EROA 1SLMA 1I76A 3EWJA 2MLSA 3L0VA 1GO7P 3EHXA 3DL1A 4H82A 4WK7A 4L7AA 1XFUA 2TCLA 1DTHA 2JT5A 3F1AA 1PWWA 3B8ZA 3VTGA 5I43A 3LQ0A 2DDFA 4HX3A 1P9HA 3KRYA 4L6TA 2Z8XA 1XFZA 1BSWA 2YIGA 2X3CA 4I03A 3N2UA 4Q1LA 3TT4A 1ZVXA 1QIAA 1BIWA 5D1SA 3VI1A 5I4OA 2OXZA 3LJZA 1SLNA 5D7WA 1Y0VA 4GR0A 4AUOA 2JNPA 3HYGA 3EDGA 2AIGP 1XFXA 4L63A 1IAGA 3LGPA 1XURA 4G9LA 1L6JA 1ZTQA 4XCTA 2ERQA 3N2VA 2MZIA 3G42A 2QUBA 1JAPA 2E3XA 4L19A 4PKQA 3USNA 1KUKA 2Z2DA 3RTSA 4ZR5A 1OM8A 2OY4A 2KRJA 4AIGA 4CTHA 3AIGA 3ULTA 3OHOA 2OY2A 2XS4A 1SU3A 2DW0A 2DDYA 1ZXVA 3HDBA 4PKTA 1GXDA 1YOUA 4XM8A 2YB9A 1USNA 5BOTA 3RTTA 4I35A 4JA1A 2XS3A 2AGMA 1AKLA 5I12A 3KHIA 3HY7A 5CUHA 1TVIA 1OMJA 3O2XA 1XFYA 1R1HA 1UMTA 3LK8A 4PKRA 4H1QA 2WO9A 3HY9A 1EAKA 1R54A 2ZJ7A 1MNCA 1A85A 4XBHA 3DTEA 3E8RA 1ND1A 2WO8A 2OXUA 5D1UA 3Q2GA 1XM5A 4XM7A 1OZ9A 1O0TA 4XM6A 4H30A 1I73A 3OHLA 2ERPA 4GQLA 1KUHA 1GO8P 1OS9A 2N8RA 2JSDA 3B2ZA
chains in the Genus database with same CATH topology
2MLRA 1GKDA 4FU4A 3LJTA 2YUFA 2MZHA 3Q2HA 2OZRA 3BA0A 4AXQA 1AF0A 3L0TA 1HTDA 2CLTA 1ASTA 1B8YA 2USNA 2HU6A 2OXWA 1IAAA 1JAOA 4R3VA 3O64A 1ATLA 2Y6CA 3WV1A 2D1NA 2J0TA 3EHYA 966CA 1UMSA 1MMPA 3LA9A 3ZVSA 1OM6A 2OW1A 1FBLA 1OO9A 456CA 2AYKA 1G9KA 1CQRA 1JIWP 4FXQA 1CAQA 4IUWA 3DPFA 1G49A 4GF1A 2MZEA 1GKCA 2OW9A 4JP4A 1HOVA 1GE5A 2I47A 4A3WA 3I7GA 3LILA 4H76A 1CXVA 1YCMA 3NTNA 1KUFA 3S6LA 1O0QA 4PKVA 3F15A 1A86A 2Z8ZA 3LKAA 5B5OA 1J7NA 2ZVDA 3NX7A 2YO1A 1D8FA 3WP8A 1XFWA 4PKWA 1JJ9A 1I1IP 2OW0A 1JH1A 4JQGA 2JIHA 4G0DA 1K7IA 5CXLA 1S4BP 2D1OA 4WF6A 4EFSA 5JMYA 5L79A 1AYKA 5CZMA 3LMCA 3ZXHA 1G4KA 4DV8A 2W12A 5D1TA 1CGFA 2FV9A 1ROSA 3K7LA 1CGLA 3KMCA 1MMBA 2W14A 1CIZA 2DW2A 3KMEA 1DMTA 2X3BA 1PWQA 1UEAA 3U1RA 3TS4A 2ZJ6A 2X3AA 4A7BA 1B3DA 1CK7A 4JPAA 1PWVA 3LQBA 3HBUP 2A8HA 4FXYP 1PWPA 2WOAA 1BKCI 3DTKA 4PKUA 1GE6A 1BM6A 1K7GA 5BOYA 1SRPA 3DTIA 1YQYA 1QIBA 3SHIA 1IAEA 3EDHA 5H8XA 1IABA 5CXAA 1QJJA 2FV5A 1BKCE 1R1JA 3LIKA 4DF9A 3DSLA 1QJIA 2V4BA 2K2GA 1IACA 1JAQA 4DPEA 4H84A 3MA2A 1OS2A 3KEJA 1RMZA 3DNGA 2O3EA 1OM7A 1D7XA 3DPEA 3UVCA 1G05A 2W13A 2RJQA 4GR8A 1Y93A 3AYKA 1BQQM 2J83A 2W15A 5I0LA 4WZVA 3GBOA 2L0RA 1ZXCA 5L7FA 3G5CA 1GE7A 1H71P 1HY7A 2YO0A 4GWNA 5D2BA 1R55A 3AYUA 1BQOA 2SRTA 4H49A 3LIRA 4H3XA 3K7NA 1JANA 2OVXA 3F18A 2OW2A 5I3MA 3ZUKA 4GUYA 1PWUA 2QPJA 3LUMA 4PKSA 3EDIA 4WKEA 1CGEA 3KEKA 4GWMA 3HBVP 1MMQA 3LJGA 1SATA 3F19A 1Q3AA 1UTZA 4JIJA 3V96B 1KAPP 2Y6DA 1K7QA 3DWBA 2OVZA 4QKZA 2XQHA 4WKIA 1R1IA 2E2DA 3P1VA 1QICA 2OI0A 1HV5A 1EB6A 2ML2A 2JT6A 2POJA 1Z3JA 1JK3A 1YP1A 5I2ZA 1XUCA 1XUDA 3HB2P 3TVCA 1BZSA 1D8MA 1BUDA 3HDAP 1FM1A 3A6ZA 4ON1A 3WV3A 1BUVM 1JKYA 1KUGA 3WV2A 2K9CA 3F16A 1SMPA 1MMRA 3LE9A 1C3IA 3LAAA 3LUNA 4IJOA 1WNIA 3CKIA 4J4MA 1XFVA 4DD8A 3TSKA 1ZP5A 830CA 1KBCA 1UTTA 4ILWD 4AYKA 3A70A 1FLSA 4H2EA 1IADA 3EDZA 1ZS0A 2W0DA 3I7IA 3F17A 3ELMA 5D3CA 4IN9A 2DW1A 1EUBA 4HMAA 1QUAA 3LEAA 2X7MA 3B92A 5LABA 3P24A 3KECA 4GR3A 1KUIA 1Y8JA 5B5PA 1C7KA 1RM8A 1C8TA 2QUAA 2PJTA 1HFCA 1BKCA 5CVWA 2RJPA 5BPAA 2O36A 1G12A 2CKIA 3KWVC 4FVLA 1JIZA 1D5JA 1HFSA 2EROA 1SLMA 1I76A 3EWJA 2MLSA 3L0VA 1GO7P 3EHXA 3DL1A 4H82A 4WK7A 4L7AA 1XFUA 2TCLA 1DTHA 2JT5A 3F1AA 1PWWA 3B8ZA 3VTGA 5I43A 3LQ0A 2DDFA 4HX3A 1P9HA 3KRYA 4L6TA 2Z8XA 1XFZA 1BSWA 2YIGA 2X3CA 4I03A 3N2UA 4Q1LA 3TT4A 1ZVXA 1QIAA 1BIWA 5D1SA 3VI1A 5I4OA 2OXZA 3LJZA 1SLNA 5D7WA 1Y0VA 4GR0A 4AUOA 2JNPA 3HYGA 3EDGA 2AIGP 1XFXA 4L63A 1IAGA 3LGPA 1XURA 4G9LA 1L6JA 1ZTQA 4XCTA 2ERQA 3N2VA 2MZIA 3G42A 2QUBA 1JAPA 2E3XA 4L19A 4PKQA 3USNA 1KUKA 2Z2DA 3RTSA 4ZR5A 1OM8A 2OY4A 2KRJA 4AIGA 4CTHA 3AIGA 3ULTA 3OHOA 2OY2A 2XS4A 1SU3A 2DW0A 2DDYA 1ZXVA 3HDBA 4PKTA 1GXDA 1YOUA 4XM8A 2YB9A 1USNA 5BOTA 3RTTA 4I35A 4JA1A 2XS3A 2AGMA 1AKLA 5I12A 3KHIA 3HY7A 5CUHA 1OMJA 3O2XA 1XFYA 1R1HA 1UMTA 3LK8A 4PKRA 4H1QA 2WO9A 3HY9A 1EAKA 1R54A 2ZJ7A 1MNCA 1A85A 4XBHA 3DTEA 3E8RA 1ND1A 2WO8A 2OXUA 5D1UA 3Q2GA 4XM7A 1O0TA 4XM6A 4H30A 1I73A 3OHLA 2ERPA 4GQLA 1KUHA 1GO8P 1OS9A 2N8RA 2JSDA 3B2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLR A;  1GKD A;  4FU4 A;  3LJT A;  3Q2H A;  2MZH A;  2OZR A;  3BA0 A;  4AXQ A;  1AF0 A;  3L0T A;  1HTD A;  2CLT A;  1AST A;  1B8Y A;  2USN A;  2HU6 A;  2OXW A;  1IAA A;  1JAO A;  4R3V A;  3O64 A;  1ATL A;  2Y6C A;  3WV1 A;  2D1N A;  2J0T A;  3EHY A;  966C A;  1UMS A;  1MMP A;  3LA9 A;  3ZVS A;  1OM6 A;  2OW1 A;  1FBL A;  1OO9 A;  456C A;  2AYK A;  1G9K A;  1CQR A;  1JIW P;  4FXQ A;  1CAQ A;  4IUW A;  3DPF A;  1G49 A;  4GF1 A;  2MZE A;  1GKC A;  2OW9 A;  4JP4 A;  1HOV A;  1GE5 A;  2I47 A;  4A3W A;  3I7G A;  3LIL A;  4H76 A;  1CXV A;  1YCM A;  3NTN A;  1KUF A;  3S6L A;  1O0Q A;  4PKV A;  3F15 A;  1A86 A;  2Z8Z A;  3LKA A;  5B5O A;  1J7N A;  2ZVD A;  3NX7 A;  2YO1 A;  1D8F A;  3WP8 A;  1XFW A;  4PKW A;  1JJ9 A;  1I1I P;  2OW0 A;  1JH1 A;  4JQG A;  2JIH A;  4G0D A;  1K7I A;  5CXL A;  1S4B P;  2D1O A;  4WF6 A;  4EFS A;  5JMY A;  5L79 A;  1AYK A;  5CZM A;  3LMC A;  3ZXH A;  1G4K A;  4DV8 A;  2W12 A;  5D1T A;  1CGF A;  2FV9 A;  1ROS A;  3K7L A;  1CGL A;  3KMC A;  1MMB A;  2W14 A;  1CIZ A;  2DW2 A;  3KME A;  1DMT A;  2X3B A;  1PWQ A;  1UEA A;  3U1R A;  3TS4 A;  2ZJ6 A;  2X3A A;  4A7B A;  1B3D A;  1CK7 A;  4JPA A;  1PWV A;  3LQB A;  3HBU P;  2A8H A;  4FXY P;  1PWP A;  2WOA A;  1BKC I;  4PKU A;  1GE6 A;  1BM6 A;  1K7G A;  5BOY A;  1SRP A;  1YQY A;  1QIB A;  3SHI A;  1IAE A;  3EDH A;  5H8X A;  1IAB A;  5CXA A;  1QJJ A;  2FV5 A;  1BKC E;  1R1J A;  3LIK A;  4DF9 A;  3DSL A;  1QJI A;  2V4B A;  2K2G A;  1IAC A;  1JAQ A;  4DPE A;  4H84 A;  3MA2 A;  1OS2 A;  3KEJ A;  1RMZ A;  3DNG A;  2O3E A;  1OM7 A;  1D7X A;  3DPE A;  3UVC A;  1G05 A;  2W13 A;  2RJQ A;  4GR8 A;  1Y93 A;  3AYK A;  1BQQ M;  2J83 A;  2W15 A;  5I0L A;  4WZV A;  3GBO A;  2L0R A;  1ZXC A;  5L7F A;  3G5C A;  1GE7 A;  1H71 P;  1HY7 A;  2YO0 A;  4GWN A;  5D2B A;  1R55 A;  3AYU A;  1BQO A;  2SRT A;  4H49 A;  3LIR A;  4H3X A;  3K7N A;  1JAN A;  2OVX A;  3F18 A;  2OW2 A;  5I3M A;  3ZUK A;  4GUY A;  1PWU A;  2QPJ A;  3LUM A;  4PKS A;  3EDI A;  4WKE A;  1CGE A;  3KEK A;  4GWM A;  3HBV P;  1MMQ A;  3LJG A;  1SAT A;  3F19 A;  1Q3A A;  1UTZ A;  4JIJ A;  3V96 B;  1KAP P;  2Y6D A;  1K7Q A;  3DWB A;  2OVZ A;  4QKZ A;  2XQH A;  4WKI A;  1R1I A;  2E2D A;  3P1V A;  1QIC A;  2OI0 A;  1HV5 A;  1EB6 A;  2ML2 A;  2JT6 A;  2POJ A;  1Z3J A;  1JK3 A;  1YP1 A;  5I2Z A;  1XUC A;  1XUD A;  3HB2 P;  3TVC A;  1BZS A;  1D8M A;  1BUD A;  3HDA P;  1FM1 A;  3A6Z A;  4ON1 A;  3WV3 A;  1BUV M;  1JKY A;  1KUG A;  3WV2 A;  2K9C A;  3F16 A;  1SMP A;  1MMR A;  3LE9 A;  1C3I A;  3LAA A;  3LUN A;  4IJO A;  1WNI A;  3CKI A;  4J4M A;  1XFV A;  4DD8 A;  3TSK A;  1ZP5 A;  830C A;  1KBC A;  1UTT A;  4ILW D;  4AYK A;  3A70 A;  1FLS A;  4H2E A;  1IAD A;  3EDZ A;  1ZS0 A;  2W0D A;  3I7I A;  3F17 A;  3ELM A;  5D3C A;  4IN9 A;  2DW1 A;  1EUB A;  4HMA A;  1QUA A;  3LEA A;  2X7M A;  3B92 A;  5LAB A;  3P24 A;  3KEC A;  4GR3 A;  1KUI A;  1Y8J A;  5B5P A;  1C7K A;  1RM8 A;  1C8T A;  2QUA A;  2PJT A;  1HFC A;  1BKC A;  5CVW A;  2RJP A;  5BPA A;  2O36 A;  1G12 A;  2CKI A;  3KWV C;  4FVL A;  1JIZ A;  1D5J A;  1HFS A;  2ERO A;  1SLM A;  1I76 A;  3EWJ A;  2MLS A;  3L0V A;  1GO7 P;  3EHX A;  3DL1 A;  4H82 A;  4WK7 A;  1XFU A;  2TCL A;  1DTH A;  2JT5 A;  3F1A A;  1PWW A;  3B8Z A;  3VTG A;  5I43 A;  3LQ0 A;  2DDF A;  4HX3 A;  1P9H A;  3KRY A;  4L6T A;  2Z8X A;  1XFZ A;  1BSW A;  2YIG A;  2X3C A;  4I03 A;  3N2U A;  4Q1L A;  3TT4 A;  1ZVX A;  1QIA A;  1BIW A;  5D1S A;  3VI1 A;  5I4O A;  2OXZ A;  3LJZ A;  1SLN A;  5D7W A;  1Y0V A;  4GR0 A;  4AUO A;  2JNP A;  3HYG A;  3EDG A;  2AIG P;  1XFX A;  4L63 A;  1IAG A;  3LGP A;  1XUR A;  4G9L A;  1L6J A;  1ZTQ A;  4XCT A;  2ERQ A;  3N2V A;  2MZI A;  3G42 A;  2QUB A;  1JAP A;  2E3X A;  4L19 A;  4PKQ A;  3USN A;  1KUK A;  2Z2D A;  3RTS A;  4ZR5 A;  1OM8 A;  2OY4 A;  2KRJ A;  4AIG A;  4CTH A;  3AIG A;  3ULT A;  3OHO A;  2OY2 A;  2XS4 A;  1SU3 A;  2DW0 A;  2DDY A;  1ZXV A;  3HDB A;  4PKT A;  1GXD A;  1YOU A;  4XM8 A;  2YB9 A;  1USN A;  5BOT A;  3RTT A;  4I35 A;  4JA1 A;  2XS3 A;  2AGM A;  1AKL A;  5I12 A;  3KHI A;  3HY7 A;  5CUH A;  1OMJ A;  3O2X A;  1XFY A;  1R1H A;  1UMT A;  3LK8 A;  4PKR A;  4H1Q A;  2WO9 A;  3HY9 A;  1EAK A;  1R54 A;  2ZJ7 A;  1MNC A;  1A85 A;  4XBH A;  3E8R A;  1ND1 A;  2WO8 A;  2OXU A;  5D1U A;  3Q2G A;  4XM7 A;  1O0T A;  4XM6 A;  4H30 A;  1I73 A;  3OHL A;  2ERP A;  4GQL A;  1KUH A;  1GO8 P;  1OS9 A;  2N8R A;  2JSD A;  3B2Z A; 
#chains in the Genus database with same CATH topology
 2MLR A;  1GKD A;  4FU4 A;  3LJT A;  2YUF A;  2MZH A;  3Q2H A;  2OZR A;  3BA0 A;  4AXQ A;  1AF0 A;  3L0T A;  1HTD A;  2CLT A;  1AST A;  1B8Y A;  2USN A;  2HU6 A;  2OXW A;  1IAA A;  1JAO A;  4R3V A;  3O64 A;  1ATL A;  2Y6C A;  3WV1 A;  2D1N A;  2J0T A;  3EHY A;  966C A;  1UMS A;  1MMP A;  3LA9 A;  3ZVS A;  1OM6 A;  2OW1 A;  1FBL A;  1OO9 A;  456C A;  2AYK A;  1G9K A;  1CQR A;  1JIW P;  4FXQ A;  1CAQ A;  4IUW A;  3DPF A;  1G49 A;  4GF1 A;  2MZE A;  1GKC A;  2OW9 A;  4JP4 A;  1HOV A;  1GE5 A;  2I47 A;  4A3W A;  3I7G A;  3LIL A;  4H76 A;  1CXV A;  1YCM A;  3NTN A;  1KUF A;  3S6L A;  1O0Q A;  4PKV A;  3F15 A;  1A86 A;  2Z8Z A;  3LKA A;  5B5O A;  1J7N A;  2ZVD A;  3NX7 A;  2YO1 A;  1D8F A;  3WP8 A;  1XFW A;  4PKW A;  1JJ9 A;  1I1I P;  2OW0 A;  1JH1 A;  4JQG A;  2JIH A;  4G0D A;  1K7I A;  5CXL A;  1S4B P;  2D1O A;  4WF6 A;  4EFS A;  5JMY A;  5L79 A;  1AYK A;  5CZM A;  3LMC A;  3ZXH A;  1G4K A;  4DV8 A;  2W12 A;  5D1T A;  1CGF A;  2FV9 A;  1ROS A;  3K7L A;  1CGL A;  3KMC A;  1MMB A;  2W14 A;  1CIZ A;  2DW2 A;  3KME A;  1DMT A;  2X3B A;  1PWQ A;  1UEA A;  3U1R A;  3TS4 A;  2ZJ6 A;  2X3A A;  4A7B A;  1B3D A;  1CK7 A;  4JPA A;  1PWV A;  3LQB A;  3HBU P;  2A8H A;  4FXY P;  1PWP A;  2WOA A;  1BKC I;  3DTK A;  4PKU A;  1GE6 A;  1BM6 A;  1K7G A;  5BOY A;  4DT5 A;  1SRP A;  3DTI A;  1YQY A;  1QIB A;  3SHI A;  1IAE A;  3EDH A;  5H8X A;  1IAB A;  5CXA A;  1QJJ A;  2FV5 A;  1BKC E;  1R1J A;  3LIK A;  4DF9 A;  3DSL A;  1QJI A;  2V4B A;  2K2G A;  1IAC A;  1JAQ A;  4DPE A;  4H84 A;  3MA2 A;  1OS2 A;  3KEJ A;  1RMZ A;  3DNG A;  2O3E A;  1OM7 A;  1D7X A;  3DPE A;  3UVC A;  1G05 A;  2W13 A;  2RJQ A;  4GR8 A;  1Y93 A;  3AYK A;  1BQQ M;  2J83 A;  2W15 A;  5I0L A;  4WZV A;  3GBO A;  2L0R A;  1ZXC A;  5L7F A;  3G5C A;  1GE7 A;  1H71 P;  1HY7 A;  2YO0 A;  4GWN A;  5D2B A;  1R55 A;  3AYU A;  1BQO A;  2SRT A;  4H49 A;  3LIR A;  4H3X A;  3K7N A;  1JAN A;  2OVX A;  3F18 A;  2OW2 A;  5I3M A;  3ZUK A;  4GUY A;  1PWU A;  2QPJ A;  3LUM A;  4PKS A;  3EDI A;  4WKE A;  1CGE A;  3KEK A;  4GWM A;  3HBV P;  1MMQ A;  3LJG A;  1SAT A;  3F19 A;  1Q3A A;  1UTZ A;  4JIJ A;  3V96 B;  1KAP P;  2Y6D A;  1K7Q A;  3DWB A;  2OVZ A;  4QKZ A;  2XQH A;  4WKI A;  1R1I A;  2E2D A;  3P1V A;  1QIC A;  2OI0 A;  1HV5 A;  1EB6 A;  2ML2 A;  2JT6 A;  2POJ A;  1Z3J A;  1JK3 A;  1YP1 A;  5I2Z A;  1XUC A;  1XUD A;  3HB2 P;  3TVC A;  1BZS A;  1D8M A;  1BUD A;  3HDA P;  1FM1 A;  3A6Z A;  4ON1 A;  3WV3 A;  1BUV M;  1JKY A;  1KUG A;  3WV2 A;  2K9C A;  3F16 A;  1SMP A;  1MMR A;  3LE9 A;  1C3I A;  3LAA A;  3LUN A;  4IJO A;  1WNI A;  3CKI A;  4J4M A;  1XFV A;  4DD8 A;  3TSK A;  1ZP5 A;  830C A;  1KBC A;  1UTT A;  4ILW D;  4AYK A;  3A70 A;  1FLS A;  4H2E A;  1XAX A;  1IAD A;  3EDZ A;  1ZS0 A;  2W0D A;  3I7I A;  3F17 A;  3ELM A;  5D3C A;  4IN9 A;  2DW1 A;  1EUB A;  4HMA A;  1QUA A;  3LEA A;  2X7M A;  3B92 A;  5LAB A;  3P24 A;  3KEC A;  4GR3 A;  1KUI A;  1Y8J A;  5B5P A;  1C7K A;  1RM8 A;  1C8T A;  2QUA A;  2PJT A;  1HFC A;  1BKC A;  5CVW A;  2RJP A;  5BPA A;  2O36 A;  1G12 A;  2CKI A;  3KWV C;  4FVL A;  1JIZ A;  1D5J A;  1HFS A;  2ERO A;  1SLM A;  1I76 A;  3EWJ A;  2MLS A;  3L0V A;  1GO7 P;  3EHX A;  3DL1 A;  4H82 A;  4WK7 A;  4L7A A;  1XFU A;  2TCL A;  1DTH A;  2JT5 A;  3F1A A;  1PWW A;  3B8Z A;  3VTG A;  5I43 A;  3LQ0 A;  2DDF A;  4HX3 A;  1P9H A;  3KRY A;  4L6T A;  2Z8X A;  1XFZ A;  1BSW A;  2YIG A;  2X3C A;  4I03 A;  3N2U A;  4Q1L A;  3TT4 A;  1ZVX A;  1QIA A;  1BIW A;  5D1S A;  3VI1 A;  5I4O A;  2OXZ A;  3LJZ A;  1SLN A;  5D7W A;  1Y0V A;  4GR0 A;  4AUO A;  2JNP A;  3HYG A;  3EDG A;  2AIG P;  1XFX A;  4L63 A;  1IAG A;  3LGP A;  1XUR A;  4G9L A;  1L6J A;  1ZTQ A;  4XCT A;  2ERQ A;  3N2V A;  2MZI A;  3G42 A;  2QUB A;  1JAP A;  2E3X A;  4L19 A;  4PKQ A;  3USN A;  1KUK A;  2Z2D A;  3RTS A;  4ZR5 A;  1OM8 A;  2OY4 A;  2KRJ A;  4AIG A;  4CTH A;  3AIG A;  3ULT A;  3OHO A;  2OY2 A;  2XS4 A;  1SU3 A;  2DW0 A;  2DDY A;  1ZXV A;  3HDB A;  4PKT A;  1GXD A;  1YOU A;  4XM8 A;  2YB9 A;  1USN A;  5BOT A;  3RTT A;  4I35 A;  4JA1 A;  2XS3 A;  2AGM A;  1AKL A;  5I12 A;  3KHI A;  3HY7 A;  5CUH A;  1TVI A;  1OMJ A;  3O2X A;  1XFY A;  1R1H A;  1UMT A;  3LK8 A;  4PKR A;  4H1Q A;  2WO9 A;  3HY9 A;  1EAK A;  1R54 A;  2ZJ7 A;  1MNC A;  1A85 A;  4XBH A;  3DTE A;  3E8R A;  1ND1 A;  2WO8 A;  2OXU A;  5D1U A;  3Q2G A;  1XM5 A;  4XM7 A;  1OZ9 A;  1O0T A;  4XM6 A;  4H30 A;  1I73 A;  3OHL A;  2ERP A;  4GQL A;  1KUH A;  1GO8 P;  1OS9 A;  2N8R A;  2JSD A;  3B2Z A; 
#chains in the Genus database with same CATH homology
 2MLR A;  1GKD A;  4FU4 A;  3LJT A;  2YUF A;  2MZH A;  3Q2H A;  2OZR A;  3BA0 A;  4AXQ A;  1AF0 A;  3L0T A;  1HTD A;  2CLT A;  1AST A;  1B8Y A;  2USN A;  2HU6 A;  2OXW A;  1IAA A;  1JAO A;  4R3V A;  3O64 A;  1ATL A;  2Y6C A;  3WV1 A;  2D1N A;  2J0T A;  3EHY A;  966C A;  1UMS A;  1MMP A;  3LA9 A;  3ZVS A;  1OM6 A;  2OW1 A;  1FBL A;  1OO9 A;  456C A;  2AYK A;  1G9K A;  1CQR A;  1JIW P;  4FXQ A;  1CAQ A;  4IUW A;  3DPF A;  1G49 A;  4GF1 A;  2MZE A;  1GKC A;  2OW9 A;  4JP4 A;  1HOV A;  1GE5 A;  2I47 A;  4A3W A;  3I7G A;  3LIL A;  4H76 A;  1CXV A;  1YCM A;  3NTN A;  1KUF A;  3S6L A;  1O0Q A;  4PKV A;  3F15 A;  1A86 A;  2Z8Z A;  3LKA A;  5B5O A;  1J7N A;  2ZVD A;  3NX7 A;  2YO1 A;  1D8F A;  3WP8 A;  1XFW A;  4PKW A;  1JJ9 A;  1I1I P;  2OW0 A;  1JH1 A;  4JQG A;  2JIH A;  4G0D A;  1K7I A;  5CXL A;  1S4B P;  2D1O A;  4WF6 A;  4EFS A;  5JMY A;  5L79 A;  1AYK A;  5CZM A;  3LMC A;  3ZXH A;  1G4K A;  4DV8 A;  2W12 A;  5D1T A;  1CGF A;  2FV9 A;  1ROS A;  3K7L A;  1CGL A;  3KMC A;  1MMB A;  2W14 A;  1CIZ A;  2DW2 A;  3KME A;  1DMT A;  2X3B A;  1PWQ A;  1UEA A;  3U1R A;  3TS4 A;  2ZJ6 A;  2X3A A;  4A7B A;  1B3D A;  1CK7 A;  4JPA A;  1PWV A;  3LQB A;  3HBU P;  2A8H A;  4FXY P;  1PWP A;  2WOA A;  1BKC I;  3DTK A;  4PKU A;  1GE6 A;  1BM6 A;  1K7G A;  5BOY A;  1SRP A;  3DTI A;  1YQY A;  1QIB A;  3SHI A;  1IAE A;  3EDH A;  5H8X A;  1IAB A;  5CXA A;  1QJJ A;  2FV5 A;  1BKC E;  1R1J A;  3LIK A;  4DF9 A;  3DSL A;  1QJI A;  2V4B A;  2K2G A;  1IAC A;  1JAQ A;  4DPE A;  4H84 A;  3MA2 A;  1OS2 A;  3KEJ A;  1RMZ A;  3DNG A;  2O3E A;  1OM7 A;  1D7X A;  3DPE A;  3UVC A;  1G05 A;  2W13 A;  2RJQ A;  4GR8 A;  1Y93 A;  3AYK A;  1BQQ M;  2J83 A;  2W15 A;  5I0L A;  4WZV A;  3GBO A;  2L0R A;  1ZXC A;  5L7F A;  3G5C A;  1GE7 A;  1H71 P;  1HY7 A;  2YO0 A;  4GWN A;  5D2B A;  1R55 A;  3AYU A;  1BQO A;  2SRT A;  4H49 A;  3LIR A;  4H3X A;  3K7N A;  1JAN A;  2OVX A;  3F18 A;  2OW2 A;  5I3M A;  3ZUK A;  4GUY A;  1PWU A;  2QPJ A;  3LUM A;  4PKS A;  3EDI A;  4WKE A;  1CGE A;  3KEK A;  4GWM A;  3HBV P;  1MMQ A;  3LJG A;  1SAT A;  3F19 A;  1Q3A A;  1UTZ A;  4JIJ A;  3V96 B;  1KAP P;  2Y6D A;  1K7Q A;  3DWB A;  2OVZ A;  4QKZ A;  2XQH A;  4WKI A;  1R1I A;  2E2D A;  3P1V A;  1QIC A;  2OI0 A;  1HV5 A;  1EB6 A;  2ML2 A;  2JT6 A;  2POJ A;  1Z3J A;  1JK3 A;  1YP1 A;  5I2Z A;  1XUC A;  1XUD A;  3HB2 P;  3TVC A;  1BZS A;  1D8M A;  1BUD A;  3HDA P;  1FM1 A;  3A6Z A;  4ON1 A;  3WV3 A;  1BUV M;  1JKY A;  1KUG A;  3WV2 A;  2K9C A;  3F16 A;  1SMP A;  1MMR A;  3LE9 A;  1C3I A;  3LAA A;  3LUN A;  4IJO A;  1WNI A;  3CKI A;  4J4M A;  1XFV A;  4DD8 A;  3TSK A;  1ZP5 A;  830C A;  1KBC A;  1UTT A;  4ILW D;  4AYK A;  3A70 A;  1FLS A;  4H2E A;  1IAD A;  3EDZ A;  1ZS0 A;  2W0D A;  3I7I A;  3F17 A;  3ELM A;  5D3C A;  4IN9 A;  2DW1 A;  1EUB A;  4HMA A;  1QUA A;  3LEA A;  2X7M A;  3B92 A;  5LAB A;  3P24 A;  3KEC A;  4GR3 A;  1KUI A;  1Y8J A;  5B5P A;  1C7K A;  1RM8 A;  1C8T A;  2QUA A;  2PJT A;  1HFC A;  1BKC A;  5CVW A;  2RJP A;  5BPA A;  2O36 A;  1G12 A;  2CKI A;  3KWV C;  4FVL A;  1JIZ A;  1D5J A;  1HFS A;  2ERO A;  1SLM A;  1I76 A;  3EWJ A;  2MLS A;  3L0V A;  1GO7 P;  3EHX A;  3DL1 A;  4H82 A;  4WK7 A;  4L7A A;  1XFU A;  2TCL A;  1DTH A;  2JT5 A;  3F1A A;  1PWW A;  3B8Z A;  3VTG A;  5I43 A;  3LQ0 A;  2DDF A;  4HX3 A;  1P9H A;  3KRY A;  4L6T A;  2Z8X A;  1XFZ A;  1BSW A;  2YIG A;  2X3C A;  4I03 A;  3N2U A;  4Q1L A;  3TT4 A;  1ZVX A;  1QIA A;  1BIW A;  5D1S A;  3VI1 A;  5I4O A;  2OXZ A;  3LJZ A;  1SLN A;  5D7W A;  1Y0V A;  4GR0 A;  4AUO A;  2JNP A;  3HYG A;  3EDG A;  2AIG P;  1XFX A;  4L63 A;  1IAG A;  3LGP A;  1XUR A;  4G9L A;  1L6J A;  1ZTQ A;  4XCT A;  2ERQ A;  3N2V A;  2MZI A;  3G42 A;  2QUB A;  1JAP A;  2E3X A;  4L19 A;  4PKQ A;  3USN A;  1KUK A;  2Z2D A;  3RTS A;  4ZR5 A;  1OM8 A;  2OY4 A;  2KRJ A;  4AIG A;  4CTH A;  3AIG A;  3ULT A;  3OHO A;  2OY2 A;  2XS4 A;  1SU3 A;  2DW0 A;  2DDY A;  1ZXV A;  3HDB A;  4PKT A;  1GXD A;  1YOU A;  4XM8 A;  2YB9 A;  1USN A;  5BOT A;  3RTT A;  4I35 A;  4JA1 A;  2XS3 A;  2AGM A;  1AKL A;  5I12 A;  3KHI A;  3HY7 A;  5CUH A;  1OMJ A;  3O2X A;  1XFY A;  1R1H A;  1UMT A;  3LK8 A;  4PKR A;  4H1Q A;  2WO9 A;  3HY9 A;  1EAK A;  1R54 A;  2ZJ7 A;  1MNC A;  1A85 A;  4XBH A;  3DTE A;  3E8R A;  1ND1 A;  2WO8 A;  2OXU A;  5D1U A;  3Q2G A;  4XM7 A;  1O0T A;  4XM6 A;  4H30 A;  1I73 A;  3OHL A;  2ERP A;  4GQL A;  1KUH A;  1GO8 P;  1OS9 A;  2N8R A;  2JSD A;  3B2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...