3HBUP

Prtc methionine mutants: m226h desy
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIHSYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 158
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hbuP01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hbuP02
3HY7A 2YIGA 1HTDA 3G42A 2Z8XA 2OVXA 2DDFA 1XUDA 1XURA 4PKVA 5D1TA 4DPEA 1YOUA 1BIWA 3WP8A 1ZP5A 3TT4A 2ERPA 2DDYA 1H71P 1GKDA 4H3XA 3ZUKA 2USNA 1SMPA 4ON1A 2W14A 2JSDA 1D8FA 1SLMA 1OS2A 1O0TA 3DSLA 1S4BP 1MMPA 2W0DA 3VTGA 3KRYA 3N2VA 1FLSA 3LGPA 3K7LA 1XFUA 3I7IA 1I76A 2K2GA 2Y6DA 3DPEA 1IACA 456CA 4CTHA 2Y6CA 1A85A 1USNA 3F19A 5I12A 2OY4A 1JH1A 3EHYA 4AUOA 1OM6A 4QKZA 1C8TA 1JAPA 1CIZA 830CA 3LE9A 1IAAA 1I1IP 4GR8A 1PWQA 5BOYA 2AIGP 3UVCA 1IAEA 3HB2P 1P9HA 1GXDA 3WV2A 2ZVDA 4XM8A 1YP1A 3EDIA 1SATA 3P24A 1BM6A 2QUBA 4HX3A 2JIHA 1OMJA 2OVZA 3HYGA 3EWJA 1R54A 3U1RA 3AYKA 1XFYA 3MA2A 1KUKA 1OM7A 1R1JA 4H2EA 5B5PA 3F1AA 3EDZA 4IN9A 2FV5A 3A70A 5I4OA 1YQYA 3ZXHA 2XS3A 5D7WA 3LUNA 1FBLA 2POJA 2Z8ZA 1BKCA 1RM8A 4GR0A 3DWBA 2W15A 1PWUA 1ZS0A 1ATLA 5BOTA 3LMCA 1FM1A 1I73A 2Z2DA 3KECA 4XCTA 3DNGA 3A6ZA 1KUFA 5B5OA 1B8YA 1JK3A 1UEAA 3S6LA 1JJ9A 2PJTA 2O3EA 1DMTA 1G9KA 3EDHA 4L6TA 1XFXA 5L7FA 1OM8A 1JKYA 1K7IA 966CA 1CAQA 2CKIA 2D1OA 1EAKA 1BQOA 3RTTA 4A7BA 4GR3A 2MZEA 4GWNA 3KHIA 1QIBA 3LKAA 4WF6A 1A86A 1HY7A 2QUAA 1DTHA 3B8ZA 3N2UA 5D1SA 2ML2A 2WO9A 2JT6A 4FXQA 3F15A 1BUDA 4WK7A 5CUHA 1IADA 2TCLA 3ELMA 1MMRA 1CGLA 1ZXCA 1D7XA 2ERQA 1HV5A 2CLTA 3GBOA 1IAGA 1QUAA 1JIWP 3LIRA 4JQGA 2D1NA 1EUBA 2ZJ6A 1R55A 3AYUA 4XBHA 1CK7A 4GUYA 2WOAA 5JMYA 3I7GA 1PWWA 3LA9A 1Y0VA 4XM7A 5BPAA 2MZHA 2HU6A 1ASTA 3O2XA 1GE6A 3B92A 1J7NA 3LQ0A 3OHLA 2OXUA 1JAQA 3HDBA 3HY9A 2OW1A 1AKLA 3K7NA 1HOVA 2OXZA 4WKIA 4R3VA 1HFSA 1ZXVA 1R1HA 4H76A 3LJTA 3LJZA 5CZMA 1L6JA 1PWPA 1KUHA 3BA0A 3USNA 1CGFA 2W12A 1CXVA 4GF1A 1BKCI 1UTZA 1QJJA 4IJOA 2QPJA 2YO1A 2N8RA 1OS9A 2RJPA 3TVCA 2KRJA 1GO7P 2SRTA 1JANA 3P1VA 1D5JA 3L0VA 4JPAA 3WV3A 1PWVA 3VI1A 3LJGA 3V96B 3B2ZA 4J4MA 2JNPA 1MMQA 3E8RA 1EB6A 3F18A 3KWVC 3TS4A 5D1UA 1G05A 3EHXA 4ZR5A 1KUIA 2OI0A 2ZJ7A 1KAPP 1BQQM 4ILWD 2MLRA 1QJIA 3NTNA 1OO9A 3ZVSA 2XQHA 1Z3JA 2OW9A 5I3MA 2E2DA 3F16A 3G5CA 3OHOA 1GE7A 4PKSA 4XM6A 1G12A 2OXWA 1MNCA 5CXLA 1SRPA 4I03A 2X3AA 2L0RA 3LK8A 2V4BA 5H8XA 1B3DA 4H1QA 3HBVP 3ULTA 1HFCA 2W13A 2I47A 3KEKA 1O0QA 4FXYP 5CXAA 2EROA 4WZVA 4PKTA 1GO8P 1D8MA 4FU4A 4DV8A 3Q2HA 3LUMA 1JIZA 1BSWA 3KMEA 3LIKA 2MZIA 1XFZA 2RJQA 2OZRA 4AYKA 5CVWA 1UMTA 1Y93A 4PKWA 1XUCA 2X3CA 2YB9A 5LABA 1CGEA 5I2ZA 4WKEA 2JT5A 1BUVM 4GQLA 1JAOA 5I43A 3Q2GA 4PKQA 1R1IA 3TSKA 1QICA 4DF9A 4JP4A 1KUGA 1K7GA 4A3WA 4FVLA 2DW2A 2XS4A 2FV9A 1SLNA 1ZVXA 1RMZA 1XFWA 1G4KA 2AGMA 1AYKA 1AF0A 2J83A 2OW0A 1ND1A 2AYKA 3DPFA 2MLSA 4HMAA 3O64A 3L0TA 3WV1A 2J0TA 1ZTQA 3RTSA 2WO8A 1BKCE 4I35A 3NX7A 2K9CA 1IABA 4AXQA 2DW0A 4Q1LA 4AIGA 1C3IA 2YO0A 1WNIA 4G0DA 3F17A 1GKCA 4G9LA 4L19A 2OW2A 2A8HA 3CKIA 1UMSA 2E3XA 3LILA 4JA1A 5D2BA 4IUWA 4GWMA 5I0LA 3HBUP 3AIGA 1C7KA 1Y8JA 3LEAA 1QIAA 4L63A 1UTTA 4H49A 1XFVA 1K7QA 3SHIA 3LAAA 3HDAP 1Q3AA 3KEJA 2X3BA 5L79A 1CQRA 1BZSA 4EFSA 1ROSA 4PKRA 4DD8A 2DW1A 1YCMA 3KMCA 1MMBA 2O36A 1KBCA 2X7MA 5D3CA 4JIJA 1GE5A 3EDGA 4H84A 4PKUA 4H30A 1G49A 2OY2A 1SU3A 3LQBA 4H82A 3DL1A
chains in the Genus database with same CATH superfamily
3HY7A 2YIGA 1HTDA 3G42A 2Z8XA 2OVXA 2DDFA 1XUDA 1XURA 4PKVA 5D1TA 4DPEA 1YOUA 1BIWA 3WP8A 1ZP5A 3TT4A 2ERPA 2DDYA 1H71P 1GKDA 4H3XA 3ZUKA 1XM5A 2USNA 1SMPA 4ON1A 2W14A 2JSDA 1D8FA 1SLMA 1OS2A 1O0TA 3DSLA 1S4BP 1MMPA 2W0DA 3VTGA 3KRYA 3N2VA 1FLSA 3LGPA 3K7LA 1XFUA 3I7IA 1I76A 2K2GA 3DTKA 2Y6DA 3DPEA 1IACA 456CA 4CTHA 2Y6CA 1A85A 1USNA 3F19A 5I12A 2OY4A 1JH1A 3EHYA 4AUOA 1OM6A 4QKZA 1C8TA 1JAPA 1CIZA 830CA 3LE9A 1IAAA 1I1IP 4GR8A 1PWQA 5BOYA 2AIGP 3UVCA 1IAEA 3HB2P 1P9HA 1GXDA 3WV2A 2ZVDA 4XM8A 1YP1A 3EDIA 1SATA 3P24A 1BM6A 2QUBA 4HX3A 2JIHA 1OMJA 2OVZA 3HYGA 3EWJA 4DT5A 1R54A 3U1RA 3AYKA 1XFYA 3MA2A 1KUKA 1OM7A 1R1JA 4H2EA 5B5PA 3F1AA 3EDZA 4IN9A 2FV5A 3A70A 5I4OA 1YQYA 3ZXHA 2XS3A 5D7WA 3DTEA 3LUNA 1FBLA 2POJA 2Z8ZA 1BKCA 1RM8A 4GR0A 3DWBA 2W15A 1PWUA 1ZS0A 1ATLA 5BOTA 3LMCA 1FM1A 1I73A 2Z2DA 3KECA 4XCTA 3DNGA 3A6ZA 1KUFA 2YUFA 5B5OA 1B8YA 1JK3A 1UEAA 3S6LA 1JJ9A 2PJTA 2O3EA 1DMTA 1G9KA 3EDHA 4L6TA 1XFXA 5L7FA 1OM8A 1JKYA 1K7IA 966CA 1CAQA 2CKIA 2D1OA 1EAKA 1BQOA 3DTIA 3RTTA 4A7BA 4GR3A 2MZEA 4GWNA 3KHIA 1QIBA 3LKAA 4WF6A 1A86A 1HY7A 2QUAA 1DTHA 3B8ZA 3N2UA 5D1SA 2ML2A 2WO9A 2JT6A 4FXQA 3F15A 1BUDA 4WK7A 5CUHA 1IADA 2TCLA 3ELMA 1MMRA 1CGLA 1ZXCA 1D7XA 2ERQA 1HV5A 2CLTA 3GBOA 1IAGA 1QUAA 1JIWP 3LIRA 4JQGA 2D1NA 1EUBA 2ZJ6A 1R55A 3AYUA 4XBHA 1CK7A 4GUYA 1OZ9A 2WOAA 5JMYA 3I7GA 1PWWA 3LA9A 1Y0VA 4XM7A 5BPAA 2MZHA 2HU6A 1ASTA 3O2XA 1GE6A 3B92A 1J7NA 3LQ0A 3OHLA 2OXUA 1JAQA 3HDBA 3HY9A 2OW1A 1AKLA 3K7NA 1HOVA 2OXZA 4WKIA 4R3VA 1HFSA 1ZXVA 1R1HA 4H76A 3LJTA 3LJZA 5CZMA 1L6JA 1PWPA 1KUHA 3BA0A 3USNA 1CGFA 2W12A 1CXVA 4GF1A 1BKCI 1UTZA 1QJJA 4IJOA 2QPJA 2YO1A 2N8RA 1OS9A 2RJPA 3TVCA 2KRJA 1GO7P 2SRTA 1JANA 3P1VA 1D5JA 3L0VA 4JPAA 3WV3A 1PWVA 3VI1A 3LJGA 3V96B 3B2ZA 1TVIA 4J4MA 2JNPA 1MMQA 3E8RA 1EB6A 3F18A 3KWVC 3TS4A 5D1UA 1G05A 3EHXA 4ZR5A 1KUIA 2OI0A 2ZJ7A 1KAPP 1BQQM 4ILWD 2MLRA 1QJIA 3NTNA 1OO9A 3ZVSA 2XQHA 1Z3JA 2OW9A 5I3MA 2E2DA 3F16A 3G5CA 3OHOA 1GE7A 4PKSA 4XM6A 1G12A 2OXWA 1MNCA 5CXLA 1SRPA 4I03A 2X3AA 2L0RA 3LK8A 2V4BA 5H8XA 1B3DA 4H1QA 3HBVP 3ULTA 1HFCA 2W13A 2I47A 3KEKA 1O0QA 4FXYP 5CXAA 2EROA 4WZVA 4PKTA 1GO8P 1D8MA 4FU4A 4DV8A 3Q2HA 3LUMA 1JIZA 1BSWA 3KMEA 3LIKA 2MZIA 1XFZA 2RJQA 2OZRA 4AYKA 5CVWA 1UMTA 1Y93A 4PKWA 1XUCA 2X3CA 2YB9A 5LABA 1CGEA 5I2ZA 4WKEA 2JT5A 1BUVM 4GQLA 1JAOA 5I43A 3Q2GA 4PKQA 1R1IA 3TSKA 1QICA 4DF9A 4JP4A 1KUGA 1K7GA 4A3WA 4FVLA 2DW2A 2XS4A 2FV9A 1SLNA 1ZVXA 1RMZA 1XFWA 1G4KA 2AGMA 1AYKA 1AF0A 2J83A 2OW0A 1ND1A 4L7AA 2AYKA 3DPFA 2MLSA 4HMAA 3O64A 3L0TA 3WV1A 2J0TA 1ZTQA 3RTSA 2WO8A 1BKCE 4I35A 3NX7A 2K9CA 1IABA 4AXQA 2DW0A 4Q1LA 4AIGA 1C3IA 2YO0A 1WNIA 4G0DA 3F17A 1GKCA 4G9LA 4L19A 2OW2A 2A8HA 3CKIA 1UMSA 2E3XA 3LILA 4JA1A 5D2BA 4IUWA 4GWMA 5I0LA 3HBUP 3AIGA 1C7KA 1Y8JA 3LEAA 1QIAA 4L63A 1UTTA 4H49A 1XFVA 1K7QA 3SHIA 3LAAA 3HDAP 1Q3AA 3KEJA 2X3BA 5L79A 1CQRA 1BZSA 1XAXA 4EFSA 1ROSA 4PKRA 4DD8A 2DW1A 1YCMA 3KMCA 1MMBA 2O36A 1KBCA 2X7MA 5D3CA 4JIJA 1GE5A 3EDGA 4H84A 4PKUA 4H30A 1G49A 2OY2A 1SU3A 3LQBA 4H82A 3DL1A
chains in the Genus database with same CATH topology
3HY7A 2YIGA 1HTDA 3G42A 2Z8XA 2OVXA 2DDFA 1XUDA 1XURA 4PKVA 5D1TA 4DPEA 1YOUA 1BIWA 3WP8A 1ZP5A 3TT4A 2ERPA 2DDYA 1H71P 1GKDA 4H3XA 3ZUKA 2USNA 1SMPA 4ON1A 2W14A 2JSDA 1D8FA 1SLMA 1OS2A 1O0TA 3DSLA 1S4BP 1MMPA 2W0DA 3VTGA 3KRYA 3N2VA 1FLSA 3LGPA 3K7LA 1XFUA 3I7IA 1I76A 2K2GA 3DTKA 2Y6DA 3DPEA 1IACA 456CA 4CTHA 2Y6CA 1A85A 1USNA 3F19A 5I12A 2OY4A 1JH1A 3EHYA 4AUOA 1OM6A 4QKZA 1C8TA 1JAPA 1CIZA 830CA 3LE9A 1IAAA 1I1IP 4GR8A 1PWQA 5BOYA 2AIGP 3UVCA 1IAEA 3HB2P 1P9HA 1GXDA 3WV2A 2ZVDA 4XM8A 1YP1A 3EDIA 1SATA 3P24A 1BM6A 2QUBA 4HX3A 2JIHA 1OMJA 2OVZA 3HYGA 3EWJA 1R54A 3U1RA 3AYKA 1XFYA 3MA2A 1KUKA 1OM7A 1R1JA 4H2EA 5B5PA 3F1AA 3EDZA 4IN9A 2FV5A 3A70A 5I4OA 1YQYA 3ZXHA 2XS3A 5D7WA 3DTEA 3LUNA 1FBLA 2POJA 2Z8ZA 1BKCA 1RM8A 4GR0A 3DWBA 2W15A 1PWUA 1ZS0A 1ATLA 5BOTA 3LMCA 1FM1A 1I73A 2Z2DA 3KECA 4XCTA 3DNGA 3A6ZA 1KUFA 2YUFA 5B5OA 1B8YA 1JK3A 1UEAA 3S6LA 1JJ9A 2PJTA 2O3EA 1DMTA 1G9KA 3EDHA 4L6TA 1XFXA 5L7FA 1OM8A 1JKYA 1K7IA 966CA 1CAQA 2CKIA 2D1OA 1EAKA 1BQOA 3DTIA 3RTTA 4A7BA 4GR3A 2MZEA 4GWNA 3KHIA 1QIBA 3LKAA 4WF6A 1A86A 1HY7A 2QUAA 1DTHA 3B8ZA 3N2UA 5D1SA 2ML2A 2WO9A 2JT6A 4FXQA 3F15A 1BUDA 4WK7A 5CUHA 1IADA 2TCLA 3ELMA 1MMRA 1CGLA 1ZXCA 1D7XA 2ERQA 1HV5A 2CLTA 3GBOA 1IAGA 1QUAA 1JIWP 3LIRA 4JQGA 2D1NA 1EUBA 2ZJ6A 1R55A 3AYUA 4XBHA 1CK7A 4GUYA 2WOAA 5JMYA 3I7GA 1PWWA 3LA9A 1Y0VA 4XM7A 5BPAA 2MZHA 2HU6A 1ASTA 3O2XA 1GE6A 3B92A 1J7NA 3LQ0A 3OHLA 2OXUA 1JAQA 3HDBA 3HY9A 2OW1A 1AKLA 3K7NA 1HOVA 2OXZA 4WKIA 4R3VA 1HFSA 1ZXVA 1R1HA 4H76A 3LJTA 3LJZA 5CZMA 1L6JA 1PWPA 1KUHA 3BA0A 3USNA 1CGFA 2W12A 1CXVA 4GF1A 1BKCI 1UTZA 1QJJA 4IJOA 2QPJA 2YO1A 2N8RA 1OS9A 2RJPA 3TVCA 2KRJA 1GO7P 2SRTA 1JANA 3P1VA 1D5JA 3L0VA 4JPAA 3WV3A 1PWVA 3VI1A 3LJGA 3V96B 3B2ZA 4J4MA 2JNPA 1MMQA 3E8RA 1EB6A 3F18A 3KWVC 3TS4A 5D1UA 1G05A 3EHXA 4ZR5A 1KUIA 2OI0A 2ZJ7A 1KAPP 1BQQM 4ILWD 2MLRA 1QJIA 3NTNA 1OO9A 3ZVSA 2XQHA 1Z3JA 2OW9A 5I3MA 2E2DA 3F16A 3G5CA 3OHOA 1GE7A 4PKSA 4XM6A 1G12A 2OXWA 1MNCA 5CXLA 1SRPA 4I03A 2X3AA 2L0RA 3LK8A 2V4BA 5H8XA 1B3DA 4H1QA 3HBVP 3ULTA 1HFCA 2W13A 2I47A 3KEKA 1O0QA 4FXYP 5CXAA 2EROA 4WZVA 4PKTA 1GO8P 1D8MA 4FU4A 4DV8A 3Q2HA 3LUMA 1JIZA 1BSWA 3KMEA 3LIKA 2MZIA 1XFZA 2RJQA 2OZRA 4AYKA 5CVWA 1UMTA 1Y93A 4PKWA 1XUCA 2X3CA 2YB9A 5LABA 1CGEA 5I2ZA 4WKEA 2JT5A 1BUVM 4GQLA 1JAOA 5I43A 3Q2GA 4PKQA 1R1IA 3TSKA 1QICA 4DF9A 4JP4A 1KUGA 1K7GA 4A3WA 4FVLA 2DW2A 2XS4A 2FV9A 1SLNA 1ZVXA 1RMZA 1XFWA 1G4KA 2AGMA 1AYKA 1AF0A 2J83A 2OW0A 1ND1A 4L7AA 2AYKA 3DPFA 2MLSA 4HMAA 3O64A 3L0TA 3WV1A 2J0TA 1ZTQA 3RTSA 2WO8A 1BKCE 4I35A 3NX7A 2K9CA 1IABA 4AXQA 2DW0A 4Q1LA 4AIGA 1C3IA 2YO0A 1WNIA 4G0DA 3F17A 1GKCA 4G9LA 4L19A 2OW2A 2A8HA 3CKIA 1UMSA 2E3XA 3LILA 4JA1A 5D2BA 4IUWA 4GWMA 5I0LA 3HBUP 3AIGA 1C7KA 1Y8JA 3LEAA 1QIAA 4L63A 1UTTA 4H49A 1XFVA 1K7QA 3SHIA 3LAAA 3HDAP 1Q3AA 3KEJA 2X3BA 5L79A 1CQRA 1BZSA 4EFSA 1ROSA 4PKRA 4DD8A 2DW1A 1YCMA 3KMCA 1MMBA 2O36A 1KBCA 2X7MA 5D3CA 4JIJA 1GE5A 3EDGA 4H84A 4PKUA 4H30A 1G49A 2OY2A 1SU3A 3LQBA 4H82A 3DL1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HY7 A;  2YIG A;  1HTD A;  3G42 A;  2Z8X A;  2OVX A;  2DDF A;  1XUD A;  1XUR A;  4PKV A;  5D1T A;  4DPE A;  1YOU A;  1BIW A;  3WP8 A;  1ZP5 A;  3TT4 A;  2ERP A;  2DDY A;  1H71 P;  1GKD A;  4H3X A;  3ZUK A;  2USN A;  1SMP A;  4ON1 A;  2W14 A;  2JSD A;  1D8F A;  1SLM A;  1OS2 A;  1O0T A;  3DSL A;  1S4B P;  1MMP A;  2W0D A;  3VTG A;  3KRY A;  3N2V A;  1FLS A;  3LGP A;  3K7L A;  1XFU A;  3I7I A;  1I76 A;  2K2G A;  2Y6D A;  3DPE A;  1IAC A;  456C A;  4CTH A;  2Y6C A;  1A85 A;  1USN A;  3F19 A;  5I12 A;  2OY4 A;  1JH1 A;  3EHY A;  4AUO A;  1OM6 A;  4QKZ A;  1C8T A;  1JAP A;  1CIZ A;  830C A;  3LE9 A;  1IAA A;  1I1I P;  4GR8 A;  1PWQ A;  5BOY A;  2AIG P;  3UVC A;  1IAE A;  3HB2 P;  1P9H A;  1GXD A;  3WV2 A;  2ZVD A;  4XM8 A;  1YP1 A;  3EDI A;  1SAT A;  3P24 A;  1BM6 A;  2QUB A;  4HX3 A;  2JIH A;  1OMJ A;  2OVZ A;  3HYG A;  3EWJ A;  1R54 A;  3U1R A;  3AYK A;  1XFY A;  3MA2 A;  1KUK A;  1OM7 A;  1R1J A;  4H2E A;  5B5P A;  3F1A A;  3EDZ A;  4IN9 A;  2FV5 A;  3A70 A;  5I4O A;  1YQY A;  3ZXH A;  2XS3 A;  5D7W A;  3LUN A;  1FBL A;  2POJ A;  2Z8Z A;  1BKC A;  1RM8 A;  4GR0 A;  3DWB A;  2W15 A;  1PWU A;  1ZS0 A;  1ATL A;  5BOT A;  3LMC A;  1FM1 A;  1I73 A;  2Z2D A;  3KEC A;  4XCT A;  3DNG A;  3A6Z A;  1KUF A;  5B5O A;  1B8Y A;  1JK3 A;  1UEA A;  3S6L A;  1JJ9 A;  2PJT A;  2O3E A;  1DMT A;  1G9K A;  3EDH A;  4L6T A;  1XFX A;  5L7F A;  1OM8 A;  1JKY A;  1K7I A;  966C A;  1CAQ A;  2CKI A;  2D1O A;  1EAK A;  1BQO A;  3RTT A;  4A7B A;  4GR3 A;  2MZE A;  4GWN A;  3KHI A;  1QIB A;  3LKA A;  4WF6 A;  1A86 A;  1HY7 A;  2QUA A;  1DTH A;  3B8Z A;  3N2U A;  5D1S A;  2ML2 A;  2WO9 A;  2JT6 A;  4FXQ A;  3F15 A;  1BUD A;  4WK7 A;  5CUH A;  1IAD A;  2TCL A;  3ELM A;  1MMR A;  1CGL A;  1ZXC A;  1D7X A;  2ERQ A;  1HV5 A;  2CLT A;  3GBO A;  1IAG A;  1QUA A;  1JIW P;  3LIR A;  4JQG A;  2D1N A;  1EUB A;  2ZJ6 A;  1R55 A;  3AYU A;  4XBH A;  1CK7 A;  4GUY A;  2WOA A;  5JMY A;  3I7G A;  1PWW A;  3LA9 A;  1Y0V A;  4XM7 A;  5BPA A;  2MZH A;  2HU6 A;  1AST A;  3O2X A;  1GE6 A;  3B92 A;  1J7N A;  3LQ0 A;  3OHL A;  2OXU A;  1JAQ A;  3HDB A;  3HY9 A;  2OW1 A;  1AKL A;  3K7N A;  1HOV A;  2OXZ A;  4WKI A;  4R3V A;  1HFS A;  1ZXV A;  1R1H A;  4H76 A;  3LJT A;  3LJZ A;  5CZM A;  1L6J A;  1PWP A;  1KUH A;  3BA0 A;  3USN A;  1CGF A;  2W12 A;  1CXV A;  4GF1 A;  1BKC I;  1UTZ A;  1QJJ A;  4IJO A;  2QPJ A;  2YO1 A;  2N8R A;  1OS9 A;  2RJP A;  3TVC A;  2KRJ A;  1GO7 P;  2SRT A;  1JAN A;  3P1V A;  1D5J A;  3L0V A;  4JPA A;  3WV3 A;  1PWV A;  3VI1 A;  3LJG A;  3V96 B;  3B2Z A;  4J4M A;  2JNP A;  1MMQ A;  3E8R A;  1EB6 A;  3F18 A;  3KWV C;  3TS4 A;  5D1U A;  1G05 A;  3EHX A;  4ZR5 A;  1KUI A;  2OI0 A;  2ZJ7 A;  1KAP P;  1BQQ M;  4ILW D;  2MLR A;  1QJI A;  3NTN A;  1OO9 A;  3ZVS A;  2XQH A;  1Z3J A;  2OW9 A;  5I3M A;  2E2D A;  3F16 A;  3G5C A;  3OHO A;  1GE7 A;  4PKS A;  4XM6 A;  1G12 A;  2OXW A;  1MNC A;  5CXL A;  1SRP A;  4I03 A;  2X3A A;  2L0R A;  3LK8 A;  2V4B A;  5H8X A;  1B3D A;  4H1Q A;  3HBV P;  3ULT A;  1HFC A;  2W13 A;  2I47 A;  3KEK A;  1O0Q A;  4FXY P;  5CXA A;  2ERO A;  4WZV A;  4PKT A;  1GO8 P;  1D8M A;  4FU4 A;  4DV8 A;  3Q2H A;  3LUM A;  1JIZ A;  1BSW A;  3KME A;  3LIK A;  2MZI A;  1XFZ A;  2RJQ A;  2OZR A;  4AYK A;  5CVW A;  1UMT A;  1Y93 A;  4PKW A;  1XUC A;  2X3C A;  2YB9 A;  5LAB A;  1CGE A;  5I2Z A;  4WKE A;  2JT5 A;  1BUV M;  4GQL A;  1JAO A;  5I43 A;  3Q2G A;  4PKQ A;  1R1I A;  3TSK A;  1QIC A;  4DF9 A;  4JP4 A;  1KUG A;  1K7G A;  4A3W A;  4FVL A;  2DW2 A;  2XS4 A;  2FV9 A;  1SLN A;  1ZVX A;  1RMZ A;  1XFW A;  1G4K A;  2AGM A;  1AYK A;  1AF0 A;  2J83 A;  2OW0 A;  1ND1 A;  2AYK A;  3DPF A;  2MLS A;  4HMA A;  3O64 A;  3L0T A;  3WV1 A;  2J0T A;  1ZTQ A;  3RTS A;  2WO8 A;  1BKC E;  4I35 A;  3NX7 A;  2K9C A;  1IAB A;  4AXQ A;  2DW0 A;  4Q1L A;  4AIG A;  1C3I A;  2YO0 A;  1WNI A;  4G0D A;  3F17 A;  1GKC A;  4G9L A;  4L19 A;  2OW2 A;  2A8H A;  3CKI A;  1UMS A;  2E3X A;  3LIL A;  4JA1 A;  5D2B A;  4IUW A;  4GWM A;  5I0L A;  3HBU P;  3AIG A;  1C7K A;  1Y8J A;  3LEA A;  1QIA A;  4L63 A;  1UTT A;  4H49 A;  1XFV A;  1K7Q A;  3SHI A;  3LAA A;  3HDA P;  1Q3A A;  3KEJ A;  2X3B A;  5L79 A;  1CQR A;  1BZS A;  4EFS A;  1ROS A;  4PKR A;  4DD8 A;  2DW1 A;  1YCM A;  3KMC A;  1MMB A;  2O36 A;  1KBC A;  2X7M A;  5D3C A;  4JIJ A;  1GE5 A;  3EDG A;  4H84 A;  4PKU A;  4H30 A;  1G49 A;  2OY2 A;  1SU3 A;  3LQB A;  4H82 A;  3DL1 A; 
#chains in the Genus database with same CATH topology
 3HY7 A;  2YIG A;  1HTD A;  3G42 A;  2Z8X A;  2OVX A;  2DDF A;  1XUD A;  1XUR A;  4PKV A;  5D1T A;  4DPE A;  1YOU A;  1BIW A;  3WP8 A;  1ZP5 A;  3TT4 A;  2ERP A;  2DDY A;  1H71 P;  1GKD A;  4H3X A;  3ZUK A;  1XM5 A;  2USN A;  1SMP A;  4ON1 A;  2W14 A;  2JSD A;  1D8F A;  1SLM A;  1OS2 A;  1O0T A;  3DSL A;  1S4B P;  1MMP A;  2W0D A;  3VTG A;  3KRY A;  3N2V A;  1FLS A;  3LGP A;  3K7L A;  1XFU A;  3I7I A;  1I76 A;  2K2G A;  3DTK A;  2Y6D A;  3DPE A;  1IAC A;  456C A;  4CTH A;  2Y6C A;  1A85 A;  1USN A;  3F19 A;  5I12 A;  2OY4 A;  1JH1 A;  3EHY A;  4AUO A;  1OM6 A;  4QKZ A;  1C8T A;  1JAP A;  1CIZ A;  830C A;  3LE9 A;  1IAA A;  1I1I P;  4GR8 A;  1PWQ A;  5BOY A;  2AIG P;  3UVC A;  1IAE A;  3HB2 P;  1P9H A;  1GXD A;  3WV2 A;  2ZVD A;  4XM8 A;  1YP1 A;  3EDI A;  1SAT A;  3P24 A;  1BM6 A;  2QUB A;  4HX3 A;  2JIH A;  1OMJ A;  2OVZ A;  3HYG A;  3EWJ A;  4DT5 A;  1R54 A;  3U1R A;  3AYK A;  1XFY A;  3MA2 A;  1KUK A;  1OM7 A;  1R1J A;  4H2E A;  5B5P A;  3F1A A;  3EDZ A;  4IN9 A;  2FV5 A;  3A70 A;  5I4O A;  1YQY A;  3ZXH A;  2XS3 A;  5D7W A;  3DTE A;  3LUN A;  1FBL A;  2POJ A;  2Z8Z A;  1BKC A;  1RM8 A;  4GR0 A;  3DWB A;  2W15 A;  1PWU A;  1ZS0 A;  1ATL A;  5BOT A;  3LMC A;  1FM1 A;  1I73 A;  2Z2D A;  3KEC A;  4XCT A;  3DNG A;  3A6Z A;  1KUF A;  2YUF A;  5B5O A;  1B8Y A;  1JK3 A;  1UEA A;  3S6L A;  1JJ9 A;  2PJT A;  2O3E A;  1DMT A;  1G9K A;  3EDH A;  4L6T A;  1XFX A;  5L7F A;  1OM8 A;  1JKY A;  1K7I A;  966C A;  1CAQ A;  2CKI A;  2D1O A;  1EAK A;  1BQO A;  3DTI A;  3RTT A;  4A7B A;  4GR3 A;  2MZE A;  4GWN A;  3KHI A;  1QIB A;  3LKA A;  4WF6 A;  1A86 A;  1HY7 A;  2QUA A;  1DTH A;  3B8Z A;  3N2U A;  5D1S A;  2ML2 A;  2WO9 A;  2JT6 A;  4FXQ A;  3F15 A;  1BUD A;  4WK7 A;  5CUH A;  1IAD A;  2TCL A;  3ELM A;  1MMR A;  1CGL A;  1ZXC A;  1D7X A;  2ERQ A;  1HV5 A;  2CLT A;  3GBO A;  1IAG A;  1QUA A;  1JIW P;  3LIR A;  4JQG A;  2D1N A;  1EUB A;  2ZJ6 A;  1R55 A;  3AYU A;  4XBH A;  1CK7 A;  4GUY A;  1OZ9 A;  2WOA A;  5JMY A;  3I7G A;  1PWW A;  3LA9 A;  1Y0V A;  4XM7 A;  5BPA A;  2MZH A;  2HU6 A;  1AST A;  3O2X A;  1GE6 A;  3B92 A;  1J7N A;  3LQ0 A;  3OHL A;  2OXU A;  1JAQ A;  3HDB A;  3HY9 A;  2OW1 A;  1AKL A;  3K7N A;  1HOV A;  2OXZ A;  4WKI A;  4R3V A;  1HFS A;  1ZXV A;  1R1H A;  4H76 A;  3LJT A;  3LJZ A;  5CZM A;  1L6J A;  1PWP A;  1KUH A;  3BA0 A;  3USN A;  1CGF A;  2W12 A;  1CXV A;  4GF1 A;  1BKC I;  1UTZ A;  1QJJ A;  4IJO A;  2QPJ A;  2YO1 A;  2N8R A;  1OS9 A;  2RJP A;  3TVC A;  2KRJ A;  1GO7 P;  2SRT A;  1JAN A;  3P1V A;  1D5J A;  3L0V A;  4JPA A;  3WV3 A;  1PWV A;  3VI1 A;  3LJG A;  3V96 B;  3B2Z A;  1TVI A;  4J4M A;  2JNP A;  1MMQ A;  3E8R A;  1EB6 A;  3F18 A;  3KWV C;  3TS4 A;  5D1U A;  1G05 A;  3EHX A;  4ZR5 A;  1KUI A;  2OI0 A;  2ZJ7 A;  1KAP P;  1BQQ M;  4ILW D;  2MLR A;  1QJI A;  3NTN A;  1OO9 A;  3ZVS A;  2XQH A;  1Z3J A;  2OW9 A;  5I3M A;  2E2D A;  3F16 A;  3G5C A;  3OHO A;  1GE7 A;  4PKS A;  4XM6 A;  1G12 A;  2OXW A;  1MNC A;  5CXL A;  1SRP A;  4I03 A;  2X3A A;  2L0R A;  3LK8 A;  2V4B A;  5H8X A;  1B3D A;  4H1Q A;  3HBV P;  3ULT A;  1HFC A;  2W13 A;  2I47 A;  3KEK A;  1O0Q A;  4FXY P;  5CXA A;  2ERO A;  4WZV A;  4PKT A;  1GO8 P;  1D8M A;  4FU4 A;  4DV8 A;  3Q2H A;  3LUM A;  1JIZ A;  1BSW A;  3KME A;  3LIK A;  2MZI A;  1XFZ A;  2RJQ A;  2OZR A;  4AYK A;  5CVW A;  1UMT A;  1Y93 A;  4PKW A;  1XUC A;  2X3C A;  2YB9 A;  5LAB A;  1CGE A;  5I2Z A;  4WKE A;  2JT5 A;  1BUV M;  4GQL A;  1JAO A;  5I43 A;  3Q2G A;  4PKQ A;  1R1I A;  3TSK A;  1QIC A;  4DF9 A;  4JP4 A;  1KUG A;  1K7G A;  4A3W A;  4FVL A;  2DW2 A;  2XS4 A;  2FV9 A;  1SLN A;  1ZVX A;  1RMZ A;  1XFW A;  1G4K A;  2AGM A;  1AYK A;  1AF0 A;  2J83 A;  2OW0 A;  1ND1 A;  4L7A A;  2AYK A;  3DPF A;  2MLS A;  4HMA A;  3O64 A;  3L0T A;  3WV1 A;  2J0T A;  1ZTQ A;  3RTS A;  2WO8 A;  1BKC E;  4I35 A;  3NX7 A;  2K9C A;  1IAB A;  4AXQ A;  2DW0 A;  4Q1L A;  4AIG A;  1C3I A;  2YO0 A;  1WNI A;  4G0D A;  3F17 A;  1GKC A;  4G9L A;  4L19 A;  2OW2 A;  2A8H A;  3CKI A;  1UMS A;  2E3X A;  3LIL A;  4JA1 A;  5D2B A;  4IUW A;  4GWM A;  5I0L A;  3HBU P;  3AIG A;  1C7K A;  1Y8J A;  3LEA A;  1QIA A;  4L63 A;  1UTT A;  4H49 A;  1XFV A;  1K7Q A;  3SHI A;  3LAA A;  3HDA P;  1Q3A A;  3KEJ A;  2X3B A;  5L79 A;  1CQR A;  1BZS A;  1XAX A;  4EFS A;  1ROS A;  4PKR A;  4DD8 A;  2DW1 A;  1YCM A;  3KMC A;  1MMB A;  2O36 A;  1KBC A;  2X7M A;  5D3C A;  4JIJ A;  1GE5 A;  3EDG A;  4H84 A;  4PKU A;  4H30 A;  1G49 A;  2OY2 A;  1SU3 A;  3LQB A;  4H82 A;  3DL1 A; 
#chains in the Genus database with same CATH homology
 3HY7 A;  2YIG A;  1HTD A;  3G42 A;  2Z8X A;  2OVX A;  2DDF A;  1XUD A;  1XUR A;  4PKV A;  5D1T A;  4DPE A;  1YOU A;  1BIW A;  3WP8 A;  1ZP5 A;  3TT4 A;  2ERP A;  2DDY A;  1H71 P;  1GKD A;  4H3X A;  3ZUK A;  2USN A;  1SMP A;  4ON1 A;  2W14 A;  2JSD A;  1D8F A;  1SLM A;  1OS2 A;  1O0T A;  3DSL A;  1S4B P;  1MMP A;  2W0D A;  3VTG A;  3KRY A;  3N2V A;  1FLS A;  3LGP A;  3K7L A;  1XFU A;  3I7I A;  1I76 A;  2K2G A;  3DTK A;  2Y6D A;  3DPE A;  1IAC A;  456C A;  4CTH A;  2Y6C A;  1A85 A;  1USN A;  3F19 A;  5I12 A;  2OY4 A;  1JH1 A;  3EHY A;  4AUO A;  1OM6 A;  4QKZ A;  1C8T A;  1JAP A;  1CIZ A;  830C A;  3LE9 A;  1IAA A;  1I1I P;  4GR8 A;  1PWQ A;  5BOY A;  2AIG P;  3UVC A;  1IAE A;  3HB2 P;  1P9H A;  1GXD A;  3WV2 A;  2ZVD A;  4XM8 A;  1YP1 A;  3EDI A;  1SAT A;  3P24 A;  1BM6 A;  2QUB A;  4HX3 A;  2JIH A;  1OMJ A;  2OVZ A;  3HYG A;  3EWJ A;  1R54 A;  3U1R A;  3AYK A;  1XFY A;  3MA2 A;  1KUK A;  1OM7 A;  1R1J A;  4H2E A;  5B5P A;  3F1A A;  3EDZ A;  4IN9 A;  2FV5 A;  3A70 A;  5I4O A;  1YQY A;  3ZXH A;  2XS3 A;  5D7W A;  3DTE A;  3LUN A;  1FBL A;  2POJ A;  2Z8Z A;  1BKC A;  1RM8 A;  4GR0 A;  3DWB A;  2W15 A;  1PWU A;  1ZS0 A;  1ATL A;  5BOT A;  3LMC A;  1FM1 A;  1I73 A;  2Z2D A;  3KEC A;  4XCT A;  3DNG A;  3A6Z A;  1KUF A;  2YUF A;  5B5O A;  1B8Y A;  1JK3 A;  1UEA A;  3S6L A;  1JJ9 A;  2PJT A;  2O3E A;  1DMT A;  1G9K A;  3EDH A;  4L6T A;  1XFX A;  5L7F A;  1OM8 A;  1JKY A;  1K7I A;  966C A;  1CAQ A;  2CKI A;  2D1O A;  1EAK A;  1BQO A;  3DTI A;  3RTT A;  4A7B A;  4GR3 A;  2MZE A;  4GWN A;  3KHI A;  1QIB A;  3LKA A;  4WF6 A;  1A86 A;  1HY7 A;  2QUA A;  1DTH A;  3B8Z A;  3N2U A;  5D1S A;  2ML2 A;  2WO9 A;  2JT6 A;  4FXQ A;  3F15 A;  1BUD A;  4WK7 A;  5CUH A;  1IAD A;  2TCL A;  3ELM A;  1MMR A;  1CGL A;  1ZXC A;  1D7X A;  2ERQ A;  1HV5 A;  2CLT A;  3GBO A;  1IAG A;  1QUA A;  1JIW P;  3LIR A;  4JQG A;  2D1N A;  1EUB A;  2ZJ6 A;  1R55 A;  3AYU A;  4XBH A;  1CK7 A;  4GUY A;  2WOA A;  5JMY A;  3I7G A;  1PWW A;  3LA9 A;  1Y0V A;  4XM7 A;  5BPA A;  2MZH A;  2HU6 A;  1AST A;  3O2X A;  1GE6 A;  3B92 A;  1J7N A;  3LQ0 A;  3OHL A;  2OXU A;  1JAQ A;  3HDB A;  3HY9 A;  2OW1 A;  1AKL A;  3K7N A;  1HOV A;  2OXZ A;  4WKI A;  4R3V A;  1HFS A;  1ZXV A;  1R1H A;  4H76 A;  3LJT A;  3LJZ A;  5CZM A;  1L6J A;  1PWP A;  1KUH A;  3BA0 A;  3USN A;  1CGF A;  2W12 A;  1CXV A;  4GF1 A;  1BKC I;  1UTZ A;  1QJJ A;  4IJO A;  2QPJ A;  2YO1 A;  2N8R A;  1OS9 A;  2RJP A;  3TVC A;  2KRJ A;  1GO7 P;  2SRT A;  1JAN A;  3P1V A;  1D5J A;  3L0V A;  4JPA A;  3WV3 A;  1PWV A;  3VI1 A;  3LJG A;  3V96 B;  3B2Z A;  4J4M A;  2JNP A;  1MMQ A;  3E8R A;  1EB6 A;  3F18 A;  3KWV C;  3TS4 A;  5D1U A;  1G05 A;  3EHX A;  4ZR5 A;  1KUI A;  2OI0 A;  2ZJ7 A;  1KAP P;  1BQQ M;  4ILW D;  2MLR A;  1QJI A;  3NTN A;  1OO9 A;  3ZVS A;  2XQH A;  1Z3J A;  2OW9 A;  5I3M A;  2E2D A;  3F16 A;  3G5C A;  3OHO A;  1GE7 A;  4PKS A;  4XM6 A;  1G12 A;  2OXW A;  1MNC A;  5CXL A;  1SRP A;  4I03 A;  2X3A A;  2L0R A;  3LK8 A;  2V4B A;  5H8X A;  1B3D A;  4H1Q A;  3HBV P;  3ULT A;  1HFC A;  2W13 A;  2I47 A;  3KEK A;  1O0Q A;  4FXY P;  5CXA A;  2ERO A;  4WZV A;  4PKT A;  1GO8 P;  1D8M A;  4FU4 A;  4DV8 A;  3Q2H A;  3LUM A;  1JIZ A;  1BSW A;  3KME A;  3LIK A;  2MZI A;  1XFZ A;  2RJQ A;  2OZR A;  4AYK A;  5CVW A;  1UMT A;  1Y93 A;  4PKW A;  1XUC A;  2X3C A;  2YB9 A;  5LAB A;  1CGE A;  5I2Z A;  4WKE A;  2JT5 A;  1BUV M;  4GQL A;  1JAO A;  5I43 A;  3Q2G A;  4PKQ A;  1R1I A;  3TSK A;  1QIC A;  4DF9 A;  4JP4 A;  1KUG A;  1K7G A;  4A3W A;  4FVL A;  2DW2 A;  2XS4 A;  2FV9 A;  1SLN A;  1ZVX A;  1RMZ A;  1XFW A;  1G4K A;  2AGM A;  1AYK A;  1AF0 A;  2J83 A;  2OW0 A;  1ND1 A;  4L7A A;  2AYK A;  3DPF A;  2MLS A;  4HMA A;  3O64 A;  3L0T A;  3WV1 A;  2J0T A;  1ZTQ A;  3RTS A;  2WO8 A;  1BKC E;  4I35 A;  3NX7 A;  2K9C A;  1IAB A;  4AXQ A;  2DW0 A;  4Q1L A;  4AIG A;  1C3I A;  2YO0 A;  1WNI A;  4G0D A;  3F17 A;  1GKC A;  4G9L A;  4L19 A;  2OW2 A;  2A8H A;  3CKI A;  1UMS A;  2E3X A;  3LIL A;  4JA1 A;  5D2B A;  4IUW A;  4GWM A;  5I0L A;  3HBU P;  3AIG A;  1C7K A;  1Y8J A;  3LEA A;  1QIA A;  4L63 A;  1UTT A;  4H49 A;  1XFV A;  1K7Q A;  3SHI A;  3LAA A;  3HDA P;  1Q3A A;  3KEJ A;  2X3B A;  5L79 A;  1CQR A;  1BZS A;  4EFS A;  1ROS A;  4PKR A;  4DD8 A;  2DW1 A;  1YCM A;  3KMC A;  1MMB A;  2O36 A;  1KBC A;  2X7M A;  5D3C A;  4JIJ A;  1GE5 A;  3EDG A;  4H84 A;  4PKU A;  4H30 A;  1G49 A;  2OY2 A;  1SU3 A;  3LQB A;  4H82 A;  3DL1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...