3NTNA

Crystal structure of uspa1 head and neck domain from moraxella catarrhalis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
211
Chain Sequence
ENSTVGGGGYNQAKGRNSTVAGGYNNEATGTDSTIAGGRKNQATGKGSFAAGIDNKANADNAVALGNKNTIEGENSVAIGSNNTVKKGQQNVFILGSNTDTTNAQNGSVLLGHNTAGKAATIVNSAEVGGLSLTGFAGASNGTVSVGKKGKERQIVHVGAGEISDTSTDAVNGSQLHALATVVAQNKADIKDLDDEVGLLGEEINKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlation of in situ mechanosensitive responses of the Moraxella catarrhalis adhesin UspA1 with fibronectin and receptor CEACAM1 binding.
pubmed doi rcsb
source organism Moraxella catarrhalis
molecule tags Membrane protein
molecule keywords UspA1
total genus 71
structure length 211
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
A PF18792 UspA1_rep Ubiquitous surface protein adhesin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ntnA02
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3ntnA01
1GK6A 2Q3IA 2R5BA 3I5CA 3TNUB 3VMZA 2H7HA 5D7WA 3U1RA 1GD2E 5APUA 1H88A 2W6AA 3NXSA 1SP4A 1G9KA 3HBVP 1JUNA 4AYCA 4I35A 1S9KE 1FAVA 3TNUA 1AKLA 4GT1A 2WPQA 4C46A 5AVYB 2YNYA 3T97A 3LIDA 4C7NB 4LC1A 1NWQA 5CMZA 1O0TA 2ZVDA 4AUWA 4HYTB 3O8ZA 1GO7P 3KQGA 1O0QA 1NAFA 5APWA 3V4QA 1MFZA 2Z8XA 3MD0A 5AVWB 1CSBA 1H89A 1HWTC 1SMPA 1K7GA 3NMDA 4JYBA 3HE4B 4B86A 2C9NY 2YO2A 1MV8A 5AW5B 2XU6A 3A7OA 3M0AA 3LA9A 5AW7B 3A2AA 1OM7A 5AW3B 1HBWA 3M91A 1HUCA 2BASA 5AW6B 5AW0B 2Q7CA 2QUBA 2KP8A 5AVXB 3HE4A 5AVUB 2YO3A 4GKGA 2ZJ6A 3HE5B 1OWAA 3VMXA 1P9HA 1GU4A 4JYCA 3VTPC 1GZLA 4XE5B 3A3YB 2W27A 5AW4B 3ULTA 5AVTB 2Z5IA 3UIAA 3V5BA 3HE5A 1OXZA 1SATA 3M0DA 2ML2A 2YO1A 4C7NA 3S6LA 5APTA 3A70A 2WPSA 1H8AA 3HDAP 1GU5A 1AF0A 5APVA 5APSA 5APYA 2P2UA 3VMYA 2QM8A 1A02J 2ZFCA 3P32A 3KDPB 2QM7A 4EOTA 2P7JA 3P8MC 1JIWP 1OM6A 2IPPA 1DH3A 3LIEA 1H71P 2XZRA 3B8EB 1OM8A 2XV5A 5AVRB 2C9LY 1CI6B 4M3LA 1GK4A 2N9BA 1T2KD 1K7QA 1KQLA 3TYYA 5AW2B 1K7IA 1GTWA 1KAPP 2R3CA 5APQA 3VN0A 1X8YA 4I2LC 3LAAA 1IO4A 2WT7B 1FOSE 2WWWA 5APXA 3V4WA 4DZOA 3VYIA 5CXLA 3VI1A 3SWFA 2JJLA 1S9KD 4AQRD 3NFQA 4KHXA 1J2JB 2VRSA 5AVZB 1SLQA 1MUUA 2WPRA 5AVQB 1CZQA 2R32A 2E42A 1SRPA 5AW8B 5AVSB 5CVWA 5AW1B 1G2CB 5AW9B 1T2KC 1YYCA 1OMJA 2WTYA 3L37A 3MGNA 3A6ZA 3M9BA 2AGMA 3M9HA 3OAKA 2XQHA 3A5TA 2P67A 3NTNA 2E43A 1GO8P 2QUAA 4I6MC 2ZJ7A 3L35A 3M06A 1FOSF 2ZXEB 4RESB 3HTKA 2WT7A 3TK1A 1A02F 1CI6A 2Z5HA 3IR9A 1JNMA 2Q5UA 3P7KA 1HJBA 3L36A 3WP8A 2YO0A 5AVVB 3HBUP 3HB2P 2Z8ZA 2R5DA
chains in the Genus database with same CATH superfamily
3EQ2A 1L0ND 3WU2E 4DOJA 1KC8Q 3TNUB 1ZMEC 2O3JA 1BCCG 5D7WA 3AE4C 2G8YA 3RGUA 1BE3E 1FJKA 2I1KA 2RMZA 3H1KG 3MUDA 3CC4P 2JP3A 2H8PD 1RF0C 1RQVA 3L75E 2LXCB 1R5SA 4PV1C 2J59M 1OW8A 3L4FA 1KYOD 1JY2N 1L0LE 1NTKJ 2BCCG 3RK3D 1KD1Q 4I35A 1GW4A 3KZIE 3L74D 3AEEC 1NOHA 4GT1A 2KNCB 4PD4D 2YIUC 1IFJA 3L72D 1EDJA 5TISH 3L75D 4ZKPA 1M8OB 2E75C 1GL2B 3B71A 1IFDA 3OJAB 2ZVDA 4AUWA 2FFDB 3RK2D 2AEJA 1RQUA 3B5ND 5KAIE 1L0NE 1S5LX 3L73J 1IFPA 1ZN5A 3II6A 4HH2A 4RO0A 4UB6H 4YXDC 2Z8XA 1PIXA 2UWJE 3RK2B 3G9RA 1RY3A 1JOCA 2GM4A 1L4AA 3EFGA 1YJNP 1HWTC 1X0TA 1SQPD 2QE7H 1G2CA 4JYBA 3HE4B 2XNDH 2AGMA 1BGYG 1ZRTE 1NU1E 2E76D 2XU6A 3HD7C 2JDIH 2Y0DA 1LWUC 1BCCE 2BEQD 2KOGA 3GHGA 3M0AA 5AW3B 1HUCA 2FY8A 3L71J 2BASA 5L8RJ 3AE8C 5AVUB 1VL2A 3CLQA 1NTKK 1N73B 2ZJ6A 3HE5B 3Q5RA 2AEMA 3OA7A 3CCQP 3QH9A 1VQLP 2OYHC 1GU4A 4I1LA 1T8ZA 2E75D 1SQQK 2A45G 2WVRA 1BCCJ 3VOPA 4A7PA 4D6TG 2QJKB 2W27A 5CCHC 4UB6E 3HUSB 2GA1A 3CI9A 4EIJA 2Z5IA 4JBZA 3SFEC 1URQD 1JTHB 1AVYA 4N3YB 4GODA 3D6ZA 1S3JA 3W68A 2ML2A 1LT9C 2YO1A 2FYNB 3BCCJ 3H1JD 4YPCA 3D70A 3GHGC 2B87A 3GF3A 1MKMA 3R2PA 1JMMA 2WMMA 2ITAA 1HGZA 4BXLA 2P2UA 2E76C 1OX3A 2P58A 3CMEP 5KAFE 1ZR2A 2ZFCA 3FWNA 3P32A 1S5LE 1VF5B 2QJKC 1A02J 4LGDE 5CCHA 3W67A 1BGYE 1NTKG 1KILE 2QM7A 2P7JA 3VP8A 1Q82Q 3CL3D 1OM6A 1LP1A 1SFCA 4OGQB 3L75J 1W2EA 1LT9B 3B8EB 4H0LC 2D2CB 3E7KA 1AKLA 2XV5A 3VI1A 1XTGB 3L71G 4W7YA 1SQBD 2XDJA 3N7NA 1BE3G 3HD7D 1FZBA 4L75A 1QL2A 1VDFA 1NTMD 4OGQD 1M1JC 2R3CA 4Y28J 5AW2B 1W2BO 2LKMA 4I2LC 1DX7A 3U1RA 1BDCA 1LTIC 1FE6A 1LTAC 3AE5C 3KYQA 3KHUA 3PLNA 4K35A 4PJ0H 3G71P 1OM8A 2R3SA 1FOSE 4U3FD 4DZOA 3VYIA 1EDKA 1E5WA 4WY4B 3RL0D 3SWFA 1S9KD 4JF7A 1RE3C 2FYUD 1KQGB 3RK2C 1RHZB 4H0LB 1PPJG 5AVZB 1R5LA 5KKZC 1Q2NA 1MFTA 1MUUA 3AE9C 5AVQB 3U1CA 2E42A 1W5CE 1SQXG 5CVWA 3H1HJ 3CCSP 1EXJA 2XKMA 1D7MA 2KUBA 2H88C 3IFMA 1YHQP 3MP7B 3MGNA 3M9BA 1TU3F 1JB0J 2QVAA 3O6QB 1KYOI 3C9IA 2A06G 3M9HA 3A0BE 2P67A 3H1HG 3V2RA 2E43A 1CW5A 3MUDC 1U57A 5KLVK 2NPSA 3L35A 4PD4I 3M06A 1JY2P 2K9JA 1RE3A 4I7ZB 3H1KJ 4BWNA 4TLFA 2WT7A 2O01H 3L70D 2OYIB 2PAJA 4KT0J 5BU8B 1OVRA 3A0HE 1FZCB 1KFNA 1EDLA 3RK3B 5CBNA 1KFMA 5GTIH 1JNMA 1LTBC 2Q5UA 1R8EA 2PP6A 1FZCC 2GUSA 1L4AC 2A45I 3HBUP 1SQXK 2W8ZA 2Z8ZA 1USDA 2R5DA 2V7QJ 2YKPA 1GK6A 3E1IA 5CCGC 3VMZA 2YKOA 1Y9BA 3MIWA 2H7HA 1K8AQ 2ZT9D 4N78D 4WY4A 1H88A 1BGYJ 3G4SP 2W6AA 3NXSA 1FZAA 2RN0A 3E1RA 3L74J 3PRJA 1S1CX 2GUVA 3H1KD 2KB7P 4ZMDA 5GTHE 3FWLA 4AYCA 1JO5A 1G9KA 4Y99C 3GG2A 1PL5A 5KKZB 3H1IE 3TNUA 2D2CD 1YJWP 2WSFH 2MKVA 1RH5B 4C46A 1Q90D 5AVYB 3PP5A 1FZCA 2H43A 4ASVA 2WSEJ 2O01J 4TT3H 1SFCB 1N7SA 4LC1A 5CMZA 1PGJA 1VQ7P 1K04A 2NPSB 4W80A 2PGDA 1AQ5A 1LT9A 2NRGA 2HPCA 1OW6A 2QRXA 1LTGC 2JWDA 1L0LD 1KILA 3MD0A 5AVWB 3RK3E 3CC2P 3CCEP 2FBWC 3O6QA 3A0HH 3JCUH 1VQNP 1FJPA 1NKZB 4UB8H 1K7GA 1BDDA 1LTJB 1KZUB 3M9QA 4B86A 2B87B 2R44A 2YO2A 3WUVA 5KLVG 2POHA 4GOFA 4H13B 4WBAA 3GF7A 4OGQC 5AW7B 2K88A 2JEEA 1HBWA 1OVUA 1X79B 2PFXA 2NPSC 2JO1A 5AW0B 2Q7CA 1Z56A 2D2CC 2KP8A 2WSFJ 1VQKP 1WT6A 5CHXA 1PV3A 4D6TE 3CD6P 2YO3A 4GKGA 1JTHA 1QL1A 2YXRB 2CPBA 3PJSK 1YTZT 2OTKE 1VQMP 1N8RQ 1EQ7A 3VTPC 2K37A 3EWKA 3PH0A 1WMKA 5H2FE 4ASWA 3A3YB 1ZP0C 3WMM0 5AW4B 3ULTA 2E76B 1VF5D 2ZYAA 3UIAA 1EZVG 1NTZE 3JC22 1NVOA 3HE5A 2NZ2A 3V5BA 3VMAA 5KJ7D 1PP9G 3AE2C 2IBZI 3M0DA 1N73A 1SATA 4C7NA 3H1HE 3AEAC 1VQ8P 2RKLA 5APTA 3IN6A 3A70A 3S6LA 2DW3A 3H1LJ 5E79H 1YI2P 1H8AA 2AEFA 3L74G 1OW7A 3CWBJ 3Q5SA 2O01N 1KV4A 3K5BA 5APYA 3I55P 1H71P 3V2NA 3S4RA 3L72G 1UIXA 5KLIB 1HH0A 1OZHA 2KIKA 5CCHD 3G6EP 2OYIA 2PRRA 3U59A 2WPVB 1QX8A 1SFCD 4EOTA 3P8MC 2M3BA 1SQQD 5BVZA 1ZW0A 1IFMA 1GL2A 1LTJC 2JWAA 1QGKB 2XZRA 1XTCC 1DH3A 5KLVE 4I7ZC 2QEXP 3CCVP 4O9BA 4QMAA 1S5LH 2C9LY 5KJ7A 1GK4A 2N9BA 3H1LE 5KAFH 3CPWO 3TYYA 2B9BA 1ZXGA 3HUSA 3USSA 1NH4A 3CWBE 1K7QA 1ZR4A 1T3UA 1JM0A 1X8YA 1IC2A 3HRNA 1KN7A 1T6AA 4HKZH 2KNCA 2KSJA 2Z4EA 1OFCX 1IK9A 2M0BA 5KLVD 3WUTA 1IO4A 2YMYA 3HTKB 2N1TD 1OMIA 3RL0C 2W6JH 1SQQE 3CX5E 3H32B 3FXDA 5DJUB 3CCUP 2KZIA 1SQXE 1NTZJ 2MJZA 2K9YA 2Q6QA 3NFQA 4KHXA 1J2JB 4U3FG 1VQ9P 4PJ0E 2FYUG 2IDBA 4R4MA 1M7LA 2QJYB 4IFFA 1CZQA 1ZOYC 1SRPA 4H13D 3B5NA 3CCRP 3BCCE 1JMBA 2Y0CA 1SQVJ 2YIUB 4OH8B 1G2CB 1SQPJ 1G1JA 1YYCA 4LLHA 5AW1B 2FYUE 4Y99B 4D6TD 1T2KC 3H1LD 1HF9A 3A6ZA 2O1JA 2ZYGA 2V7QH 1KQFB 1T3JA 2OYHA 1VQ5P 4W7ZA 1NU1G 5B66E 3TGUD 2OTJP 2AXTE 3Q1MA 2IBZE 1GO8P 3NTNA 5GTHH 3RK3C 2XQHA 4I6MC 1GW3A 3H1JJ 4DT5A 1AV1A 3BASA 3FGAD 3H32A 1DEEG 2ZXEB 3SFDC 1S72P 3HTKA 1S2EA 1LTSC 1ZRTD 1J1DC 2M3EA 2ZYDA 4UB8E 2FYZA 1OVVA 2Z5HA 3JCUE 3WUUA 1Q81Q 1NU1J 3L36A 4JPZB 5AVVB 1LNQA 1M57D 2A45H 1NTZG 1EZVE 4GOEA 4BRYA 1N7SC 1IFIA 5KAIH 2WSSH 1OM7A 3I5CA 2R5BA 3H1IJ 1K05A 1FBMA 1SQXJ 1URQB 1P84I 3L71D 1L0LK 1BE3D 3AEBC 1LTJA 1SQQJ 1GD2E 5CJ0A 1IFNA 1NTMG 1OIPA 1KILC 1NU1K 1USEA 2YMKA 3Q2YA 3A0BH 3I56P 1X22A 3HBVP 3TSIA 2Y0EA 3HUSC 4H44C 1S9KE 1FAVA 1N2DC 2Q9IA 1AQTA 1J1EB 1UIIA 3FX0A 3L74E 4KJMA 1IZNB 2N1TB 2Q1KA 4NPDA 4HB1A 2KLUA 1NTKE 2IZ0A 1Y8AA 2WSEH 5B66H 3RBZA 4C7RA 5K5GB 3AEFC 5KLVJ 2QG4A 2YNYA 3LIDA 4C7NB 1NYHA 1O0TA 4GIFA 2W90A 1L0LJ 3TF5A 3KQGA 1KYOH 1SQXD 1N7LA 1L2PA 1NAFA 1P84E 1O0QA 5DJTB 5APWA 1NTZK 3V4QA 2C0WA 1HVVA 1EZVD 2KSEA 2P10A 1KTMA 3V6IA 1URQA 1HTLC 1CSBA 4Z1MH 1SFCC 1PFIA 1L0LG 2BCCE 5GTIE 3ZDMA 3Q5PA 1KB9D 1LWUB 3U1AA 1YITP 4IOIH 1FZGA 2KK7A 3M0DC 2QJYC 2CK3H 3A7OA 3G3ZA 3LA9A 1YQ4C 3TGUJ 2YXQB 3A2AA 3C1LA 1BSHA 5M1BA 1KMIZ 2KS1A 3L70G 5AW6B 1U7JA 3L70J 3IF4A 4H44D 2QJPB 3F5HA 1PP9E 3BCCG 5CXLA 2I8DA 5C39A 3TGUE 1M56D 2Y9ZA 1VQPP 2HPCB 3VMXA 1P9HA 3AE1C 2L5GB 3L70E 2WSCJ 1KILB 2QIWA 4XE5B 4D6TJ 3CWBD 2OYHB 4NPEA 4L76A 1L4AD 1SQVK 2LR2A 4IL6H 4WB4A 2WSCH 2FXMA 1PP9D 2IYOA 2WPSA 3HDAP 1GU5A 4PV1D 1AF0A 3ITKA 5APSA 5KTBA 5E79E 4YTPC 2J5UA 4U7JA 3VMYA 2QM8A 1MZ9A 3F89A 4XFJA 2E74D 1HJ0A 2P1JA 1JY2O 1GL2D 3P8CD 1JIWP 1BSNA 5H2FH 1GDTA 2LXBA 1ZLLA 3BATA 2BEZF 3LIEA 3T97B 4EI2A 1SQQG 3PTZA 5AVRB 1DIPA 3B5NC 4GDOA 4K3AA 3BVHA 1T2KD 3BRTB 1KAPP 1KQLA 1NTME 5APQA 2CPSA 2YKQA 3R4YA 1QVGO 1EC5A 1SQBE 2WITA 4RJTA 1VQOP 4WY4C 1K73Q 4XA4A 2WT7B 2XNXA 3H1IG 3Q3DA 2FXOA 2KLVA 2KXPB 2WWWA 4H0LD 1Q86Q 1NKNA 2HFED 5CJ4A 2ZVOB 4AQRD 2M8RA 1S4XA 5CCGA 3GMAA 1SLQA 1M1KQ 4WY4D 3AEGC 3LW5J 1N86A 4H13C 2R32A 5AW8B 2KS1B 3AEDC 1M1JB 3L71E 4DT0A 3CCMP 1EDIA 3KPEA 4MN4C 3QWOC 3OW2O 1J1EC 2WTYA 3L37A 1N7SD 1OMJA 4OWFA 2O1KA 4H44B 1SS1A 2M5AA 2N1TC 3H1LG 1SQVG 1LWUA 3A5TA 2ZJ7A 2ZXXA 1HGVA 1NU1D 1KILD 1GMJA 1BGYD 1LT1A 1QEXA 1VF5C 2AXTH 1FS0E 2E74C 2FYUJ 4JQ0D 1SQPE 2M5AB 1SQVE 3CX5H 1LTTC 3H25A 3TK1A 4IL6E 1A02F 2HLOA 2ZJSE 4IFDK 1L0NJ 3L73E 2OARA 3P7KA 4HJGH 5TJHA 1YTZI 3WP8A 1KB9H 4EYYQ 2FYNC 3GHGB 1BCCD 4NPFX 3HB2P 2ZAEB 1M1JA 5AVXB 2Q3IA 3AE6C 1DD3A 3B4SA 1J1DB 2IBZG 4WVZA 2E74B 2K3RA 4N78E 1K9MQ 4PD4E 1KB9I 4L73A 5APUA 1JY3O 3SSUA 1SP4A 2ZT9B 4IFMA 2HG5D 1BE3J 3GW6A 1G1IA 1N73C 3CC7P 2Q3EA 3ABVC 3SWKA 3L73D 3CMAP 2OTLP 2FFDA 1JY3P 1EXIA 2WPQA 3D71A 1FC2C 4PD4H 1IJDB 1VQ6P 3T97A 1NWQA 1KQSO 1YIJP 1U7MA 1NTKD 4HYTB 3O8ZA 1GO7P 3WU2H 1SVFA 1NJIQ 1L0NK 1PGQA 1FDIA 1PPJE 2JKVA 3CWBG 1MFZA 1H0TA 1RF0A 2NPSD 4CPGA 2N9YB 1SQPG 1GL2C 3AE7C 1H89A 3TGUG 1SMPA 2Y9YA 2E75B 3NMDA 1Q7YQ 1P84D 1PP9J 3BRVB 1PGOA 2C9NY 2KZJA 1MV8A 4IL6X 5AW5B 2FFDC 1JCCA 3MHVA 1H0TB 3V2PA 3CXHE 5B5EE 3M91A 1L4AB 3L72E 1FU1A 3CCLP 3B5NB 1JUNA 2QUBA 3HE4A 1DEBA 2OGUA 3N4XA 1E79H 2K9JB 4PV1B 4RKUJ 1YJ9P 1OWAA 3BCCD 2AXCA 2HODB 1NTZD 4JYCA 5KLIC 3MTUE 1GZLA 2ZT9C 3AECC 3IAOA 3H6PA 1RE4A 1RF1A 1FZEA 5AVTB 3CX5I 2OYIC 2G3AA 1SQBK 1AA0A 1OXZA 1SQPK 2IBZD 3CX5D 1EZVI 1WRGA 2B88A 2ZVNB 2IYPA 3VP9A 5CBOA 1M90Q 5APVA 3CXHD 1AVOA 3MZWB 3S1KA 2V4HA 3L73G 2QA4P 2SPZA 2IFMA 3V2QA 2E5YA 2FYUK 5CCGD 2HYNA 3KDPB 1AFOA 2K1AA 4ZKUA 1NGMB 3C8VA 1ZV8A 1SQBJ 2J58A 4N6JA 1JEKA 2IPPA 2QSIA 1L0NG 4DJGA 1FDMA 1NTMJ 3D6YA 2QJPC 2W6BA 2I1JA 3PHLA 4WWIA 5B5EH 3P8CE 1CI6B 4M3LA 1K7IA 2A06E 2E5TA 4DCKA 2RH0A 1SQVD 2WQYC 1FZFA 1GTWA 3VN0A 1YQ3C 3AE3C 1LP1B 2BCCD 3LAAA 2C0XA 1QLED 3H1JG 2N1TA 2IX7C 2IFNA 2HR3A 2FKWB 1YBKA 3CCJP 5APXA 3V4WA 1IK7A 3H1ID 2JJLA 1PGPA 3L75G 3S9OA 3H1JE 3RBXA 5BU5A 2VRSA 3GLMA 3JSVC 3LW5H 5EFWB 3H1KE 4EDFA 1NHLA 1VPCA 4BRYB 2WPRA 3HD7B 1AJYA 5AVSB 2JR8A 1NO4A 3RL0g 1PZQA 3KXDA 3L72J 5AW9B 2W83C 4OVNF 2A06D 4R4LA 3SWYA 2IZ1A 1LGHB 1LJ2A 1NTMK 3H1HD 1SQBG 3HD7A 4U3FE 1X9VA 5TISE 4YXWH 2H89C 3OAKA 3RL0B 2QUAA 1RE4C 1RF1C 2WZ7A 1URQC 3CXHH 2FXPA 4L74A 3KZIH 2B89A 1FOSF 4ZNCA 2L91A 3FXEA 2OQQA 4RESB 3TDKA 2HODA 3EFFK 1JCDA 4U3FJ 1QVFO 1VQ4P 1FDOA 2OYOA 1CI6A 1JY3N 1KORA 2KYVA 1DD4A 1KB9E 1N7SB 1NAYA 1Y47A 3IR9A 2BCCJ 1PPJD 1HJBA 3CXHI 1RF1B 2YO0A 5KJ7C 2KI7B 1P84H 1KYOE
chains in the Genus database with same CATH topology
3EQ2A 4DOJA 3TNUB 5D7WA 1FJKA 2I1KA 3MUDA 2H8PD 1RF0C 2J59M 1JUNA 3L4FA 1JY2N 3RK3D 4I35A 1GW4A 1NOHA 4GT1A 1IFJA 4ZKPA 1GL2B 1IFDA 3OJAB 2ZVDA 4AUWA 2FFDB 3RK2D 3B5ND 1RF1B 4HH2A 1ZN5A 3II6A 2Z8XA 3RK2B 1RY3A 1JOCA 2GM4A 1L4AA 3EFGA 1HWTC 1G2CA 4JYBA 3HE4B 3HD7C 2XU6A 3M0AA 1LWUC 2KOGA 3GHGA 5AW3B 1HUCA 2BASA 5AVUB 3CLQA 1NTKK 1N73B 2ZJ6A 3HE5B 3OA7A 2OYHC 1GU4A 4I1LA 1T8ZA 1SQQK 2A45G 5CCHC 3VOPA 2W27A 3HUSB 3CI9A 4EIJA 2Z5IA 1JTHB 1URQD 4N3YB 2ML2A 2YO1A 1LT9C 3GHGC 3R2PA 1JMMA 1HGZA 2P2UA 1A02J 2ZFCA 3P32A 4LGDE 5CCHA 2QM7A 3VP8A 2P7JA 3CL3D 1OM6A 1SFCA 1W2EA 1LT9B 3B8EB 2XV5A 1XTGB 4W7YA 2XDJA 3N7NA 3HD7D 1FZBA 5AW2B 1QL2A 1VDFA 1M1JC 2R3CA 2LKMA 4I2LC 1LTIC 3KYQA 1LTAC 1FOSE 4DZOA 3VYIA 3RL0D 1E5WA 4WY4B 3SWFA 1S9KD 3VI1A 4JF7A 1RE3C 3RK2C 5AVZB 1MUUA 5AVQB 2E42A 3U1CA 5CVWA 2XKMA 3IFMA 3MGNA 3M9BA 3C9IA 3M9HA 1CW5A 2P67A 3V2RA 2E43A 5KLVK 2NPSA 3L35A 3M06A 1JY2P 1RE3A 2WT7A 2OYIB 2O01H 2PAJA 5BU8B 1FZCB 1KFNA 3RK3B 1KFMA 1JNMA 1LTBC 2Q5UA 2PP6A 1FZCC 2GUSA 2A45I 1L4AC 3HBUP 1SQXK 2Z8ZA 2YKPA 2R5DA 3E1IA 5CCGC 1GK6A 3VMZA 2YKOA 3MIWA 2H7HA 4N78D 4WY4A 1H88A 2W6AA 3NXSA 1FZAA 1DX7A 1JO5A 2GUVA 1G9KA 2KB7P 4AYCA 4Y99C 3TNUA 2WSFH 4C46A 5AVYB 3PP5A 1FZCA 2H43A 1SFCB 1N7SA 4LC1A 5CMZA 2NPSB 4W80A 1AQ5A 1LT9A 2HPCA 1LTGC 3MD0A 1KILA 5AVWB 1FJPA 1NKZB 1K7GA 1LTJB 3M9QA 1KZUB 4B86A 2YO2A 2POHA 4WBAA 5AW7B 2JEEA 1HBWA 1X79B 2NPSC 5AW0B 2Q7CA 1Z56A 2KP8A 1WT6A 5CHXA 2YO3A 4GKGA 1JTHA 1QL1A 2CPBA 1YTZT 1EQ7A 3VTPC 3A3YB 3WMM0 5AW4B 3ULTA 3UIAA 3V5BA 3HE5A 1N73A 5KJ7D 1SATA 3M0DA 4C7NA 3S6LA 5APTA 3A70A 1H8AA 5APYA 3V2NA 1HH0A 5CCHD 3U59A 1SFCD 4EOTA 3P8MC 2M3BA 5BVZA 1DH3A 1IFMA 1GL2A 1LTJC 1H71P 2XZRA 1XTCC 1OM8A 2C9LY 4O9BA 5KJ7A 1GK4A 2N9BA 1K7QA 3TYYA 3HUSA 1K7IA 1NH4A 1ZR4A 1T3UA 1X8YA 1IC2A 3HRNA 2Z4EA 2KSJA 1IO4A 1IK9A 2YMYA 3HTKB 2N1TD 3RL0C 5CXLA 3H32B 2MJZA 3NFQA 4KHXA 1J2JB 1M7LA 4IFFA 1CZQA 1SRPA 3B5NA 4OH8B 5AW1B 1G2CB 1G1JA 1YYCA 4LLHA 1T2KC 4Y99B 3A6ZA 2O1JA 2OYHA 1T3JA 4W7ZA 2AGMA 2XQHA 1GO8P 3NTNA 3RK3C 4I6MC 1GW3A 3BASA 3H32A 2ZXEB 3HTKA 1LTSC 1J1DC 2FYZA 2Z5HA 3L36A 5AVVB 2A45H 1N7SC 1IFIA 1OM7A 3I5CA 2R5BA 1URQB 1FBMA 3U1RA 1GD2E 1L0LK 1LTJA 5CJ0A 1IFNA 1KILC 1NU1K 3HBVP 3TSIA 3HUSC 1S9KE 1FAVA 1N2DC 2Q9IA 1J1EB 1AKLA 2N1TB 2WSEH 4C7RA 2YNYA 4C7NB 3LIDA 1O0TA 4GIFA 1O0QA 3KQGA 1N7LA 1NAFA 5APWA 1NTZK 3V4QA 2C0WA 1HVVA 1URQA 1HTLC 1CSBA 1PFIA 1SFCC 1LWUB 3U1AA 1FZGA 3M0DC 3A7OA 3G3ZA 3LA9A 3A2AA 5AW6B 2HPCB 3VMXA 1P9HA 2L5GB 1KILB 4XE5B 2OYHB 1L4AD 1SQVK 4WB4A 2WSCH 2FXMA 2WPSA 3HDAP 1GU5A 1AF0A 5APSA 5KTBA 3VMYA 2QM8A 1MZ9A 2P1JA 1JY2O 1GL2D 3P8CD 1JIWP 1GDTA 3BATA 1ZLLA 3LIEA 5AVRB 3B5NC 3BVHA 1T2KD 3BRTB 1KAPP 1KQLA 5APQA 2CPSA 2YKQA 2WITA 4WY4C 4XA4A 2WT7B 2XNXA 2OYIA 2KLVA 2WWWA 1NKNA 2HFED 5CJ4A 4AQRD 2M8RA 5CCGA 1SLQA 4WY4D 1N86A 2R32A 5AW8B 1M1JB 1OMJA 3KPEA 1J1EC 2WTYA 3L37A 1N7SD 2O1KA 2N1TC 1LWUA 3A5TA 2ZJ7A 1HGVA 1KILD 1LTTC 3TK1A 1A02F 2HLOA 4IFDK 3P7KA 2OARA 3WP8A 1YTZI 3GHGB 3HB2P 5AVXB 1M1JA 2Q3IA 1J1DB 4N78E 5APUA 1JY3O 1SP4A 4IFMA 2HG5D 1G1IA 1N73C 2FFDA 1JY3P 2WPQA 1IJDB 3T97A 1NWQA 4HYTB 3O8ZA 1GO7P 1SVFA 1L0NK 1MFZA 1RF0A 2NPSD 1GL2C 1H89A 1SMPA 3NMDA 3BRVB 2C9NY 1MV8A 5AW5B 2FFDC 1JCCA 3V2PA 3M91A 1L4AB 1FU1A 3B5NB 2QUBA 3HE4A 1DEBA 3N4XA 1OWAA 2HODB 4JYCA 3MTUE 1GZLA 3H6PA 1RE4A 1RF1A 1FZEA 5AVTB 2OYIC 1SQBK 1OXZA 1SQPK 1WRGA 3VP9A 5APVA 2IFMA 3V2QA 2FYUK 5CCGD 2HYNA 3KDPB 1AFOA 4ZKUA 1ZV8A 2J58A 4N6JA 1FDMA 2IPPA 2W6BA 2I1JA 3P8CE 1CI6B 4M3LA 1FZFA 1GTWA 3VN0A 3LAAA 2C0XA 2N1TA 2IX7C 2IFNA 2FKWB 5APXA 3V4WA 2JJLA 5BU5A 2VRSA 3LW5H 1NHLA 1VPCA 2WPRA 3HD7B 5AVSB 1NO4A 5AW9B 3SWYA 1LGHB 1NTMK 1ZR2A 3HD7A 1X9VA 3OAKA 3RL0B 2QUAA 1RE4C 1RF1C 2WZ7A 1URQC 1FOSF 4RESB 2HODA 1JCDA 1CI6A 1JY3N 2KYVA 1N7SB 3IR9A 1HJBA 2YO0A 5KJ7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK6 A;  2Q3I A;  2R5B A;  3I5C A;  3TNU B;  3VMZ A;  2H7H A;  5D7W A;  3U1R A;  1GD2 E;  5APU A;  1H88 A;  2W6A A;  3NXS A;  1SP4 A;  1G9K A;  3HBV P;  1JUN A;  4AYC A;  4I35 A;  1S9K E;  1FAV A;  3TNU A;  1AKL A;  4GT1 A;  2WPQ A;  4C46 A;  5AVY B;  2YNY A;  3T97 A;  3LID A;  4C7N B;  4LC1 A;  1NWQ A;  5CMZ A;  1O0T A;  2ZVD A;  4AUW A;  4HYT B;  3O8Z A;  1GO7 P;  3KQG A;  1O0Q A;  1NAF A;  5APW A;  3V4Q A;  1MFZ A;  2Z8X A;  3MD0 A;  5AVW B;  1CSB A;  1H89 A;  1HWT C;  1SMP A;  1K7G A;  3NMD A;  4JYB A;  3HE4 B;  4B86 A;  2C9N Y;  2YO2 A;  1MV8 A;  5AW5 B;  2XU6 A;  3A7O A;  3M0A A;  3LA9 A;  5AW7 B;  3A2A A;  1OM7 A;  5AW3 B;  1HBW A;  3M91 A;  1HUC A;  2BAS A;  5AW6 B;  5AW0 B;  2Q7C A;  2QUB A;  2KP8 A;  5AVX B;  3HE4 A;  5AVU B;  2YO3 A;  4GKG A;  2ZJ6 A;  3HE5 B;  1OWA A;  3VMX A;  1P9H A;  1GU4 A;  4JYC A;  3VTP C;  1GZL A;  4XE5 B;  3A3Y B;  2W27 A;  5AW4 B;  3ULT A;  5AVT B;  2Z5I A;  3UIA A;  3V5B A;  3HE5 A;  1OXZ A;  1SAT A;  3M0D A;  2ML2 A;  2YO1 A;  4C7N A;  3S6L A;  5APT A;  3A70 A;  2WPS A;  1H8A A;  3HDA P;  1GU5 A;  1AF0 A;  5APV A;  5APS A;  5APY A;  2P2U A;  3VMY A;  2QM8 A;  1A02 J;  2ZFC A;  3P32 A;  3KDP B;  2QM7 A;  4EOT A;  2P7J A;  3P8M C;  1JIW P;  1OM6 A;  2IPP A;  1DH3 A;  3LIE A;  1H71 P;  2XZR A;  3B8E B;  1OM8 A;  2XV5 A;  5AVR B;  2C9L Y;  1CI6 B;  4M3L A;  1GK4 A;  2N9B A;  1T2K D;  1K7Q A;  1KQL A;  3TYY A;  5AW2 B;  1K7I A;  1GTW A;  1KAP P;  2R3C A;  5APQ A;  3VN0 A;  1X8Y A;  4I2L C;  3LAA A;  1IO4 A;  2WT7 B;  1FOS E;  2WWW A;  5APX A;  3V4W A;  4DZO A;  3VYI A;  5CXL A;  3VI1 A;  3SWF A;  2JJL A;  1S9K D;  4AQR D;  3NFQ A;  4KHX A;  1J2J B;  2VRS A;  5AVZ B;  1SLQ A;  1MUU A;  2WPR A;  5AVQ B;  1CZQ A;  2R32 A;  2E42 A;  1SRP A;  5AW8 B;  5AVS B;  5CVW A;  5AW1 B;  1G2C B;  5AW9 B;  1T2K C;  1YYC A;  1OMJ A;  2WTY A;  3L37 A;  3MGN A;  3A6Z A;  3M9B A;  2AGM A;  3M9H A;  3OAK A;  2XQH A;  3A5T A;  2P67 A;  3NTN A;  2E43 A;  1GO8 P;  2QUA A;  4I6M C;  2ZJ7 A;  3L35 A;  3M06 A;  1FOS F;  2ZXE B;  4RES B;  3HTK A;  2WT7 A;  3TK1 A;  1A02 F;  1CI6 A;  2Z5H A;  3IR9 A;  1JNM A;  2Q5U A;  3P7K A;  1HJB A;  3L36 A;  3WP8 A;  2YO0 A;  5AVV B;  3HBU P;  3HB2 P;  2Z8Z A;  2R5D A; 
#chains in the Genus database with same CATH topology
 3EQ2 A;  1L0N D;  3WU2 E;  4DOJ A;  1KC8 Q;  3TNU B;  1ZME C;  2O3J A;  1BCC G;  5D7W A;  3AE4 C;  2G8Y A;  3RGU A;  1BE3 E;  1FJK A;  2I1K A;  2RMZ A;  3H1K G;  3MUD A;  3CC4 P;  2JP3 A;  2H8P D;  1RF0 C;  1RQV A;  3L75 E;  2LXC B;  1R5S A;  4PV1 C;  2J59 M;  1OW8 A;  3L4F A;  1KYO D;  1JY2 N;  1L0L E;  1NTK J;  2BCC G;  3RK3 D;  1KD1 Q;  4I35 A;  1GW4 A;  3KZI E;  3L74 D;  3AEE C;  1NOH A;  4GT1 A;  2KNC B;  4PD4 D;  2YIU C;  1IFJ A;  3L72 D;  1EDJ A;  5TIS H;  3L75 D;  4ZKP A;  1M8O B;  2E75 C;  1GL2 B;  3B71 A;  1IFD A;  3OJA B;  2ZVD A;  4AUW A;  2FFD B;  3RK2 D;  2AEJ A;  1RQU A;  3B5N D;  5KAI E;  1L0N E;  1S5L X;  3L73 J;  1IFP A;  1ZN5 A;  3II6 A;  4HH2 A;  4RO0 A;  4UB6 H;  4YXD C;  2Z8X A;  1PIX A;  2UWJ E;  3RK2 B;  3G9R A;  1RY3 A;  1JOC A;  2GM4 A;  1L4A A;  3EFG A;  1YJN P;  1HWT C;  1X0T A;  1SQP D;  2QE7 H;  1G2C A;  4JYB A;  3HE4 B;  2XND H;  2AGM A;  1BGY G;  1ZRT E;  1NU1 E;  2E76 D;  2XU6 A;  3HD7 C;  2JDI H;  2Y0D A;  1LWU C;  1BCC E;  2BEQ D;  2KOG A;  3GHG A;  3M0A A;  5AW3 B;  1HUC A;  2FY8 A;  3L71 J;  2BAS A;  5L8R J;  3AE8 C;  5AVU B;  1VL2 A;  3CLQ A;  1NTK K;  1N73 B;  2ZJ6 A;  3HE5 B;  3Q5R A;  2AEM A;  3OA7 A;  3CCQ P;  3QH9 A;  1VQL P;  2OYH C;  1GU4 A;  4I1L A;  1T8Z A;  2E75 D;  1SQQ K;  2A45 G;  2WVR A;  1BCC J;  3VOP A;  4A7P A;  4D6T G;  2QJK B;  2W27 A;  5CCH C;  4UB6 E;  3HUS B;  2GA1 A;  3CI9 A;  4EIJ A;  2Z5I A;  4JBZ A;  3SFE C;  1URQ D;  1JTH B;  1AVY A;  4N3Y B;  4GOD A;  3D6Z A;  1S3J A;  3W68 A;  2ML2 A;  1LT9 C;  2YO1 A;  2FYN B;  3BCC J;  3H1J D;  4YPC A;  3D70 A;  3GHG C;  2B87 A;  3GF3 A;  1MKM A;  3R2P A;  1JMM A;  2WMM A;  2ITA A;  1HGZ A;  4BXL A;  2P2U A;  2E76 C;  1OX3 A;  2P58 A;  3CME P;  5KAF E;  1ZR2 A;  2ZFC A;  3FWN A;  3P32 A;  1S5L E;  1VF5 B;  2QJK C;  1A02 J;  4LGD E;  5CCH A;  3W67 A;  1BGY E;  1NTK G;  1KIL E;  2QM7 A;  2P7J A;  3VP8 A;  1Q82 Q;  3CL3 D;  1OM6 A;  1LP1 A;  1SFC A;  4OGQ B;  3L75 J;  1W2E A;  1LT9 B;  3B8E B;  4H0L C;  2D2C B;  3E7K A;  1AKL A;  2XV5 A;  3VI1 A;  1XTG B;  3L71 G;  4W7Y A;  1SQB D;  2XDJ A;  3N7N A;  1BE3 G;  3HD7 D;  1FZB A;  4L75 A;  1QL2 A;  1VDF A;  1NTM D;  4OGQ D;  1M1J C;  2R3C A;  4Y28 J;  5AW2 B;  1W2B O;  2LKM A;  4I2L C;  1DX7 A;  3U1R A;  1BDC A;  1LTI C;  1FE6 A;  1LTA C;  3AE5 C;  3KYQ A;  3KHU A;  3PLN A;  4K35 A;  4PJ0 H;  3G71 P;  1OM8 A;  2R3S A;  1FOS E;  4U3F D;  4DZO A;  3VYI A;  1EDK A;  1E5W A;  4WY4 B;  3RL0 D;  3SWF A;  1S9K D;  4JF7 A;  1RE3 C;  2FYU D;  1KQG B;  3RK2 C;  1RHZ B;  4H0L B;  1PPJ G;  5AVZ B;  1R5L A;  5KKZ C;  1Q2N A;  1MFT A;  1MUU A;  3AE9 C;  5AVQ B;  3U1C A;  2E42 A;  1W5C E;  1SQX G;  5CVW A;  3H1H J;  3CCS P;  1EXJ A;  2XKM A;  1D7M A;  2KUB A;  2H88 C;  3IFM A;  1YHQ P;  3MP7 B;  3MGN A;  3M9B A;  1TU3 F;  1JB0 J;  2QVA A;  3O6Q B;  1KYO I;  3C9I A;  2A06 G;  3M9H A;  3A0B E;  2P67 A;  3H1H G;  3V2R A;  2E43 A;  1CW5 A;  3MUD C;  1U57 A;  5KLV K;  2NPS A;  3L35 A;  4PD4 I;  3M06 A;  1JY2 P;  2K9J A;  1RE3 A;  4I7Z B;  3H1K J;  4BWN A;  4TLF A;  2WT7 A;  2O01 H;  3L70 D;  2OYI B;  2PAJ A;  4KT0 J;  5BU8 B;  1OVR A;  3A0H E;  1FZC B;  1KFN A;  1EDL A;  3RK3 B;  5CBN A;  1KFM A;  5GTI H;  1JNM A;  1LTB C;  2Q5U A;  1R8E A;  2PP6 A;  1FZC C;  2GUS A;  1L4A C;  2A45 I;  3HBU P;  1SQX K;  2W8Z A;  2Z8Z A;  1USD A;  2R5D A;  2V7Q J;  2YKP A;  1GK6 A;  3E1I A;  5CCG C;  3VMZ A;  2YKO A;  1Y9B A;  3MIW A;  2H7H A;  1K8A Q;  2ZT9 D;  4N78 D;  4WY4 A;  1H88 A;  1BGY J;  3G4S P;  2W6A A;  3NXS A;  1FZA A;  2RN0 A;  3E1R A;  3L74 J;  3PRJ A;  1S1C X;  2GUV A;  3H1K D;  2KB7 P;  4ZMD A;  5GTH E;  3FWL A;  4AYC A;  1JO5 A;  1G9K A;  4Y99 C;  3GG2 A;  1PL5 A;  5KKZ B;  3H1I E;  3TNU A;  2D2C D;  1YJW P;  2WSF H;  2MKV A;  1RH5 B;  4C46 A;  1Q90 D;  5AVY B;  3PP5 A;  1FZC A;  2H43 A;  4ASV A;  2WSE J;  2O01 J;  4TT3 H;  1SFC B;  1N7S A;  4LC1 A;  5CMZ A;  1PGJ A;  1VQ7 P;  1K04 A;  2NPS B;  4W80 A;  2PGD A;  1AQ5 A;  1LT9 A;  2NRG A;  2HPC A;  1OW6 A;  2QRX A;  1LTG C;  2JWD A;  1L0L D;  1KIL A;  3MD0 A;  5AVW B;  3RK3 E;  3CC2 P;  3CCE P;  2FBW C;  3O6Q A;  3A0H H;  3JCU H;  1VQN P;  1FJP A;  1NKZ B;  4UB8 H;  1K7G A;  1BDD A;  1LTJ B;  1KZU B;  3M9Q A;  4B86 A;  2B87 B;  2R44 A;  2YO2 A;  3WUV A;  5KLV G;  2POH A;  4GOF A;  4H13 B;  4WBA A;  3GF7 A;  4OGQ C;  5AW7 B;  2K88 A;  2JEE A;  1HBW A;  1OVU A;  1X79 B;  2PFX A;  2NPS C;  2JO1 A;  5AW0 B;  2Q7C A;  1Z56 A;  2D2C C;  2KP8 A;  2WSF J;  1VQK P;  1WT6 A;  5CHX A;  1PV3 A;  4D6T E;  3CD6 P;  2YO3 A;  4GKG A;  1JTH A;  1QL1 A;  2YXR B;  2CPB A;  3PJS K;  1YTZ T;  2OTK E;  1VQM P;  1N8R Q;  1EQ7 A;  3VTP C;  2K37 A;  3EWK A;  3PH0 A;  1WMK A;  5H2F E;  4ASW A;  3A3Y B;  1ZP0 C;  3WMM 0;  5AW4 B;  3ULT A;  2E76 B;  1VF5 D;  2ZYA A;  3UIA A;  1EZV G;  1NTZ E;  3JC2 2;  1NVO A;  3HE5 A;  2NZ2 A;  3V5B A;  3VMA A;  5KJ7 D;  1PP9 G;  3AE2 C;  2IBZ I;  3M0D A;  1N73 A;  1SAT A;  4C7N A;  3H1H E;  3AEA C;  1VQ8 P;  2RKL A;  5APT A;  3IN6 A;  3A70 A;  3S6L A;  2DW3 A;  3H1L J;  5E79 H;  1YI2 P;  1H8A A;  2AEF A;  3L74 G;  1OW7 A;  3CWB J;  3Q5S A;  2O01 N;  1KV4 A;  3K5B A;  5APY A;  3I55 P;  1H71 P;  3V2N A;  3S4R A;  3L72 G;  1UIX A;  5KLI B;  1HH0 A;  1OZH A;  2KIK A;  5CCH D;  3G6E P;  2OYI A;  2PRR A;  3U59 A;  2WPV B;  1QX8 A;  1SFC D;  4EOT A;  3P8M C;  2M3B A;  1SQQ D;  5BVZ A;  1ZW0 A;  1IFM A;  1GL2 A;  1LTJ C;  2JWA A;  1QGK B;  2XZR A;  1XTC C;  1DH3 A;  5KLV E;  4I7Z C;  2QEX P;  3CCV P;  4O9B A;  4QMA A;  1S5L H;  2C9L Y;  5KJ7 A;  1GK4 A;  2N9B A;  3H1L E;  5KAF H;  3CPW O;  3TYY A;  2B9B A;  1ZXG A;  3HUS A;  3USS A;  1NH4 A;  3CWB E;  1K7Q A;  1ZR4 A;  1T3U A;  1JM0 A;  1X8Y A;  1IC2 A;  3HRN A;  1KN7 A;  1T6A A;  4HKZ H;  2KNC A;  2KSJ A;  2Z4E A;  1OFC X;  1IK9 A;  2M0B A;  5KLV D;  3WUT A;  1IO4 A;  2YMY A;  3HTK B;  2N1T D;  1OMI A;  3RL0 C;  2W6J H;  1SQQ E;  3CX5 E;  3H32 B;  3FXD A;  5DJU B;  3CCU P;  2KZI A;  1SQX E;  1NTZ J;  2MJZ A;  2K9Y A;  2Q6Q A;  3NFQ A;  4KHX A;  1J2J B;  4U3F G;  1VQ9 P;  4PJ0 E;  2FYU G;  2IDB A;  4R4M A;  1M7L A;  2QJY B;  4IFF A;  1CZQ A;  1ZOY C;  1SRP A;  4H13 D;  3B5N A;  3CCR P;  3BCC E;  1JMB A;  2Y0C A;  1SQV J;  2YIU B;  4OH8 B;  1G2C B;  1SQP J;  1G1J A;  1YYC A;  4LLH A;  5AW1 B;  2FYU E;  4Y99 B;  4D6T D;  1T2K C;  3H1L D;  1HF9 A;  3A6Z A;  2O1J A;  2ZYG A;  2V7Q H;  1KQF B;  1T3J A;  2OYH A;  1VQ5 P;  4W7Z A;  1NU1 G;  5B66 E;  3TGU D;  2OTJ P;  2AXT E;  3Q1M A;  2IBZ E;  1GO8 P;  3NTN A;  5GTH H;  3RK3 C;  2XQH A;  4I6M C;  1GW3 A;  3H1J J;  4DT5 A;  1AV1 A;  3BAS A;  3FGA D;  3H32 A;  1DEE G;  2ZXE B;  3SFD C;  1S72 P;  3HTK A;  1S2E A;  1LTS C;  1ZRT D;  1J1D C;  2M3E A;  2ZYD A;  4UB8 E;  2FYZ A;  1OVV A;  2Z5H A;  3JCU E;  3WUU A;  1Q81 Q;  1NU1 J;  3L36 A;  4JPZ B;  5AVV B;  1LNQ A;  1M57 D;  2A45 H;  1NTZ G;  1EZV E;  4GOE A;  4BRY A;  1N7S C;  1IFI A;  5KAI H;  2WSS H;  1OM7 A;  3I5C A;  2R5B A;  3H1I J;  1K05 A;  1FBM A;  1SQX J;  1URQ B;  1P84 I;  3L71 D;  1L0L K;  1BE3 D;  3AEB C;  1LTJ A;  1SQQ J;  1GD2 E;  5CJ0 A;  1IFN A;  1NTM G;  1OIP A;  1KIL C;  1NU1 K;  1USE A;  2YMK A;  3Q2Y A;  3A0B H;  3I56 P;  1X22 A;  3HBV P;  3TSI A;  2Y0E A;  3HUS C;  4H44 C;  1S9K E;  1FAV A;  1N2D C;  2Q9I A;  1AQT A;  1J1E B;  1UII A;  3FX0 A;  3L74 E;  4KJM A;  1IZN B;  2N1T B;  2Q1K A;  4NPD A;  4HB1 A;  2KLU A;  1NTK E;  2IZ0 A;  1Y8A A;  2WSE H;  5B66 H;  3RBZ A;  4C7R A;  5K5G B;  3AEF C;  5KLV J;  2QG4 A;  2YNY A;  3LID A;  4C7N B;  1NYH A;  1O0T A;  4GIF A;  2W90 A;  1L0L J;  3TF5 A;  3KQG A;  1KYO H;  1SQX D;  1N7L A;  1L2P A;  1NAF A;  1P84 E;  1O0Q A;  5DJT B;  5APW A;  1NTZ K;  3V4Q A;  2C0W A;  1HVV A;  1EZV D;  2KSE A;  2P10 A;  1KTM A;  3V6I A;  1URQ A;  1HTL C;  1CSB A;  4Z1M H;  1SFC C;  1PFI A;  1L0L G;  2BCC E;  5GTI E;  3ZDM A;  3Q5P A;  1KB9 D;  1LWU B;  3U1A A;  1YIT P;  4IOI H;  1FZG A;  2KK7 A;  3M0D C;  2QJY C;  2CK3 H;  3A7O A;  3G3Z A;  3LA9 A;  1YQ4 C;  3TGU J;  2YXQ B;  3A2A A;  3C1L A;  1BSH A;  5M1B A;  1KMI Z;  2KS1 A;  3L70 G;  5AW6 B;  1U7J A;  3L70 J;  3IF4 A;  4H44 D;  2QJP B;  3F5H A;  1PP9 E;  3BCC G;  5CXL A;  2I8D A;  5C39 A;  3TGU E;  1M56 D;  2Y9Z A;  1VQP P;  2HPC B;  3VMX A;  1P9H A;  3AE1 C;  2L5G B;  3L70 E;  2WSC J;  1KIL B;  2QIW A;  4XE5 B;  4D6T J;  3CWB D;  2OYH B;  4NPE A;  4L76 A;  1L4A D;  1SQV K;  2LR2 A;  4IL6 H;  4WB4 A;  2WSC H;  2FXM A;  1PP9 D;  2IYO A;  2WPS A;  3HDA P;  1GU5 A;  4PV1 D;  1AF0 A;  3ITK A;  5APS A;  5KTB A;  5E79 E;  4YTP C;  2J5U A;  4U7J A;  3VMY A;  2QM8 A;  1MZ9 A;  3F89 A;  4XFJ A;  2E74 D;  1HJ0 A;  2P1J A;  1JY2 O;  1GL2 D;  3P8C D;  1JIW P;  1BSN A;  5H2F H;  1GDT A;  2LXB A;  1ZLL A;  3BAT A;  2BEZ F;  3LIE A;  3T97 B;  4EI2 A;  1SQQ G;  3PTZ A;  5AVR B;  1DIP A;  3B5N C;  4GDO A;  4K3A A;  3BVH A;  1T2K D;  3BRT B;  1KAP P;  1KQL A;  1NTM E;  5APQ A;  2CPS A;  2YKQ A;  3R4Y A;  1QVG O;  1EC5 A;  1SQB E;  2WIT A;  4RJT A;  1VQO P;  4WY4 C;  1K73 Q;  4XA4 A;  2WT7 B;  2XNX A;  3H1I G;  3Q3D A;  2FXO A;  2KLV A;  2KXP B;  2WWW A;  4H0L D;  1Q86 Q;  1NKN A;  2HFE D;  5CJ4 A;  2ZVO B;  4AQR D;  2M8R A;  1S4X A;  5CCG A;  3GMA A;  1SLQ A;  1M1K Q;  4WY4 D;  3AEG C;  3LW5 J;  1N86 A;  4H13 C;  2R32 A;  5AW8 B;  2KS1 B;  3AED C;  1M1J B;  3L71 E;  4DT0 A;  3CCM P;  1EDI A;  3KPE A;  4MN4 C;  3QWO C;  3OW2 O;  1J1E C;  2WTY A;  3L37 A;  1N7S D;  1OMJ A;  4OWF A;  2O1K A;  4H44 B;  1SS1 A;  2M5A A;  2N1T C;  3H1L G;  1SQV G;  1LWU A;  3A5T A;  2ZJ7 A;  2ZXX A;  1HGV A;  1NU1 D;  1KIL D;  1GMJ A;  1BGY D;  1LT1 A;  1QEX A;  1VF5 C;  2AXT H;  1FS0 E;  2E74 C;  2FYU J;  4JQ0 D;  1SQP E;  2M5A B;  1SQV E;  3CX5 H;  1LTT C;  3H25 A;  3TK1 A;  4IL6 E;  1A02 F;  2HLO A;  2ZJS E;  4IFD K;  1L0N J;  3L73 E;  2OAR A;  3P7K A;  4HJG H;  5TJH A;  1YTZ I;  3WP8 A;  1KB9 H;  4EYY Q;  2FYN C;  3GHG B;  1BCC D;  4NPF X;  3HB2 P;  2ZAE B;  1M1J A;  5AVX B;  2Q3I A;  3AE6 C;  1DD3 A;  3B4S A;  1J1D B;  2IBZ G;  4WVZ A;  2E74 B;  2K3R A;  4N78 E;  1K9M Q;  4PD4 E;  1KB9 I;  4L73 A;  5APU A;  1JY3 O;  3SSU A;  1SP4 A;  2ZT9 B;  4IFM A;  2HG5 D;  1BE3 J;  3GW6 A;  1G1I A;  1N73 C;  3CC7 P;  2Q3E A;  3ABV C;  3SWK A;  3L73 D;  3CMA P;  2OTL P;  2FFD A;  1JY3 P;  1EXI A;  2WPQ A;  3D71 A;  1FC2 C;  4PD4 H;  1IJD B;  1VQ6 P;  3T97 A;  1NWQ A;  1KQS O;  1YIJ P;  1U7M A;  1NTK D;  4HYT B;  3O8Z A;  1GO7 P;  3WU2 H;  1SVF A;  1NJI Q;  1L0N K;  1PGQ A;  1FDI A;  1PPJ E;  2JKV A;  3CWB G;  1MFZ A;  1H0T A;  1RF0 A;  2NPS D;  4CPG A;  2N9Y B;  1SQP G;  1GL2 C;  3AE7 C;  1H89 A;  3TGU G;  1SMP A;  2Y9Y A;  2E75 B;  3NMD A;  1Q7Y Q;  1P84 D;  1PP9 J;  3BRV B;  1PGO A;  2C9N Y;  2KZJ A;  1MV8 A;  4IL6 X;  5AW5 B;  2FFD C;  1JCC A;  3MHV A;  1H0T B;  3V2P A;  3CXH E;  5B5E E;  3M91 A;  1L4A B;  3L72 E;  1FU1 A;  3CCL P;  3B5N B;  1JUN A;  2QUB A;  3HE4 A;  1DEB A;  2OGU A;  3N4X A;  1E79 H;  2K9J B;  4PV1 B;  4RKU J;  1YJ9 P;  1OWA A;  3BCC D;  2AXC A;  2HOD B;  1NTZ D;  4JYC A;  5KLI C;  3MTU E;  1GZL A;  2ZT9 C;  3AEC C;  3IAO A;  3H6P A;  1RE4 A;  1RF1 A;  1FZE A;  5AVT B;  3CX5 I;  2OYI C;  2G3A A;  1SQB K;  1AA0 A;  1OXZ A;  1SQP K;  2IBZ D;  3CX5 D;  1EZV I;  1WRG A;  2B88 A;  2ZVN B;  2IYP A;  3VP9 A;  5CBO A;  1M90 Q;  5APV A;  3CXH D;  1AVO A;  3MZW B;  3S1K A;  2V4H A;  3L73 G;  2QA4 P;  2SPZ A;  2IFM A;  3V2Q A;  2E5Y A;  2FYU K;  5CCG D;  2HYN A;  3KDP B;  1AFO A;  2K1A A;  4ZKU A;  1NGM B;  3C8V A;  1ZV8 A;  1SQB J;  2J58 A;  4N6J A;  1JEK A;  2IPP A;  2QSI A;  1L0N G;  4DJG A;  1FDM A;  1NTM J;  3D6Y A;  2QJP C;  2W6B A;  2I1J A;  3PHL A;  4WWI A;  5B5E H;  3P8C E;  1CI6 B;  4M3L A;  1K7I A;  2A06 E;  2E5T A;  4DCK A;  2RH0 A;  1SQV D;  2WQY C;  1FZF A;  1GTW A;  3VN0 A;  1YQ3 C;  3AE3 C;  1LP1 B;  2BCC D;  3LAA A;  2C0X A;  1QLE D;  3H1J G;  2N1T A;  2IX7 C;  2IFN A;  2HR3 A;  2FKW B;  1YBK A;  3CCJ P;  5APX A;  3V4W A;  1IK7 A;  3H1I D;  2JJL A;  1PGP A;  3L75 G;  3S9O A;  3H1J E;  3RBX A;  5BU5 A;  2VRS A;  3GLM A;  3JSV C;  3LW5 H;  5EFW B;  3H1K E;  4EDF A;  1NHL A;  1VPC A;  4BRY B;  2WPR A;  3HD7 B;  1AJY A;  5AVS B;  2JR8 A;  1NO4 A;  3RL0 g;  1PZQ A;  3KXD A;  3L72 J;  5AW9 B;  2W83 C;  4OVN F;  2A06 D;  4R4L A;  3SWY A;  2IZ1 A;  1LGH B;  1LJ2 A;  1NTM K;  3H1H D;  1SQB G;  3HD7 A;  4U3F E;  1X9V A;  5TIS E;  4YXW H;  2H89 C;  3OAK A;  3RL0 B;  2QUA A;  1RE4 C;  1RF1 C;  2WZ7 A;  1URQ C;  3CXH H;  2FXP A;  4L74 A;  3KZI H;  2B89 A;  1FOS F;  4ZNC A;  2L91 A;  3FXE A;  2OQQ A;  4RES B;  3TDK A;  2HOD A;  3EFF K;  1JCD A;  4U3F J;  1QVF O;  1VQ4 P;  1FDO A;  2OYO A;  1CI6 A;  1JY3 N;  1KOR A;  2KYV A;  1DD4 A;  1KB9 E;  1N7S B;  1NAY A;  1Y47 A;  3IR9 A;  2BCC J;  1PPJ D;  1HJB A;  3CXH I;  1RF1 B;  2YO0 A;  5KJ7 C;  2KI7 B;  1P84 H;  1KYO E; 
#chains in the Genus database with same CATH homology
 3EQ2 A;  4DOJ A;  3TNU B;  5D7W A;  1FJK A;  2I1K A;  3MUD A;  2H8P D;  1RF0 C;  2J59 M;  1JUN A;  3L4F A;  1JY2 N;  3RK3 D;  4I35 A;  1GW4 A;  1NOH A;  4GT1 A;  1IFJ A;  4ZKP A;  1GL2 B;  1IFD A;  3OJA B;  2ZVD A;  4AUW A;  2FFD B;  3RK2 D;  3B5N D;  1RF1 B;  4HH2 A;  1ZN5 A;  3II6 A;  2Z8X A;  3RK2 B;  1RY3 A;  1JOC A;  2GM4 A;  1L4A A;  3EFG A;  1HWT C;  1G2C A;  4JYB A;  3HE4 B;  3HD7 C;  2XU6 A;  3M0A A;  1LWU C;  2KOG A;  3GHG A;  5AW3 B;  1HUC A;  2BAS A;  5AVU B;  3CLQ A;  1NTK K;  1N73 B;  2ZJ6 A;  3HE5 B;  3OA7 A;  2OYH C;  1GU4 A;  4I1L A;  1T8Z A;  1SQQ K;  2A45 G;  5CCH C;  3VOP A;  2W27 A;  3HUS B;  3CI9 A;  4EIJ A;  2Z5I A;  1JTH B;  1URQ D;  4N3Y B;  2ML2 A;  2YO1 A;  1LT9 C;  3GHG C;  3R2P A;  1JMM A;  1HGZ A;  2P2U A;  1A02 J;  2ZFC A;  3P32 A;  4LGD E;  5CCH A;  2QM7 A;  3VP8 A;  2P7J A;  3CL3 D;  1OM6 A;  1SFC A;  1W2E A;  1LT9 B;  3B8E B;  2XV5 A;  1XTG B;  4W7Y A;  2XDJ A;  3N7N A;  3HD7 D;  1FZB A;  5AW2 B;  1QL2 A;  1VDF A;  1M1J C;  2R3C A;  2LKM A;  4I2L C;  1LTI C;  3KYQ A;  1LTA C;  1FOS E;  4DZO A;  3VYI A;  3RL0 D;  1E5W A;  4WY4 B;  3SWF A;  1S9K D;  3VI1 A;  4JF7 A;  1RE3 C;  3RK2 C;  5AVZ B;  1MUU A;  5AVQ B;  2E42 A;  3U1C A;  5CVW A;  2XKM A;  3IFM A;  3MGN A;  3M9B A;  3C9I A;  3M9H A;  1CW5 A;  2P67 A;  3V2R A;  2E43 A;  5KLV K;  2NPS A;  3L35 A;  3M06 A;  1JY2 P;  1RE3 A;  2WT7 A;  2OYI B;  2O01 H;  2PAJ A;  5BU8 B;  1FZC B;  1KFN A;  3RK3 B;  1KFM A;  1JNM A;  1LTB C;  2Q5U A;  2PP6 A;  1FZC C;  2GUS A;  2A45 I;  1L4A C;  3HBU P;  1SQX K;  2Z8Z A;  2YKP A;  2R5D A;  3E1I A;  5CCG C;  1GK6 A;  3VMZ A;  2YKO A;  3MIW A;  2H7H A;  4N78 D;  4WY4 A;  1H88 A;  2W6A A;  3NXS A;  1FZA A;  1DX7 A;  1JO5 A;  2GUV A;  1G9K A;  2KB7 P;  4AYC A;  4Y99 C;  3TNU A;  2WSF H;  4C46 A;  5AVY B;  3PP5 A;  1FZC A;  2H43 A;  1SFC B;  1N7S A;  4LC1 A;  5CMZ A;  2NPS B;  4W80 A;  1AQ5 A;  1LT9 A;  2HPC A;  1LTG C;  3MD0 A;  1KIL A;  5AVW B;  1FJP A;  1NKZ B;  1K7G A;  1LTJ B;  3M9Q A;  1KZU B;  4B86 A;  2YO2 A;  2POH A;  4WBA A;  5AW7 B;  2JEE A;  1HBW A;  1X79 B;  2NPS C;  5AW0 B;  2Q7C A;  1Z56 A;  2KP8 A;  1WT6 A;  5CHX A;  2YO3 A;  4GKG A;  1JTH A;  1QL1 A;  2CPB A;  1YTZ T;  1EQ7 A;  3VTP C;  3A3Y B;  3WMM 0;  5AW4 B;  3ULT A;  3UIA A;  3V5B A;  3HE5 A;  1N73 A;  5KJ7 D;  1SAT A;  3M0D A;  4C7N A;  3S6L A;  5APT A;  3A70 A;  1H8A A;  5APY A;  3V2N A;  1HH0 A;  5CCH D;  3U59 A;  1SFC D;  4EOT A;  3P8M C;  2M3B A;  5BVZ A;  1DH3 A;  1IFM A;  1GL2 A;  1LTJ C;  1H71 P;  2XZR A;  1XTC C;  1OM8 A;  2C9L Y;  4O9B A;  5KJ7 A;  1GK4 A;  2N9B A;  1K7Q A;  3TYY A;  3HUS A;  1K7I A;  1NH4 A;  1ZR4 A;  1T3U A;  1X8Y A;  1IC2 A;  3HRN A;  2Z4E A;  2KSJ A;  1IO4 A;  1IK9 A;  2YMY A;  3HTK B;  2N1T D;  3RL0 C;  5CXL A;  3H32 B;  2MJZ A;  3NFQ A;  4KHX A;  1J2J B;  1M7L A;  4IFF A;  1CZQ A;  1SRP A;  3B5N A;  4OH8 B;  5AW1 B;  1G2C B;  1G1J A;  1YYC A;  4LLH A;  1T2K C;  4Y99 B;  3A6Z A;  2O1J A;  2OYH A;  1T3J A;  4W7Z A;  2AGM A;  2XQH A;  1GO8 P;  3NTN A;  3RK3 C;  4I6M C;  1GW3 A;  3BAS A;  3H32 A;  2ZXE B;  3HTK A;  1LTS C;  1J1D C;  2FYZ A;  2Z5H A;  3L36 A;  5AVV B;  2A45 H;  1N7S C;  1IFI A;  1OM7 A;  3I5C A;  2R5B A;  1URQ B;  1FBM A;  3U1R A;  1GD2 E;  1L0L K;  1LTJ A;  5CJ0 A;  1IFN A;  1KIL C;  1NU1 K;  3HBV P;  3TSI A;  3HUS C;  1S9K E;  1FAV A;  1N2D C;  2Q9I A;  1J1E B;  1AKL A;  2N1T B;  2WSE H;  4C7R A;  2YNY A;  4C7N B;  3LID A;  1O0T A;  4GIF A;  1O0Q A;  3KQG A;  1N7L A;  1NAF A;  5APW A;  1NTZ K;  3V4Q A;  2C0W A;  1HVV A;  1URQ A;  1HTL C;  1CSB A;  1PFI A;  1SFC C;  1LWU B;  3U1A A;  1FZG A;  3M0D C;  3A7O A;  3G3Z A;  3LA9 A;  3A2A A;  5AW6 B;  2HPC B;  3VMX A;  1P9H A;  2L5G B;  1KIL B;  4XE5 B;  2OYH B;  1L4A D;  1SQV K;  4WB4 A;  2WSC H;  2FXM A;  2WPS A;  3HDA P;  1GU5 A;  1AF0 A;  5APS A;  5KTB A;  3VMY A;  2QM8 A;  1MZ9 A;  2P1J A;  1JY2 O;  1GL2 D;  3P8C D;  1JIW P;  1GDT A;  3BAT A;  1ZLL A;  3LIE A;  5AVR B;  3B5N C;  3BVH A;  1T2K D;  3BRT B;  1KAP P;  1KQL A;  5APQ A;  2CPS A;  2YKQ A;  2WIT A;  4WY4 C;  4XA4 A;  2WT7 B;  2XNX A;  2OYI A;  2KLV A;  2WWW A;  1NKN A;  2HFE D;  5CJ4 A;  4AQR D;  2M8R A;  5CCG A;  1SLQ A;  4WY4 D;  1N86 A;  2R32 A;  5AW8 B;  1M1J B;  1OMJ A;  3KPE A;  1J1E C;  2WTY A;  3L37 A;  1N7S D;  2O1K A;  2N1T C;  1LWU A;  3A5T A;  2ZJ7 A;  1HGV A;  1KIL D;  1LTT C;  3TK1 A;  1A02 F;  2HLO A;  4IFD K;  3P7K A;  2OAR A;  3WP8 A;  1YTZ I;  3GHG B;  3HB2 P;  5AVX B;  1M1J A;  2Q3I A;  1J1D B;  4N78 E;  5APU A;  1JY3 O;  1SP4 A;  4IFM A;  2HG5 D;  1G1I A;  1N73 C;  2FFD A;  1JY3 P;  2WPQ A;  1IJD B;  3T97 A;  1NWQ A;  4HYT B;  3O8Z A;  1GO7 P;  1SVF A;  1L0N K;  1MFZ A;  1RF0 A;  2NPS D;  1GL2 C;  1H89 A;  1SMP A;  3NMD A;  3BRV B;  2C9N Y;  1MV8 A;  5AW5 B;  2FFD C;  1JCC A;  3V2P A;  3M91 A;  1L4A B;  1FU1 A;  3B5N B;  2QUB A;  3HE4 A;  1DEB A;  3N4X A;  1OWA A;  2HOD B;  4JYC A;  3MTU E;  1GZL A;  3H6P A;  1RE4 A;  1RF1 A;  1FZE A;  5AVT B;  2OYI C;  1SQB K;  1OXZ A;  1SQP K;  1WRG A;  3VP9 A;  5APV A;  2IFM A;  3V2Q A;  2FYU K;  5CCG D;  2HYN A;  3KDP B;  1AFO A;  4ZKU A;  1ZV8 A;  2J58 A;  4N6J A;  1FDM A;  2IPP A;  2W6B A;  2I1J A;  3P8C E;  1CI6 B;  4M3L A;  1FZF A;  1GTW A;  3VN0 A;  3LAA A;  2C0X A;  2N1T A;  2IX7 C;  2IFN A;  2FKW B;  5APX A;  3V4W A;  2JJL A;  5BU5 A;  2VRS A;  3LW5 H;  1NHL A;  1VPC A;  2WPR A;  3HD7 B;  5AVS B;  1NO4 A;  5AW9 B;  3SWY A;  1LGH B;  1NTM K;  1ZR2 A;  3HD7 A;  1X9V A;  3OAK A;  3RL0 B;  2QUA A;  1RE4 C;  1RF1 C;  2WZ7 A;  1URQ C;  1FOS F;  4RES B;  2HOD A;  1JCD A;  1CI6 A;  1JY3 N;  2KYV A;  1N7S B;  3IR9 A;  1HJB A;  2YO0 A;  5KJ7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...