3NTNA

Crystal structure of uspa1 head and neck domain from moraxella catarrhalis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
211
Chain Sequence
b'ENSTVGGGGYNQAKGRNSTVAGGYNNEATGTDSTIAGGRKNQATGKGSFAAGIDNKANADNAVALGNKNTIEGENSVAIGSNNTVKKGQQNVFILGSNTDTTNAQNGSVLLGHNTAGKAATIVNSAEVGGLSLTGFAGASNGTVSVGKKGKERQIVHVGAGEISDTSTDAVNGSQLHALATVVAQNKADIKDLDDEVGLLGEEINKHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UspA1
publication title Correlation of in situ mechanosensitive responses of the Moraxella catarrhalis adhesin UspA1 with fibronectin and receptor CEACAM1 binding.
pubmed doi rcsb
source organism Moraxella catarrhalis
molecule tags Membrane protein
total genus 71
structure length 211
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
A PF18792 UspA1_rep Ubiquitous surface protein adhesin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ntnA02
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3ntnA01
3P8MC 5AVSB 3VYIA 1A02F 3OAKA 1S9KE 5AVRB 3M9HA 1OWAA 3HE4B 3HDAP 2ZFCA 1G2CB 3M0DA 2P7JA 4EOTA 5APTA 3HB2P 2WPRA 5AVUB 3HE4A 2C9LY 1GO8P 3A7OA 1K7IA 2WPQA 3P32A 1KQLA 1A02J 2QM7A 5APUA 2E42A 4B86A 2Z8XA 2N9BA 3NMDA 5APWA 5AW0B 1NWQA 1S9KD 2AGMA 2H7HA 2Z8ZA 3A70A 2XV5A 2R5DA 5AVWB 4AQRD 1HJBA 2YNYA 1H89A 3A2AA 4GKGA 5AW4B 2R3CA 1KAPP 1O0QA 4I2LC 1CZQA 1GU5A 1JNMA 2YO1A 2WT7A 3L36A 2R32A 4LC1A 1GU4A 5CMZA 3M06A 3B8EB 1JUNA 3VMYA 1GK4A 1AF0A 1K7GA 2WWWA 3M0AA 5APYA 1T2KC 5AW5B 3KQGA 3U1RA 3TK1A 3HBUP 5AVZB 5AVYB 3WP8A 5AVTB 1HWTC 2P2UA 2BASA 2WTYA 3TNUB 3MGNA 2VRSA 1SLQA 2E43A 1SMPA 1SP4A 2KP8A 4JYBA 1MUUA 3HBVP 3A5TA 1OM7A 2P67A 4GT1A 3MD0A 1IO4A 1H71P 2ZVDA 5AVVB 4I35A 3I5CA 2QUAA 2YO2A 3SWFA 1H8AA 4JYCA 3TYYA 5AW9B 1OXZA 2R5BA 4C7NB 2ZXEB 3M91A 5AW2B 3VTPC 1DH3A 1GD2E 1SRPA 1GO7P 3HE5B 3HTKA 3NFQA 3UIAA 2Q7CA 1T2KD 4C7NA 3V5BA 2XQHA 5D7WA 2Z5IA 1O0TA 5AW7B 4KHXA 1OM8A 1H88A 2WPSA 3M9BA 1G9KA 5CVWA 3LIEA 5APSA 4AUWA 3LA9A 1CSBA 1CI6B 1FAVA 3VN0A 4I6MC 5AVXB 3T97A 5AVQB 3V4WA 1NAFA 1OM6A 3KDPB 2W6AA 3TNUA 1OMJA 2JJLA 1YYCA 2ZJ6A 5APQA 4XE5B 2Q5UA 3ULTA 3O8ZA 1X8YA 3NXSA 5AW1B 3LAAA 4M3LA 1SATA 1GTWA 1GK6A 3P7KA 2Q3IA 3LIDA 1J2JB 4HYTB 5APVA 4RESB 4DZOA 2YO0A 1FOSE 2ML2A 3HE5A 3NTNA 3S6LA 1K7QA 5APXA 1JIWP 3L35A 2XZRA 5AW8B 3VMXA 4C46A 2ZJ7A 1MFZA 2Z5HA 5AW6B 1HUCA 2YO3A 1MV8A 2IPPA 2XU6A 2W27A 1AKLA 3IR9A 1FOSF 1HBWA 1P9HA 3VMZA 2C9NY 2QM8A 5CXLA 2QUBA 3A3YB 5AW3B 3VI1A 1CI6A 2WT7B 3L37A 3V4QA 4AYCA 1GZLA 3A6ZA
chains in the Genus database with same CATH superfamily
3SFDC 2K9JB 3L75E 1S9KE 3MIWA 3P8CD 2MJZA 3O6QA 3U1CA 2K37A 1JMBA 1OVVA 2L5GB 3R4YA 1ZR2A 2HG5D 4I2LC 2JEEA 1JY3P 4UB8H 2HODA 2PP6A 2QJKB 3AEEC 4W7ZA 1L0LK 1FZCC 1FZCA 1YJNP 3IAOA 1VQ8P 2MKVA 2E74B 2E43A 1BGYJ 3RK3D 3WU2H 2YO2A 2ZJSE 1DH3A 2M5AA 2B89A 2IBZE 3HTKA 4RKUJ 1O0TA 3WUUA 4PV1D 2O1JA 3RK2C 1P84D 2QRXA 2JWDA 1L0LG 3B4SA 3FX0A 4RO0A 2JJLA 3S4RA 2ZJ6A 1IK9A 1FJPA 1URQB 3L71G 1K73Q 4I7ZC 2HR3A 2ZVOB 2YO0A 3CX5H 1QL2A 3TGUE 1PP9E 1LP1A 4U3FG 1VQ5P 3VI1A 2WT7B 4WVZA 1GZLA 1L0LD 1RY3A 2IFNA 1FJKA 2Q9IA 1KQGB 1FDOA 1G2CB 2FFDC 2FKWB 2WSEJ 5AVUB 2FFDA 5KAFH 1GDTA 4KJMA 1SFCD 2PGDA 4U3FD 2AGMA 2HLOA 1HJBA 3FXEA 2IFMA 4BRYA 2KSEA 4U7JA 3OW2O 3KQGA 3KZIE 3CL3D 3BRTB 4HH2A 3MGNA 1RQUA 4PD4H 4JYBA 2LR2A 4NPDA 5B66H 4I35A 2QUAA 1PPJG 2V7QJ 2ZXEB 1T2KD 1FC2C 1KYOH 4I1LA 1G9KA 1GW3A 3AE4C 4NPFX 3CC7P 3GW6A 1BCCG 4RJTA 3V4WA 3TNUA 4H13D 1SQPD 3H1LE 1YQ3C 1J1DC 3LAAA 3SSUA 3EQ2A 3CXHD 1K7QA 3A0BH 1HUCA 1MV8A 4IL6H 4N78D 4N3YB 1BCCD 1YTZT 3A6ZA 1X0TA 2RN0A 1EZVI 3AE5C 4ASWA 2OTKE 4U3FJ 3O6QB 1KN7A 4EIJA 1OVUA 2ZFCA 1PL5A 2B88A 1T6AA 2JWAA 2N9YB 3CX5I 1KILC 4WWIA 2LKMA 4TT3H 3H1JG 3H25A 1ZXGA 1KILA 1LTGC 3VP9A 4BXLA 1VQ9P 2QE7H 2OGUA 2H88C 3RL0D 1KMIZ 4WY4D 2KLUA 1FZCB 5APYA 3M0AA 1EDIA 3TK1A 2Y0EA 2FXPA 2C0XA 2AXTH 3Q5SA 1MUUA 3L75D 1BGYE 3H1JD 1H71P 2FYNC 2OYIC 4ZMDA 2SPZA 3TYYA 2OYIA 4IFMA 4TLFA 3UIAA 1NTZE 1PGQA 3PHLA 2XQHA 3SWKA 5GTHH 1YHQP 1SQPJ 4OGQC 3EFGA 3S1KA 3V2RA 4EDFA 1QL1A 5E79E 5AVXB 2A45G 3BCCG 3H1HJ 4PD4I 2KNCB 3WUVA 4K35A 3AE8C 4DZOA 1BCCJ 4HYTB 1WRGA 3HE5A 5BVZA 3G3ZA 2KYVA 3TSIA 2W8ZA 1KYOI 1HVVA 4GODA 1FOSF 1DIPA 1M7LA 1IFDA 1N7SB 2LXCB 3V2PA 1ZN5A 1L4AC 1ZV8A 2NPSD 3CC4P 1LGHB 2KB7P 1RH5B 1NTMK 1FZAA 4B86A 2R44A 1SQVK 3KYQA 1H89A 4BRYB 1VQ6P 3L75J 1J1EB 1R8EA 3H1JJ 2K9JA 3RK3E 1JUNA 4OVNF 2E75B 3GG2A 2P2UA 2VRSA 4LLHA 1JY2P 3GF7A 4GT1A 3VP8A 3FGAD 2OARA 1NTMG 4JPZB 3NFQA 2Q7CA 1VQMP 1RF0C 1SQVG 1H88A 1M56D 2QJKC 1OIPA 3H32B 2J59M 1JOCA 1LTTC 1FE6A 2E74C 3CLQA 3GLMA 4OWFA 1NH4A 1JCDA 3CCVP 3LIDA 5B5EE 3CCJP 1NTMD 3QH9A 3RK2D 4Z1MH 1YITP 1L0LE 1SQVD 1AKLA 1P9HA 1TU3F 4AYCA 3P8MC 1S5LX 1URQC 4U3FE 5AVRB 3M0DC 1URQA 2ZYGA 1OWAA 1NKNA 1AJYA 3M0DA 1MFTA 3L73G 3IF4A 2WSFJ 3H1LD 2OQQA 4GIFA 5CCGD 1SQBK 2IDBA 2WT7A 3CWBG 3M06A 2M3BA 1LNQA 2HPCB 1DD3A 1RE4C 1L0NK 1HWTC 1G2CA 1RE4A 3L73D 2GM4A 3AECC 3MD0A 4KT0J 3V6IA 5TISE 2P58A 3B5NA 2Z5IA 1S5LE 3CWBD 3KZIH 1FDIA 1VQKP 1SQBG 4LGDE 1PPJE 2A06G 2XDJA 1NTMJ 1NAFA 3CXHE 4BWNA 1SQVJ 1L0NG 1X8YA 1SATA 1AA0A 4N78E 1BCCE 1BDCA 3E7KA 5APXA 3AE2C 2ZJ7A 2AEFA 3A0HH 1Q81Q 2Q6QA 2KZIA 1SQBD 3A3YB 3BASA 2A06D 3AE1C 1AVYA 3PTZA 3H1LJ 1BDDA 3KPEA 1L0ND 1SS1A 1DEBA 1ZLLA 2IX7C 5DJTB 3PLNA 3IN6A 3A7OA 1RHZB 1A02J 1EQ7A 1KAPP 2WSCJ 5AW4B 1OW8A 2XNXA 3L73J 3Q1MA 5CMZA 2N1TC 3B8EB 2N1TA 3H1JE 1KILD 3U1RA 3HBUP 1JY3N 2YXRB 4ZKPA 2KP8A 1YBKA 3CWBJ 3A5TA 3SWFA 2FYUK 1Q82Q 1OXZA 2R5BA 1GD2E 2XNDH 1AQ5A 1IFIA 2ZT9B 2K3RA 3TF5A 3LIEA 1LTBC 1QLED 1VPCA 3VN0A 1HTLC 1OZHA 2Y9YA 4YTPC 1SQXK 1W5CE 2YXQB 5APQA 1XTCC 2WMMA 1SQBJ 1NTZJ 4OGQD 3U59A 5H2FE 2IZ1A 2FYUG 3BCCE 1DEEG 1L0NJ 2XU6A 4WB4A 1SQQK 2KI7B 4H44B 1HBWA 3VMZA 1YTZI 5CXLA 2QJPB 5KLIB 1DX7A 1NU1K 3G9RA 3VYIA 3L72G 3MP7B 2KNCA 1SQXG 1N2DC 2O01J 1FZBA 3JCUE 1KV4A 2UWJE 2E42A 2FYUD 3CD6P 1K05A 1IFMA 5KKZB 1PGOA 3VMAA 3CCEP 2YNYA 3D71A 3L74G 3F5HA 1L4AD 1N7SC 1N7SA 1SQQG 2QVAA 3WUTA 1KQSO 1GK4A 3L71D 1NU1G 1BSNA 3USSA 2WSEH 3GHGB 3L72D 1E5WA 2D2CB 1SVFA 4YXWH 1SQXD 2QA4P 1GL2C 2V4HA 3BRVB 1GL2A 1JB0J 5AVVB 2JO1A 3B5NB 1X9VA 1QEXA 3L74D 3GF3A 3Q5PA 5CBNA 1J1EC 1SQQD 1YQ4C 1JCCA 2H89C 4PJ0H 1NU1D 2E75C 4DOJA 3PH0A 1ZRTE 1NTME 1YYCA 2V7QH 1SQVE 1P84H 1K8AQ 5CCHC 4M3LA 2K9YA 2KZJA 1RQVA 4RESB 5CCHA 1LT1A 3MTUE 2E74D 2GUSA 3H32A 4L74A 1USEA 2L91A 2FYUJ 2QSIA 2Q1KA 5CHXA 5GTIH 1PPJD 1S2EA 1L0LJ 3AEAC 1IZNB 1KQLA 3L71J 3BATA 2WQYC 1BSHA 2R5DA 3L72J 3A2AA 1URQD 3KHUA 3L73E 2N1TB 2DW3A 3SFEC 1R5SA 4DCKA 4W80A 1T3UA 3VMYA 1JY3O 2K88A 5KAIH 3T97B 3D6YA 3L74J 3MHVA 3RGUA 4H0LC 1SQQJ 3CWBE 1JO5A 4GDOA 1NU1J 2W6JH 1VF5B 2YKOA 4C7NA 5D7WA 4L76A 1YIJP 2BEQD 4Y28J 5CVWA 4UB6H 4Y99B 1CSBA 4K3AA 3C9IA 2HPCA 1Y8AA 1U7JA 2PFXA 4UB8E 1OVRA 5KJ7C 1SQBE 3AEBC 2A06E 5KJ7A 2ML2A 1N8RQ 3H1IG 5KTBA 3CMAP 1S72P 1L0NE 5EFWB 2PAJA 3CI9A 3CXHH 1N86A 4HJGH 1Q86Q 3WU2E 3WMM0 1FU1A 1JMMA 1KB9D 2G3AA 3OAKA 1P84I 5TJHA 2C9LY 2H43A 4PV1C 3AEGC 2KSJA 1LTSC 1U57A 3H1ID 1KILE 3SWYA 1BE3G 2ZAEB 1JNMA 3BCCD 2R32A 4LC1A 1U7MA 1W2EA 3C8VA 3CX5E 3WP8A 4L73A 1GL2B 2O1KA 1SP4A 1QGKB 1IO4A 2POHA 5AW9B 2IYOA 1N73A 1Y47A 3S9OA 1JY2N 2E76B 1CW5A 3FXDA 3W67A 3V2QA 5KAFE 2FYZA 1PGJA 3B71A 3G4SP 1FDMA 1FBMA 1D7MA 3E1RA 3AE9C 2HFED 1GK6A 2ZT9C 4HKZH 1OFCX 4IFFA 1KQFB 3S6LA 3RL0g 3VMXA 4C46A 2YMYA 2YO3A 1S3JA 1VQ4P 2G8YA 3V4QA 4IOIH 3IFMA 2FYUE 3H1IJ 2KOGA 3R2PA 1KYOE 2IZ0A 1ZRTD 2KLVA 1QVFO 3BCCJ 3HB2P 2WPRA 1K7IA 3EWKA 2WPQA 4D6TG 5APUA 4OH8B 1FS0E 3L71E 4H44C 3HD7B 3L72E 3CCQP 5KLIC 2QJPC 2E5YA 1EDKA 3CXHI 1NHLA 1GU5A 1SQXE 3I55P 1W2BO 3V2NA 3CCLP 3JCUH 3LW5J 2WSFH 1VDFA 5AVZB 3L74E 1LTIC 4H0LB 1N7SD 3HBVP 3W68A 1SQQE 5KKZC 3I5CA 2I1JA 2JKVA 2OYOA 4C7NB 5AW2B 3M91A 1NU1E 2QIWA 2K1AA 1QX8A 1NO4A 1YJ9P 2M0BA 4ZKUA 3GHGC 2D2CC 1LTAC 4I6MC 3GHGA 5AVQB 2KUBA 4XE5B 1RE3C 3B5NC 4N6JA 3BVHA 1RE3A 2W90A 3F89A 3G6EP 1LT9B 3MUDA 2E75D 2XZRA 1X79B 4WY4A 5KLVK 2Q3EA 1WT6A 2QM8A 3GMAA 1VQOP 2ZYDA 5CCHD 3RK3B 1XTGB 5AVSB 2WPVB 1A02F 1HH0A 5CJ0A 2YKQA 4R4MA 3JC22 1HGZA 2P7JA 4PV1B 1M57D 4ASVA 2Z8XA 1IC2A 2QJYB 2H7HA 2Z8ZA 3C1LA 5AVWB 3HRNA 5KLVG 1NYHA 1KTMA 1EZVG 3PP5A 1AF0A 1IK7A 2IBZI 1Y9BA 1MZ9A 1LWUB 3Q3DA 2KXPB 1PFIA 2FBWC 1ZOYC 2WSCH 1N73B 2BEZF 1JY2O 2FXOA 3CCMP 5KLVD 3V5BA 2NZ2A 2FY8A 3EFFK 2WPSA 1EZVD 1AQTA 3MZWB 3L70G 1KC8Q 3CC2P 3T97A 4CPGA 3N7NA 1SFCB 1OX3A 3CX5D 4YPCA 3NXSA 4XFJA 1VF5C 2B87A 1FOSE 2ZXXA 1NTKK 3L35A 5AW6B 1KB9E 1JTHB 4Y99C 2IPPA 3IR9A 3L70D 5AW3B 3O8ZA 5KJ7D 1EXIA 4JBZA 2H8PD 4HB1A 3H1IE 4EYYQ 3AE3C 2PRRA 5E79H 2OYHB 5APWA 5AW0B 2YIUB 2XV5A 1NTKG 4GKGA 1O0QA 1KFNA 1PIXA 2R3SA 4H13B 2YO1A 1KZUB 1GU4A 2W83C 1ZW0A 4PD4D 1NVOA 1USDA 2M3EA 5DJUB 1IFPA 2O01H 4GOFA 5KLVJ 1BE3E 3HUSB 1PZQA 2P10A 1KYOD 4JYCA 4DJGA 1NTKD 2O3JA 5AW7B 1X22A 4KHXA 3AEDC 3LA9A 3ZDMA 1PGPA 1CI6B 3RBXA 1Q7YQ 4NPEA 4O9BA 4JF7A 2W6AA 1OMJA 2RKLA 2E5TA 2Q5UA 3L70J 1M1JC 3H1KG 1SQPK 5CCGC 2Q3IA 3RL0B 4WY4B 1M1JA 5CCGA 2E76C 1EC5A 1LTJB 4EI2A 2FXMA 1VQNP 2JR8A 2ZYAA 3QWOC 1VQ7P 3AE7C 1NKZB 1NJIQ 2ZT9D 1G1JA 1KFMA 1OW7A 3M9HA 3OJAB 2GUVA 3H1KD 1YJWP 5APTA 3CMEP 3P32A 2IYPA 1SQPG 5BU5A 1NWQA 2CPBA 3A70A 1MKMA 4AQRD 2Y9ZA 2Y0DA 2OTJP 3H1HG 5B5EH 2KS1B 5BU8B 4D6TE 1NTKJ 5AVTB 4H44D 2WTYA 3A0HE 1Z56A 3FWNA 2P67A 2ZVDA 2KIKA 3HD7C 2QEXP 1SQXJ 2KK7A 3HD7A 1RF1B 4W7YA 2CK3H 1KORA 3N4XA 3H1HD 2NPSB 2LXBA 5APSA 4AUWA 1H0TA 2J58A 1FAVA 1QVGO 2BCCG 1JM0A 1G1IA 2CPSA 2B87B 1OMIA 1GTWA 2RH0A 5APVA 1LJ2A 1E79H 1NOHA 2D2CD 1EDLA 2ITAA 3L75G 2Z5HA 1YI2P 1AV1A 1N7LA 3H1KJ 3B5ND 1VQLP 2HODB 3L37A 2BCCD 5TISH 2O01N 2I1KA 1FZEA 2I8DA 5M1BA 1S5LH 2NRGA 1IFNA 1HF9A 1LT9C 3HE4A 1LT9A 5K5GB 2N9BA 3NMDA 1AFOA 2M5AB 1S9KD 3HTKB 2R3CA 3M9QA 1T3JA 1CZQA 1K04A 1Q90D 3RK3C 2WITA 1VQPP 1L2PA 5L8RJ 2QG4A 1FZFA 1WMKA 1NAYA 2WWWA 2IBZG 3RK2B 1ZP0C 5KLVE 1M1KQ 1HJ0A 2QJYC 1EZVE 1UIXA 1OM7A 3CPWO 3Q2YA 4I7ZB 3JSVC 3VTPC 1T8ZA 3OA7A 3TDKA 3KXDA 1LP1B 3ABVC 2HYNA 3E1IA 2IBZD 3TGUG 2OTLP 3P8CE 1PP9G 1LWUC 1LWUA 2N1TD 1N73C 3ULTA 1M1JB 4GOEA 3L70E 1BE3D 1L4AA 2FFDB 2BCCJ 3NTNA 1JIWP 5AW8B 4A7PA 2QUBA 3TGUD 2AEMA 1R5LA 1SFCC 1PP9D 1VF5D 1SFCA 3RBZA 3HDAP 2Z4EA 3G71P 2ZVNB 4EOTA 1KB9H 5CJ4A 3PJSK 4DT0A 4IL6X 2XKMA 4PJ0E 4XA4A 2W6BA 2QM7A 4L75A 2RMZA 4PD4E 2YMKA 1JTHA 1UIIA 5B66E 1P84E 3D6ZA 1RF0A 1K7GA 5H2FH 2A45H 1ZR4A 1T2KC 5AW5B 1NTKE 2JDIH 3TNUB 2JP3A 2OYHC 2C0WA 2OYHA 2YIUC 1H8AA 1EXJA 1JEKA 2AXCA 1J1DB 4H13C 5GTIE 1H0TB 1OM8A 1OW6A 1K9MQ 3H1LG 3LW5H 3A0BE 1BE3J 3K5BA 3II6A 2M8RA 1OM6A 3KDPB 4IL6E 3HUSC 1AVOA 4D6TD 2AEJA 3HUSA 1S1CX 4WBAA 1PV3A 1J2JB 3TGUJ 1FZGA 1PP9J 1KILB 5KAIE 1GL2D 1MFZA 1DD4A 2W27A 1M8OB 2C9NY 1CI6A 3H1KE 2P1JA 2WSSH 1IFJA 1NTZK 3FWLA 1ZMEC 1Q2NA 2E76D 3AE6C 3HE4B 3MUDC 3RL0C 2B9BA 3CCRP 4WY4C 4UB6E 1GO8P 2YKPA 1LTJC 1KD1Q 1LTJA 1M90Q 2AXTE 2FYNB 2OYIB 3Q5RA 3L36A 1BGYG 3ITKA 2J5UA 4OGQB 5GTHE 1SQPE 1S4XA 1NTZG 5AVYB 3D70A 2BASA 1SMPA 1SLQA 2GA1A 1KB9I 4JQ0D 3H1HE 3L4FA 1GW4A 1SRPA 1GO7P 3HE5B 3H6PA 3I56P 4D6TJ 3M9BA 1BGYD 1VL2A 4ZNCA 3CCUP 2KS1A 4C7RA 3AEFC 2A45I 1HGVA 2WZ7A 1NTZD 3VOPA 3HD7D 5C39A 4YXDC 1L4AB 4DT5A 5AW1B 3P7KA 2WVRA 1RF1C 3CCSP 4QMAA 2BCCE 1RF1A 3U1AA 2NPSC 4MN4C 1EDJA 4H0LD 4R4LA 5CBOA 1NGMB 2NPSA 3PRJA 2Y0CA 1IJDB 1GMJA 4IFDK
chains in the Genus database with same CATH topology
3P8MC 1NKZB 1G1JA 1URQC 3OAKA 1S9KE 1KFMA 5AVRB 3M0DC 3M9HA 1URQA 1OWAA 3MIWA 3OJAB 3P8CD 1NKNA 2MJZA 3M0DA 2GUVA 3U1CA 5APTA 2C9LY 2H43A 3P32A 2KSJA 2L5GB 1LTSC 5BU5A 1NWQA 2CPBA 3A70A 3SWYA 4AQRD 1ZR2A 2HG5D 4I2LC 2JEEA 4GIFA 1JNMA 5CCGD 1JY3P 1SQBK 2WT7A 2HODA 2R32A 4LC1A 3M06A 2PP6A 2M3BA 5BU8B 1W2EA 4W7ZA 1L0LK 1FZCC 2HPCB 1FZCA 1RE4C 3WP8A 1L0NK 5AVTB 1HWTC 2WTYA 1G2CA 1GL2B 1RE4A 2O1KA 2E43A 1SP4A 2GM4A 1Z56A 2P67A 1IO4A 3MD0A 3RK3D 2ZVDA 2POHA 2YO2A 3HD7C 1DH3A 5AW9B 3HD7A 1N73A 3HTKA 1RF1B 3B5NA 4W7YA 1JY2N 2Z5IA 1O0TA 1CW5A 3N4XA 2NPSB 2O1JA 5APSA 4AUWA 2J58A 3V2QA 1FAVA 4LGDE 3RK2C 2XDJA 2FYZA 1NAFA 2JJLA 2ZJ6A 1G1IA 2CPSA 1IK9A 1FDMA 1FJPA 1URQB 1FBMA 1X8YA 2HFED 1SATA 1GTWA 1GK6A 4N78E 2YO0A 5APVA 1QL2A 4IFFA 1NOHA 3S6LA 5APXA 3VMXA 4C46A 2ZJ7A 2Z5HA 2YMYA 2YO3A 3A3YB 3BASA 3VI1A 1N7LA 2WT7B 3B5ND 2HODB 3L37A 3V4QA 1GZLA 1RY3A 2IFNA 3IFMA 3KPEA 1FJKA 2I1KA 2KOGA 3R2PA 2Q9IA 1FZEA 1DEBA 1ZLLA 1G2CB 1IFNA 2FFDC 2KLVA 2IX7C 2FKWB 3HB2P 1LT9C 2WPRA 3HE4A 5AVUB 2FFDA 3A7OA 1K7IA 1GDTA 2WPQA 1LT9A 1A02J 5APUA 2N9BA 1SFCD 3NMDA 4OH8B 1AFOA 1S9KD 2AGMA 2HLOA 1EQ7A 3HD7B 3HTKB 1HJBA 1KAPP 2IFMA 2R3CA 5AW4B 3M9QA 1T3JA 2XNXA 1CZQA 1NHLA 1GU5A 3RK3C 2WITA 5CMZA 2N1TC 1FZFA 3B8EB 2N1TA 1KILD 3V2NA 2WWWA 3U1RA 3KQGA 2WSFH 1VDFA 5AVZB 3HBUP 3RK2B 1JY3N 3CL3D 1LTIC 3BRTB 3MGNA 4HH2A 4ZKPA 2KP8A 4JYBA 1N7SD 3HBVP 3A5TA 1OM7A 4I35A 3I5CA 2I1JA 2QUAA 3SWFA 2FYUK 4C7NB 1OXZA 2R5BA 2ZXEB 3M91A 5AW2B 3VTPC 1GD2E 1AQ5A 1IFIA 1T8ZA 3OA7A 1T2KD 4I1LA 1G9KA 3LIEA 1LTBC 1GW3A 1NO4A 2HYNA 3E1IA 4ZKUA 3GHGC 1VPCA 3VN0A 1HTLC 1LTAC 4I6MC 3GHGA 3P8CE 5AVQB 3V4WA 1LWUC 3TNUA 1SQXK 1LWUA 5APQA 1XTCC 2N1TD 4XE5B 1N73C 1RE3C 3ULTA 3B5NC 4N6JA 1J1DC 1M1JB 3BVHA 1RE3A 3LAAA 3U59A 1L4AA 2FFDB 3EQ2A 1LT9B 3NTNA 3MUDA 1K7QA 1JIWP 5AW8B 2XZRA 1X79B 4WY4A 5KLVK 1HUCA 1MV8A 2XU6A 4WB4A 1SQQK 1HBWA 3VMZA 1WT6A 1YTZI 2QM8A 4N78D 2QUBA 5CXLA 4N3YB 1DX7A 1YTZT 5CCHD 1SFCC 1NU1K 3RK3B 3A6ZA 1XTGB 5AVSB 3VYIA 1A02F 1SFCA 1HH0A 5CJ0A 2YKQA 4EIJA 3HDAP 2Z4EA 2ZFCA 1N2DC 1HGZA 2P7JA 4EOTA 1FZBA 5CJ4A 1KILC 2XKMA 4XA4A 2LKMA 2W6BA 2Z8XA 1IC2A 2QM7A 2E42A 1KILA 1LTGC 3VP9A 1IFMA 2H7HA 2Z8ZA 1JTHA 5AVWB 3HRNA 2YNYA 1L4AD 1N7SC 1N7SA 3RL0D 3PP5A 4WY4D 1FZCB 1RF0A 1GK4A 1AF0A 1K7GA 2A45H 1ZR4A 5APYA 3M0AA 1T2KC 2WSEH 3GHGB 5AW5B 1E5WA 3TK1A 1SVFA 1MZ9A 3TNUB 2C0XA 1GL2C 1LWUB 1MUUA 2OYHC 3BRVB 4IFDK 1PFIA 1GL2A 2C0WA 1H71P 2OYHA 5AVVB 2WSCH 1N73B 3B5NB 1H8AA 2OYIC 3TYYA 1X9VA 1J1DB 1JY2O 2OYIA 4IFMA 3UIAA 3V5BA 2XQHA 1OM8A 2WPSA 1J1EC 3LW5H 3EFGA 1JCCA 3V2RA 1QL1A 5AVXB 4DOJA 3II6A 2A45G 3T97A 2M8RA 3N7NA 1OM6A 3KDPB 1SFCB 3HUSC 1YYCA 3HUSA 4WBAA 3NXSA 5CCHC 4M3LA 4DZOA 1J2JB 4HYTB 4RESB 5CCHA 1WRGA 1FZGA 1FOSE 3HE5A 3MTUE 5BVZA 3G3ZA 2KYVA 3TSIA 1NTKK 1KILB 3L35A 1GL2D 1MFZA 5AW6B 1JTHB 2GUSA 4Y99C 1HVVA 2IPPA 2W27A 3H32A 3IR9A 1FOSF 2C9NY 1M7LA 5AW3B 1IFDA 1CI6A 1N7SB 2P1JA 3O8ZA 5KJ7D 1IFJA 3V2PA 1NTZK 2H8PD 1ZN5A 5CHXA 1L4AC 1ZV8A 2NPSD 3HE4B 3RL0C 4WY4C 1GO8P 1LGHB 2YKPA 1LTJC 2KB7P 2OYHB 1KQLA 1NTMK 1FZAA 4B86A 1LTJA 5APWA 5AW0B 3BATA 1SQVK 2OYIB 2XV5A 2R5DA 3KYQA 1H89A 3A2AA 1URQD 4GKGA 1O0QA 1KFNA 2YO1A 3L36A 2N1TB 1KZUB 1GU4A 1J1EB 4W80A 1T3UA 3VMYA 1JUNA 1JY3O 2O01H 5AVYB 2P2UA 2BASA 1SMPA 2VRSA 1SLQA 4LLHA 1JY2P 3HUSB 4GT1A 3L4FA 1JO5A 3VP8A 1GW4A 4JYCA 2OARA 1SRPA 1GO7P 3HE5B 3NFQA 3H6PA 2Q7CA 2YKOA 4C7NA 1RF0C 5D7WA 5AW7B 4KHXA 1H88A 3M9BA 5CVWA 3H32B 4Y99B 3LA9A 1CSBA 3C9IA 4C7RA 1CI6B 2J59M 1JOCA 2A45I 2HPCA 1HGVA 2WZ7A 1LTTC 3VOPA 3HD7D 4O9BA 3CLQA 4JF7A 2W6AA 1OMJA 1NH4A 2Q5UA 1L4AB 1JCDA 5AW1B 1M1JC 5KJ7C 1SQPK 3P7KA 2Q3IA 3LIDA 5CCGC 3RL0B 1RF1C 4WY4B 1M1JA 5KJ7A 2ML2A 5CCGA 1RF1A 3RK2D 1LTJB 3U1AA 2NPSC 2FXMA 5KTBA 2NPSA 1AKLA 2PAJA 3CI9A 1P9HA 1IJDB 1N86A 4AYCA 3WMM0 1FU1A 1JMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P8M C;  5AVS B;  3VYI A;  1A02 F;  3OAK A;  1S9K E;  5AVR B;  3M9H A;  1OWA A;  3HE4 B;  3HDA P;  2ZFC A;  1G2C B;  3M0D A;  2P7J A;  4EOT A;  5APT A;  3HB2 P;  2WPR A;  5AVU B;  3HE4 A;  2C9L Y;  1GO8 P;  3A7O A;  1K7I A;  2WPQ A;  3P32 A;  1KQL A;  1A02 J;  2QM7 A;  5APU A;  2E42 A;  4B86 A;  2Z8X A;  2N9B A;  3NMD A;  5APW A;  5AW0 B;  1NWQ A;  1S9K D;  2AGM A;  2H7H A;  2Z8Z A;  3A70 A;  2XV5 A;  2R5D A;  5AVW B;  4AQR D;  1HJB A;  2YNY A;  1H89 A;  3A2A A;  4GKG A;  5AW4 B;  2R3C A;  1KAP P;  1O0Q A;  4I2L C;  1CZQ A;  1GU5 A;  1JNM A;  2YO1 A;  2WT7 A;  3L36 A;  2R32 A;  4LC1 A;  1GU4 A;  5CMZ A;  3M06 A;  3B8E B;  1JUN A;  3VMY A;  1GK4 A;  1AF0 A;  1K7G A;  2WWW A;  3M0A A;  5APY A;  1T2K C;  5AW5 B;  3KQG A;  3U1R A;  3TK1 A;  3HBU P;  5AVZ B;  5AVY B;  3WP8 A;  5AVT B;  1HWT C;  2P2U A;  2BAS A;  2WTY A;  3TNU B;  3MGN A;  2VRS A;  1SLQ A;  2E43 A;  1SMP A;  1SP4 A;  2KP8 A;  4JYB A;  1MUU A;  3HBV P;  3A5T A;  1OM7 A;  2P67 A;  4GT1 A;  3MD0 A;  1IO4 A;  1H71 P;  2ZVD A;  5AVV B;  4I35 A;  3I5C A;  2QUA A;  2YO2 A;  3SWF A;  1H8A A;  4JYC A;  3TYY A;  5AW9 B;  1OXZ A;  2R5B A;  4C7N B;  2ZXE B;  3M91 A;  5AW2 B;  3VTP C;  1DH3 A;  1GD2 E;  1SRP A;  1GO7 P;  3HE5 B;  3HTK A;  3NFQ A;  3UIA A;  2Q7C A;  1T2K D;  4C7N A;  3V5B A;  2XQH A;  5D7W A;  2Z5I A;  1O0T A;  5AW7 B;  4KHX A;  1OM8 A;  1H88 A;  2WPS A;  3M9B A;  1G9K A;  5CVW A;  3LIE A;  5APS A;  4AUW A;  3LA9 A;  1CSB A;  1CI6 B;  1FAV A;  3VN0 A;  4I6M C;  5AVX B;  3T97 A;  5AVQ B;  3V4W A;  1NAF A;  1OM6 A;  3KDP B;  2W6A A;  3TNU A;  1OMJ A;  2JJL A;  1YYC A;  2ZJ6 A;  5APQ A;  4XE5 B;  2Q5U A;  3ULT A;  3O8Z A;  1X8Y A;  3NXS A;  5AW1 B;  3LAA A;  4M3L A;  1SAT A;  1GTW A;  1GK6 A;  3P7K A;  2Q3I A;  3LID A;  1J2J B;  4HYT B;  5APV A;  4RES B;  4DZO A;  2YO0 A;  1FOS E;  2ML2 A;  3HE5 A;  3NTN A;  3S6L A;  1K7Q A;  5APX A;  1JIW P;  3L35 A;  2XZR A;  5AW8 B;  3VMX A;  4C46 A;  2ZJ7 A;  1MFZ A;  2Z5H A;  5AW6 B;  1HUC A;  2YO3 A;  1MV8 A;  2IPP A;  2XU6 A;  2W27 A;  1AKL A;  3IR9 A;  1FOS F;  1HBW A;  1P9H A;  3VMZ A;  2C9N Y;  2QM8 A;  5CXL A;  2QUB A;  3A3Y B;  5AW3 B;  3VI1 A;  1CI6 A;  2WT7 B;  3L37 A;  3V4Q A;  4AYC A;  1GZL A;  3A6Z A; 
#chains in the Genus database with same CATH topology
 3SFD C;  2K9J B;  3L75 E;  1S9K E;  3MIW A;  3P8C D;  2MJZ A;  3O6Q A;  3U1C A;  2K37 A;  1JMB A;  1OVV A;  2L5G B;  3R4Y A;  1ZR2 A;  2HG5 D;  4I2L C;  2JEE A;  1JY3 P;  4UB8 H;  2HOD A;  2PP6 A;  2QJK B;  3AEE C;  4W7Z A;  1L0L K;  1FZC C;  1FZC A;  1YJN P;  3IAO A;  1VQ8 P;  2MKV A;  2E74 B;  2E43 A;  1BGY J;  3RK3 D;  3WU2 H;  2YO2 A;  2ZJS E;  1DH3 A;  2M5A A;  2B89 A;  2IBZ E;  3HTK A;  4RKU J;  1O0T A;  3WUU A;  4PV1 D;  2O1J A;  3RK2 C;  1P84 D;  2QRX A;  2JWD A;  1L0L G;  3B4S A;  3FX0 A;  4RO0 A;  2JJL A;  3S4R A;  2ZJ6 A;  1IK9 A;  1FJP A;  1URQ B;  3L71 G;  1K73 Q;  4I7Z C;  2HR3 A;  2ZVO B;  2YO0 A;  3CX5 H;  1QL2 A;  3TGU E;  1PP9 E;  1LP1 A;  4U3F G;  1VQ5 P;  3VI1 A;  2WT7 B;  4WVZ A;  1GZL A;  1L0L D;  1RY3 A;  2IFN A;  1FJK A;  2Q9I A;  1KQG B;  1FDO A;  1G2C B;  2FFD C;  2FKW B;  2WSE J;  5AVU B;  2FFD A;  5KAF H;  1GDT A;  4KJM A;  1SFC D;  2PGD A;  4U3F D;  2AGM A;  2HLO A;  1HJB A;  3FXE A;  2IFM A;  4BRY A;  2KSE A;  4U7J A;  3OW2 O;  3KQG A;  3KZI E;  3CL3 D;  3BRT B;  4HH2 A;  3MGN A;  1RQU A;  4PD4 H;  4JYB A;  2LR2 A;  4NPD A;  5B66 H;  4I35 A;  2QUA A;  1PPJ G;  2V7Q J;  2ZXE B;  1T2K D;  1FC2 C;  1KYO H;  4I1L A;  1G9K A;  1GW3 A;  3AE4 C;  4NPF X;  3CC7 P;  3GW6 A;  1BCC G;  4RJT A;  3V4W A;  3TNU A;  4H13 D;  1SQP D;  3H1L E;  1YQ3 C;  1J1D C;  3LAA A;  3SSU A;  3EQ2 A;  3CXH D;  1K7Q A;  3A0B H;  1HUC A;  1MV8 A;  4IL6 H;  4N78 D;  4N3Y B;  1BCC D;  1YTZ T;  3A6Z A;  1X0T A;  2RN0 A;  1EZV I;  3AE5 C;  4ASW A;  2OTK E;  4U3F J;  3O6Q B;  1KN7 A;  4EIJ A;  1OVU A;  2ZFC A;  1PL5 A;  2B88 A;  1T6A A;  2JWA A;  2N9Y B;  3CX5 I;  1KIL C;  4WWI A;  2LKM A;  4TT3 H;  3H1J G;  3H25 A;  1ZXG A;  1KIL A;  1LTG C;  3VP9 A;  4BXL A;  1VQ9 P;  2QE7 H;  2OGU A;  2H88 C;  3RL0 D;  1KMI Z;  4WY4 D;  2KLU A;  1FZC B;  5APY A;  3M0A A;  1EDI A;  3TK1 A;  2Y0E A;  2FXP A;  2C0X A;  2AXT H;  3Q5S A;  1MUU A;  3L75 D;  1BGY E;  3H1J D;  1H71 P;  2FYN C;  2OYI C;  4ZMD A;  2SPZ A;  3TYY A;  2OYI A;  4IFM A;  4TLF A;  3UIA A;  1NTZ E;  1PGQ A;  3PHL A;  2XQH A;  3SWK A;  5GTH H;  1YHQ P;  1SQP J;  4OGQ C;  3EFG A;  3S1K A;  3V2R A;  4EDF A;  1QL1 A;  5E79 E;  5AVX B;  2A45 G;  3BCC G;  3H1H J;  4PD4 I;  2KNC B;  3WUV A;  4K35 A;  3AE8 C;  4DZO A;  1BCC J;  4HYT B;  1WRG A;  3HE5 A;  5BVZ A;  3G3Z A;  2KYV A;  3TSI A;  2W8Z A;  1KYO I;  1HVV A;  4GOD A;  1FOS F;  1DIP A;  1M7L A;  1IFD A;  1N7S B;  2LXC B;  3V2P A;  1ZN5 A;  1L4A C;  1ZV8 A;  2NPS D;  3CC4 P;  1LGH B;  2KB7 P;  1RH5 B;  1NTM K;  1FZA A;  4B86 A;  2R44 A;  1SQV K;  3KYQ A;  1H89 A;  4BRY B;  1VQ6 P;  3L75 J;  1J1E B;  1R8E A;  3H1J J;  2K9J A;  3RK3 E;  1JUN A;  4OVN F;  2E75 B;  3GG2 A;  2P2U A;  2VRS A;  4LLH A;  1JY2 P;  3GF7 A;  4GT1 A;  3VP8 A;  3FGA D;  2OAR A;  1NTM G;  4JPZ B;  3NFQ A;  2Q7C A;  1VQM P;  1RF0 C;  1SQV G;  1H88 A;  1M56 D;  2QJK C;  1OIP A;  3H32 B;  2J59 M;  1JOC A;  1LTT C;  1FE6 A;  2E74 C;  3CLQ A;  3GLM A;  4OWF A;  1NH4 A;  1JCD A;  3CCV P;  3LID A;  5B5E E;  3CCJ P;  1NTM D;  3QH9 A;  3RK2 D;  4Z1M H;  1YIT P;  1L0L E;  1SQV D;  1AKL A;  1P9H A;  1TU3 F;  4AYC A;  3P8M C;  1S5L X;  1URQ C;  4U3F E;  5AVR B;  3M0D C;  1URQ A;  2ZYG A;  1OWA A;  1NKN A;  1AJY A;  3M0D A;  1MFT A;  3L73 G;  3IF4 A;  2WSF J;  3H1L D;  2OQQ A;  4GIF A;  5CCG D;  1SQB K;  2IDB A;  2WT7 A;  3CWB G;  3M06 A;  2M3B A;  1LNQ A;  2HPC B;  1DD3 A;  1RE4 C;  1L0N K;  1HWT C;  1G2C A;  1RE4 A;  3L73 D;  2GM4 A;  3AEC C;  3MD0 A;  4KT0 J;  3V6I A;  5TIS E;  2P58 A;  3B5N A;  2Z5I A;  1S5L E;  3CWB D;  3KZI H;  1FDI A;  1VQK P;  1SQB G;  4LGD E;  1PPJ E;  2A06 G;  2XDJ A;  1NTM J;  1NAF A;  3CXH E;  4BWN A;  1SQV J;  1L0N G;  1X8Y A;  1SAT A;  1AA0 A;  4N78 E;  1BCC E;  1BDC A;  3E7K A;  5APX A;  3AE2 C;  2ZJ7 A;  2AEF A;  3A0H H;  1Q81 Q;  2Q6Q A;  2KZI A;  1SQB D;  3A3Y B;  3BAS A;  2A06 D;  3AE1 C;  1AVY A;  3PTZ A;  3H1L J;  1BDD A;  3KPE A;  1L0N D;  1SS1 A;  1DEB A;  1ZLL A;  2IX7 C;  5DJT B;  3PLN A;  3IN6 A;  3A7O A;  1RHZ B;  1A02 J;  1EQ7 A;  1KAP P;  2WSC J;  5AW4 B;  1OW8 A;  2XNX A;  3L73 J;  3Q1M A;  5CMZ A;  2N1T C;  3B8E B;  2N1T A;  3H1J E;  1KIL D;  3U1R A;  3HBU P;  1JY3 N;  2YXR B;  4ZKP A;  2KP8 A;  1YBK A;  3CWB J;  3A5T A;  3SWF A;  2FYU K;  1Q82 Q;  1OXZ A;  2R5B A;  1GD2 E;  2XND H;  1AQ5 A;  1IFI A;  2ZT9 B;  2K3R A;  3TF5 A;  3LIE A;  1LTB C;  1QLE D;  1VPC A;  3VN0 A;  1HTL C;  1OZH A;  2Y9Y A;  4YTP C;  1SQX K;  1W5C E;  2YXQ B;  5APQ A;  1XTC C;  2WMM A;  1SQB J;  1NTZ J;  4OGQ D;  3U59 A;  5H2F E;  2IZ1 A;  2FYU G;  3BCC E;  1DEE G;  1L0N J;  2XU6 A;  4WB4 A;  1SQQ K;  2KI7 B;  4H44 B;  1HBW A;  3VMZ A;  1YTZ I;  5CXL A;  2QJP B;  5KLI B;  1DX7 A;  1NU1 K;  3G9R A;  3VYI A;  3L72 G;  3MP7 B;  2KNC A;  1SQX G;  1N2D C;  2O01 J;  1FZB A;  3JCU E;  1KV4 A;  2UWJ E;  2E42 A;  2FYU D;  3CD6 P;  1K05 A;  1IFM A;  5KKZ B;  1PGO A;  3VMA A;  3CCE P;  2YNY A;  3D71 A;  3L74 G;  3F5H A;  1L4A D;  1N7S C;  1N7S A;  1SQQ G;  2QVA A;  3WUT A;  1KQS O;  1GK4 A;  3L71 D;  1NU1 G;  1BSN A;  3USS A;  2WSE H;  3GHG B;  3L72 D;  1E5W A;  2D2C B;  1SVF A;  4YXW H;  1SQX D;  2QA4 P;  1GL2 C;  2V4H A;  3BRV B;  1GL2 A;  1JB0 J;  5AVV B;  2JO1 A;  3B5N B;  1X9V A;  1QEX A;  3L74 D;  3GF3 A;  3Q5P A;  5CBN A;  1J1E C;  1SQQ D;  1YQ4 C;  1JCC A;  2H89 C;  4PJ0 H;  1NU1 D;  2E75 C;  4DOJ A;  3PH0 A;  1ZRT E;  1NTM E;  1YYC A;  2V7Q H;  1SQV E;  1P84 H;  1K8A Q;  5CCH C;  4M3L A;  2K9Y A;  2KZJ A;  1RQV A;  4RES B;  5CCH A;  1LT1 A;  3MTU E;  2E74 D;  2GUS A;  3H32 A;  4L74 A;  1USE A;  2L91 A;  2FYU J;  2QSI A;  2Q1K A;  5CHX A;  5GTI H;  1PPJ D;  1S2E A;  1L0L J;  3AEA C;  1IZN B;  1KQL A;  3L71 J;  3BAT A;  2WQY C;  1BSH A;  2R5D A;  3L72 J;  3A2A A;  1URQ D;  3KHU A;  3L73 E;  2N1T B;  2DW3 A;  3SFE C;  1R5S A;  4DCK A;  4W80 A;  1T3U A;  3VMY A;  1JY3 O;  2K88 A;  5KAI H;  3T97 B;  3D6Y A;  3L74 J;  3MHV A;  3RGU A;  4H0L C;  1SQQ J;  3CWB E;  1JO5 A;  4GDO A;  1NU1 J;  2W6J H;  1VF5 B;  2YKO A;  4C7N A;  5D7W A;  4L76 A;  1YIJ P;  2BEQ D;  4Y28 J;  5CVW A;  4UB6 H;  4Y99 B;  1CSB A;  4K3A A;  3C9I A;  2HPC A;  1Y8A A;  1U7J A;  2PFX A;  4UB8 E;  1OVR A;  5KJ7 C;  1SQB E;  3AEB C;  2A06 E;  5KJ7 A;  2ML2 A;  1N8R Q;  3H1I G;  5KTB A;  3CMA P;  1S72 P;  1L0N E;  5EFW B;  2PAJ A;  3CI9 A;  3CXH H;  1N86 A;  4HJG H;  1Q86 Q;  3WU2 E;  3WMM 0;  1FU1 A;  1JMM A;  1KB9 D;  2G3A A;  3OAK A;  1P84 I;  5TJH A;  2C9L Y;  2H43 A;  4PV1 C;  3AEG C;  2KSJ A;  1LTS C;  1U57 A;  3H1I D;  1KIL E;  3SWY A;  1BE3 G;  2ZAE B;  1JNM A;  3BCC D;  2R32 A;  4LC1 A;  1U7M A;  1W2E A;  3C8V A;  3CX5 E;  3WP8 A;  4L73 A;  1GL2 B;  2O1K A;  1SP4 A;  1QGK B;  1IO4 A;  2POH A;  5AW9 B;  2IYO A;  1N73 A;  1Y47 A;  3S9O A;  1JY2 N;  2E76 B;  1CW5 A;  3FXD A;  3W67 A;  3V2Q A;  5KAF E;  2FYZ A;  1PGJ A;  3B71 A;  3G4S P;  1FDM A;  1FBM A;  1D7M A;  3E1R A;  3AE9 C;  2HFE D;  1GK6 A;  2ZT9 C;  4HKZ H;  1OFC X;  4IFF A;  1KQF B;  3S6L A;  3RL0 g;  3VMX A;  4C46 A;  2YMY A;  2YO3 A;  1S3J A;  1VQ4 P;  2G8Y A;  3V4Q A;  4IOI H;  3IFM A;  2FYU E;  3H1I J;  2KOG A;  3R2P A;  1KYO E;  2IZ0 A;  1ZRT D;  2KLV A;  1QVF O;  3BCC J;  3HB2 P;  2WPR A;  1K7I A;  3EWK A;  2WPQ A;  4D6T G;  5APU A;  4OH8 B;  1FS0 E;  3L71 E;  4H44 C;  3HD7 B;  3L72 E;  3CCQ P;  5KLI C;  2QJP C;  2E5Y A;  1EDK A;  3CXH I;  1NHL A;  1GU5 A;  1SQX E;  3I55 P;  1W2B O;  3V2N A;  3CCL P;  3JCU H;  3LW5 J;  2WSF H;  1VDF A;  5AVZ B;  3L74 E;  1LTI C;  4H0L B;  1N7S D;  3HBV P;  3W68 A;  1SQQ E;  5KKZ C;  3I5C A;  2I1J A;  2JKV A;  2OYO A;  4C7N B;  5AW2 B;  3M91 A;  1NU1 E;  2QIW A;  2K1A A;  1QX8 A;  1NO4 A;  1YJ9 P;  2M0B A;  4ZKU A;  3GHG C;  2D2C C;  1LTA C;  4I6M C;  3GHG A;  5AVQ B;  2KUB A;  4XE5 B;  1RE3 C;  3B5N C;  4N6J A;  3BVH A;  1RE3 A;  2W90 A;  3F89 A;  3G6E P;  1LT9 B;  3MUD A;  2E75 D;  2XZR A;  1X79 B;  4WY4 A;  5KLV K;  2Q3E A;  1WT6 A;  2QM8 A;  3GMA A;  1VQO P;  2ZYD A;  5CCH D;  3RK3 B;  1XTG B;  5AVS B;  2WPV B;  1A02 F;  1HH0 A;  5CJ0 A;  2YKQ A;  4R4M A;  3JC2 2;  1HGZ A;  2P7J A;  4PV1 B;  1M57 D;  4ASV A;  2Z8X A;  1IC2 A;  2QJY B;  2H7H A;  2Z8Z A;  3C1L A;  5AVW B;  3HRN A;  5KLV G;  1NYH A;  1KTM A;  1EZV G;  3PP5 A;  1AF0 A;  1IK7 A;  2IBZ I;  1Y9B A;  1MZ9 A;  1LWU B;  3Q3D A;  2KXP B;  1PFI A;  2FBW C;  1ZOY C;  2WSC H;  1N73 B;  2BEZ F;  1JY2 O;  2FXO A;  3CCM P;  5KLV D;  3V5B A;  2NZ2 A;  2FY8 A;  3EFF K;  2WPS A;  1EZV D;  1AQT A;  3MZW B;  3L70 G;  1KC8 Q;  3CC2 P;  3T97 A;  4CPG A;  3N7N A;  1SFC B;  1OX3 A;  3CX5 D;  4YPC A;  3NXS A;  4XFJ A;  1VF5 C;  2B87 A;  1FOS E;  2ZXX A;  1NTK K;  3L35 A;  5AW6 B;  1KB9 E;  1JTH B;  4Y99 C;  2IPP A;  3IR9 A;  3L70 D;  5AW3 B;  3O8Z A;  5KJ7 D;  1EXI A;  4JBZ A;  2H8P D;  4HB1 A;  3H1I E;  4EYY Q;  3AE3 C;  2PRR A;  5E79 H;  2OYH B;  5APW A;  5AW0 B;  2YIU B;  2XV5 A;  1NTK G;  4GKG A;  1O0Q A;  1KFN A;  1PIX A;  2R3S A;  4H13 B;  2YO1 A;  1KZU B;  1GU4 A;  2W83 C;  1ZW0 A;  4PD4 D;  1NVO A;  1USD A;  2M3E A;  5DJU B;  1IFP A;  2O01 H;  4GOF A;  5KLV J;  1BE3 E;  3HUS B;  1PZQ A;  2P10 A;  1KYO D;  4JYC A;  4DJG A;  1NTK D;  2O3J A;  5AW7 B;  1X22 A;  4KHX A;  3AED C;  3LA9 A;  3ZDM A;  1PGP A;  1CI6 B;  3RBX A;  1Q7Y Q;  4NPE A;  4O9B A;  4JF7 A;  2W6A A;  1OMJ A;  2RKL A;  2E5T A;  2Q5U A;  3L70 J;  1M1J C;  3H1K G;  1SQP K;  5CCG C;  2Q3I A;  3RL0 B;  4WY4 B;  1M1J A;  5CCG A;  2E76 C;  1EC5 A;  1LTJ B;  4EI2 A;  2FXM A;  1VQN P;  2JR8 A;  2ZYA A;  3QWO C;  1VQ7 P;  3AE7 C;  1NKZ B;  1NJI Q;  2ZT9 D;  1G1J A;  1KFM A;  1OW7 A;  3M9H A;  3OJA B;  2GUV A;  3H1K D;  1YJW P;  5APT A;  3CME P;  3P32 A;  2IYP A;  1SQP G;  5BU5 A;  1NWQ A;  2CPB A;  3A70 A;  1MKM A;  4AQR D;  2Y9Z A;  2Y0D A;  2OTJ P;  3H1H G;  5B5E H;  2KS1 B;  5BU8 B;  4D6T E;  1NTK J;  5AVT B;  4H44 D;  2WTY A;  3A0H E;  1Z56 A;  3FWN A;  2P67 A;  2ZVD A;  2KIK A;  3HD7 C;  2QEX P;  1SQX J;  2KK7 A;  3HD7 A;  1RF1 B;  4W7Y A;  2CK3 H;  1KOR A;  3N4X A;  3H1H D;  2NPS B;  2LXB A;  5APS A;  4AUW A;  1H0T A;  2J58 A;  1FAV A;  1QVG O;  2BCC G;  1JM0 A;  1G1I A;  2CPS A;  2B87 B;  1OMI A;  1GTW A;  2RH0 A;  5APV A;  1LJ2 A;  1E79 H;  1NOH A;  2D2C D;  1EDL A;  2ITA A;  3L75 G;  2Z5H A;  1YI2 P;  1AV1 A;  1N7L A;  3H1K J;  3B5N D;  1VQL P;  2HOD B;  3L37 A;  2BCC D;  5TIS H;  2O01 N;  2I1K A;  1FZE A;  2I8D A;  5M1B A;  1S5L H;  2NRG A;  1IFN A;  1HF9 A;  1LT9 C;  3HE4 A;  1LT9 A;  5K5G B;  2N9B A;  3NMD A;  1AFO A;  2M5A B;  1S9K D;  3HTK B;  2R3C A;  3M9Q A;  1T3J A;  1CZQ A;  1K04 A;  1Q90 D;  3RK3 C;  2WIT A;  1VQP P;  1L2P A;  5L8R J;  2QG4 A;  1FZF A;  1WMK A;  1NAY A;  2WWW A;  2IBZ G;  3RK2 B;  1ZP0 C;  5KLV E;  1M1K Q;  1HJ0 A;  2QJY C;  1EZV E;  1UIX A;  1OM7 A;  3CPW O;  3Q2Y A;  4I7Z B;  3JSV C;  3VTP C;  1T8Z A;  3OA7 A;  3TDK A;  3KXD A;  1LP1 B;  3ABV C;  2HYN A;  3E1I A;  2IBZ D;  3TGU G;  2OTL P;  3P8C E;  1PP9 G;  1LWU C;  1LWU A;  2N1T D;  1N73 C;  3ULT A;  1M1J B;  4GOE A;  3L70 E;  1BE3 D;  1L4A A;  2FFD B;  2BCC J;  3NTN A;  1JIW P;  5AW8 B;  4A7P A;  2QUB A;  3TGU D;  2AEM A;  1R5L A;  1SFC C;  1PP9 D;  1VF5 D;  1SFC A;  3RBZ A;  3HDA P;  2Z4E A;  3G71 P;  2ZVN B;  4EOT A;  1KB9 H;  5CJ4 A;  3PJS K;  4DT0 A;  4IL6 X;  2XKM A;  4PJ0 E;  4XA4 A;  2W6B A;  2QM7 A;  4L75 A;  2RMZ A;  4PD4 E;  2YMK A;  1JTH A;  1UII A;  5B66 E;  1P84 E;  3D6Z A;  1RF0 A;  1K7G A;  5H2F H;  2A45 H;  1ZR4 A;  1T2K C;  5AW5 B;  1NTK E;  2JDI H;  3TNU B;  2JP3 A;  2OYH C;  2C0W A;  2OYH A;  2YIU C;  1H8A A;  1EXJ A;  1JEK A;  2AXC A;  1J1D B;  4H13 C;  5GTI E;  1H0T B;  1OM8 A;  1OW6 A;  1K9M Q;  3H1L G;  3LW5 H;  3A0B E;  1BE3 J;  3K5B A;  3II6 A;  2M8R A;  1OM6 A;  3KDP B;  4IL6 E;  3HUS C;  1AVO A;  4D6T D;  2AEJ A;  3HUS A;  1S1C X;  4WBA A;  1PV3 A;  1J2J B;  3TGU J;  1FZG A;  1PP9 J;  1KIL B;  5KAI E;  1GL2 D;  1MFZ A;  1DD4 A;  2W27 A;  1M8O B;  2C9N Y;  1CI6 A;  3H1K E;  2P1J A;  2WSS H;  1IFJ A;  1NTZ K;  3FWL A;  1ZME C;  1Q2N A;  2E76 D;  3AE6 C;  3HE4 B;  3MUD C;  3RL0 C;  2B9B A;  3CCR P;  4WY4 C;  4UB6 E;  1GO8 P;  2YKP A;  1LTJ C;  1KD1 Q;  1LTJ A;  1M90 Q;  2AXT E;  2FYN B;  2OYI B;  3Q5R A;  3L36 A;  1BGY G;  3ITK A;  2J5U A;  4OGQ B;  5GTH E;  1SQP E;  1S4X A;  1NTZ G;  5AVY B;  3D70 A;  2BAS A;  1SMP A;  1SLQ A;  2GA1 A;  1KB9 I;  4JQ0 D;  3H1H E;  3L4F A;  1GW4 A;  1SRP A;  1GO7 P;  3HE5 B;  3H6P A;  3I56 P;  4D6T J;  3M9B A;  1BGY D;  1VL2 A;  4ZNC A;  3CCU P;  2KS1 A;  4C7R A;  3AEF C;  2A45 I;  1HGV A;  2WZ7 A;  1NTZ D;  3VOP A;  3HD7 D;  5C39 A;  4YXD C;  1L4A B;  4DT5 A;  5AW1 B;  3P7K A;  2WVR A;  1RF1 C;  3CCS P;  4QMA A;  2BCC E;  1RF1 A;  3U1A A;  2NPS C;  4MN4 C;  1EDJ A;  4H0L D;  4R4L A;  5CBO A;  1NGM B;  2NPS A;  3PRJ A;  2Y0C A;  1IJD B;  1GMJ A;  4IFD K; 
#chains in the Genus database with same CATH homology
 3P8M C;  1NKZ B;  1G1J A;  1URQ C;  3OAK A;  1S9K E;  1KFM A;  5AVR B;  3M0D C;  3M9H A;  1URQ A;  1OWA A;  3MIW A;  3OJA B;  3P8C D;  1NKN A;  2MJZ A;  3M0D A;  2GUV A;  3U1C A;  5APT A;  2C9L Y;  2H43 A;  3P32 A;  2KSJ A;  2L5G B;  1LTS C;  5BU5 A;  1NWQ A;  2CPB A;  3A70 A;  3SWY A;  4AQR D;  1ZR2 A;  2HG5 D;  4I2L C;  2JEE A;  4GIF A;  1JNM A;  5CCG D;  1JY3 P;  1SQB K;  2WT7 A;  2HOD A;  2R32 A;  4LC1 A;  3M06 A;  2PP6 A;  2M3B A;  5BU8 B;  1W2E A;  4W7Z A;  1L0L K;  1FZC C;  2HPC B;  1FZC A;  1RE4 C;  3WP8 A;  1L0N K;  5AVT B;  1HWT C;  2WTY A;  1G2C A;  1GL2 B;  1RE4 A;  2O1K A;  2E43 A;  1SP4 A;  2GM4 A;  1Z56 A;  2P67 A;  1IO4 A;  3MD0 A;  3RK3 D;  2ZVD A;  2POH A;  2YO2 A;  3HD7 C;  1DH3 A;  5AW9 B;  3HD7 A;  1N73 A;  3HTK A;  1RF1 B;  3B5N A;  4W7Y A;  1JY2 N;  2Z5I A;  1O0T A;  1CW5 A;  3N4X A;  2NPS B;  2O1J A;  5APS A;  4AUW A;  2J58 A;  3V2Q A;  1FAV A;  4LGD E;  3RK2 C;  2XDJ A;  2FYZ A;  1NAF A;  2JJL A;  2ZJ6 A;  1G1I A;  2CPS A;  1IK9 A;  1FDM A;  1FJP A;  1URQ B;  1FBM A;  1X8Y A;  2HFE D;  1SAT A;  1GTW A;  1GK6 A;  4N78 E;  2YO0 A;  5APV A;  1QL2 A;  4IFF A;  1NOH A;  3S6L A;  5APX A;  3VMX A;  4C46 A;  2ZJ7 A;  2Z5H A;  2YMY A;  2YO3 A;  3A3Y B;  3BAS A;  3VI1 A;  1N7L A;  2WT7 B;  3B5N D;  2HOD B;  3L37 A;  3V4Q A;  1GZL A;  1RY3 A;  2IFN A;  3IFM A;  3KPE A;  1FJK A;  2I1K A;  2KOG A;  3R2P A;  2Q9I A;  1FZE A;  1DEB A;  1ZLL A;  1G2C B;  1IFN A;  2FFD C;  2KLV A;  2IX7 C;  2FKW B;  3HB2 P;  1LT9 C;  2WPR A;  3HE4 A;  5AVU B;  2FFD A;  3A7O A;  1K7I A;  1GDT A;  2WPQ A;  1LT9 A;  1A02 J;  5APU A;  2N9B A;  1SFC D;  3NMD A;  4OH8 B;  1AFO A;  1S9K D;  2AGM A;  2HLO A;  1EQ7 A;  3HD7 B;  3HTK B;  1HJB A;  1KAP P;  2IFM A;  2R3C A;  5AW4 B;  3M9Q A;  1T3J A;  2XNX A;  1CZQ A;  1NHL A;  1GU5 A;  3RK3 C;  2WIT A;  5CMZ A;  2N1T C;  1FZF A;  3B8E B;  2N1T A;  1KIL D;  3V2N A;  2WWW A;  3U1R A;  3KQG A;  2WSF H;  1VDF A;  5AVZ B;  3HBU P;  3RK2 B;  1JY3 N;  3CL3 D;  1LTI C;  3BRT B;  3MGN A;  4HH2 A;  4ZKP A;  2KP8 A;  4JYB A;  1N7S D;  3HBV P;  3A5T A;  1OM7 A;  4I35 A;  3I5C A;  2I1J A;  2QUA A;  3SWF A;  2FYU K;  4C7N B;  1OXZ A;  2R5B A;  2ZXE B;  3M91 A;  5AW2 B;  3VTP C;  1GD2 E;  1AQ5 A;  1IFI A;  1T8Z A;  3OA7 A;  1T2K D;  4I1L A;  1G9K A;  3LIE A;  1LTB C;  1GW3 A;  1NO4 A;  2HYN A;  3E1I A;  4ZKU A;  3GHG C;  1VPC A;  3VN0 A;  1HTL C;  1LTA C;  4I6M C;  3GHG A;  3P8C E;  5AVQ B;  3V4W A;  1LWU C;  3TNU A;  1SQX K;  1LWU A;  5APQ A;  1XTC C;  2N1T D;  4XE5 B;  1N73 C;  1RE3 C;  3ULT A;  3B5N C;  4N6J A;  1J1D C;  1M1J B;  3BVH A;  1RE3 A;  3LAA A;  3U59 A;  1L4A A;  2FFD B;  3EQ2 A;  1LT9 B;  3NTN A;  3MUD A;  1K7Q A;  1JIW P;  5AW8 B;  2XZR A;  1X79 B;  4WY4 A;  5KLV K;  1HUC A;  1MV8 A;  2XU6 A;  4WB4 A;  1SQQ K;  1HBW A;  3VMZ A;  1WT6 A;  1YTZ I;  2QM8 A;  4N78 D;  2QUB A;  5CXL A;  4N3Y B;  1DX7 A;  1YTZ T;  5CCH D;  1SFC C;  1NU1 K;  3RK3 B;  3A6Z A;  1XTG B;  5AVS B;  3VYI A;  1A02 F;  1SFC A;  1HH0 A;  5CJ0 A;  2YKQ A;  4EIJ A;  3HDA P;  2Z4E A;  2ZFC A;  1N2D C;  1HGZ A;  2P7J A;  4EOT A;  1FZB A;  5CJ4 A;  1KIL C;  2XKM A;  4XA4 A;  2LKM A;  2W6B A;  2Z8X A;  1IC2 A;  2QM7 A;  2E42 A;  1KIL A;  1LTG C;  3VP9 A;  1IFM A;  2H7H A;  2Z8Z A;  1JTH A;  5AVW B;  3HRN A;  2YNY A;  1L4A D;  1N7S C;  1N7S A;  3RL0 D;  3PP5 A;  4WY4 D;  1FZC B;  1RF0 A;  1GK4 A;  1AF0 A;  1K7G A;  2A45 H;  1ZR4 A;  5APY A;  3M0A A;  1T2K C;  2WSE H;  3GHG B;  5AW5 B;  1E5W A;  3TK1 A;  1SVF A;  1MZ9 A;  3TNU B;  2C0X A;  1GL2 C;  1LWU B;  1MUU A;  2OYH C;  3BRV B;  4IFD K;  1PFI A;  1GL2 A;  2C0W A;  1H71 P;  2OYH A;  5AVV B;  2WSC H;  1N73 B;  3B5N B;  1H8A A;  2OYI C;  3TYY A;  1X9V A;  1J1D B;  1JY2 O;  2OYI A;  4IFM A;  3UIA A;  3V5B A;  2XQH A;  1OM8 A;  2WPS A;  1J1E C;  3LW5 H;  3EFG A;  1JCC A;  3V2R A;  1QL1 A;  5AVX B;  4DOJ A;  3II6 A;  2A45 G;  3T97 A;  2M8R A;  3N7N A;  1OM6 A;  3KDP B;  1SFC B;  3HUS C;  1YYC A;  3HUS A;  4WBA A;  3NXS A;  5CCH C;  4M3L A;  4DZO A;  1J2J B;  4HYT B;  4RES B;  5CCH A;  1WRG A;  1FZG A;  1FOS E;  3HE5 A;  3MTU E;  5BVZ A;  3G3Z A;  2KYV A;  3TSI A;  1NTK K;  1KIL B;  3L35 A;  1GL2 D;  1MFZ A;  5AW6 B;  1JTH B;  2GUS A;  4Y99 C;  1HVV A;  2IPP A;  2W27 A;  3H32 A;  3IR9 A;  1FOS F;  2C9N Y;  1M7L A;  5AW3 B;  1IFD A;  1CI6 A;  1N7S B;  2P1J A;  3O8Z A;  5KJ7 D;  1IFJ A;  3V2P A;  1NTZ K;  2H8P D;  1ZN5 A;  5CHX A;  1L4A C;  1ZV8 A;  2NPS D;  3HE4 B;  3RL0 C;  4WY4 C;  1GO8 P;  1LGH B;  2YKP A;  1LTJ C;  2KB7 P;  2OYH B;  1KQL A;  1NTM K;  1FZA A;  4B86 A;  1LTJ A;  5APW A;  5AW0 B;  3BAT A;  1SQV K;  2OYI B;  2XV5 A;  2R5D A;  3KYQ A;  1H89 A;  3A2A A;  1URQ D;  4GKG A;  1O0Q A;  1KFN A;  2YO1 A;  3L36 A;  2N1T B;  1KZU B;  1GU4 A;  1J1E B;  4W80 A;  1T3U A;  3VMY A;  1JUN A;  1JY3 O;  2O01 H;  5AVY B;  2P2U A;  2BAS A;  1SMP A;  2VRS A;  1SLQ A;  4LLH A;  1JY2 P;  3HUS B;  4GT1 A;  3L4F A;  1JO5 A;  3VP8 A;  1GW4 A;  4JYC A;  2OAR A;  1SRP A;  1GO7 P;  3HE5 B;  3NFQ A;  3H6P A;  2Q7C A;  2YKO A;  4C7N A;  1RF0 C;  5D7W A;  5AW7 B;  4KHX A;  1H88 A;  3M9B A;  5CVW A;  3H32 B;  4Y99 B;  3LA9 A;  1CSB A;  3C9I A;  4C7R A;  1CI6 B;  2J59 M;  1JOC A;  2A45 I;  2HPC A;  1HGV A;  2WZ7 A;  1LTT C;  3VOP A;  3HD7 D;  4O9B A;  3CLQ A;  4JF7 A;  2W6A A;  1OMJ A;  1NH4 A;  2Q5U A;  1L4A B;  1JCD A;  5AW1 B;  1M1J C;  5KJ7 C;  1SQP K;  3P7K A;  2Q3I A;  3LID A;  5CCG C;  3RL0 B;  1RF1 C;  4WY4 B;  1M1J A;  5KJ7 A;  2ML2 A;  5CCG A;  1RF1 A;  3RK2 D;  1LTJ B;  3U1A A;  2NPS C;  2FXM A;  5KTB A;  2NPS A;  1AKL A;  2PAJ A;  3CI9 A;  1P9H A;  1IJD B;  1N86 A;  4AYC A;  3WMM 0;  1FU1 A;  1JMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...