3NTNA

Crystal structure of uspa1 head and neck domain from moraxella catarrhalis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
211
Chain Sequence
ENSTVGGGGYNQAKGRNSTVAGGYNNEATGTDSTIAGGRKNQATGKGSFAAGIDNKANADNAVALGNKNTIEGENSVAIGSNNTVKKGQQNVFILGSNTDTTNAQNGSVLLGHNTAGKAATIVNSAEVGGLSLTGFAGASNGTVSVGKKGKERQIVHVGAGEISDTSTDAVNGSQLHALATVVAQNKADIKDLDDEVGLLGEEINKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UspA1
publication title Correlation of in situ mechanosensitive responses of the Moraxella catarrhalis adhesin UspA1 with fibronectin and receptor CEACAM1 binding.
pubmed doi rcsb
source organism Moraxella catarrhalis
molecule tags Membrane protein
total genus 71
structure length 211
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
A PF18792 UspA1_rep Ubiquitous surface protein adhesin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ntnA02
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3ntnA01
1AKLA 5AVYB 1OM8A 1K7QA 5CMZA 1T2KC 1SP4A 3A6ZA 3V5BA 3VYIA 2WTYA 1A02J 3HE4A 5AVQB 2E42A 2ZFCA 2XZRA 3T97A 1SMPA 2ZXEB 3HDAP 5AW1B 3NXSA 5AVTB 4AQRD 5AW5B 4HYTB 1SRPA 1CSBA 5APWA 5AW4B 1JUNA 3M91A 1NAFA 1O0TA 4EOTA 2ZVDA 2WPRA 3P32A 3MGNA 4M3LA 5APXA 3TK1A 2Q3IA 1FOSE 1HJBA 3S6LA 2KP8A 3HTKA 5AVVB 2JJLA 2P2UA 5AVUB 3L36A 5AW2B 1MV8A 1SLQA 4JYCA 5APYA 1IO4A 3LA9A 4GKGA 5AW9B 2WWWA 5CXLA 3A5TA 1OM6A 3L37A 1MUUA 1YYCA 2WT7B 4KHXA 2XV5A 4GT1A 3O8ZA 3UIAA 1AF0A 3IR9A 1OXZA 3HE4B 5AVWB 4C46A 5AW7B 3TNUA 2N9BA 2P7JA 1HUCA 2QM7A 3V4QA 1H89A 2QUAA 2ZJ6A 5CVWA 1K7IA 2AGMA 1DH3A 1CI6B 1FOSF 5AW6B 1FAVA 3HE5A 1KQLA 1J2JB 5APUA 5AW0B 2R5DA 1OMJA 2E43A 1OM7A 1SATA 3TYYA 2C9LY 1G9KA 1S9KD 3A7OA 3MD0A 2XU6A 2W27A 3M06A 2YO2A 1A02F 1CZQA 3A2AA 2WPSA 3I5CA 3NTNA 4JYBA 3V4WA 4B86A 4DZOA 1GU4A 2QUBA 3NMDA 3VMYA 3LIEA 1JIWP 2ML2A 1O0QA 3ULTA 3VMXA 4AUWA 2BASA 1GO8P 4AYCA 1HWTC 1OWAA 3P8MC 4C7NA 2Q7CA 1GTWA 2Z8XA 2R3CA 3M0AA 3M0DA 3TNUB 1X8YA 5AVXB 1HBWA 3VI1A 5D7WA 4I35A 1GO7P 5APTA 1P9HA 1GK6A 2VRSA 4LC1A 2Q5UA 2YO3A 3P7KA 2Z5IA 1GU5A 1H88A 2Z8ZA 3WP8A 1G2CB 3A3YB 3KDPB 2QM8A 2H7HA 5APVA 2W6AA 5AVRB 3KQGA 2WT7A 3HBVP 3HBUP 5AVZB 2XQHA 2C9NY 3LAAA 3OAKA 1NWQA 1GZLA 5AVSB 4I6MC 3NFQA 1K7GA 3A70A 2P67A 1H8AA 2Z5HA 2YO0A 2ZJ7A 3VTPC 2YO1A 2R32A 1GD2E 1CI6A 5APQA 3M9BA 4I2LC 3L35A 1KAPP 3B8EB 2IPPA 3VN0A 1JNMA 4RESB 3HB2P 2R5BA 2YNYA 2WPQA 3M9HA 4C7NB 1MFZA 1GK4A 1S9KE 5AW3B 4XE5B 3LIDA 1H71P 3U1RA 3VMZA 3HE5B 1T2KD 3SWFA 5AW8B 5APSA
chains in the Genus database with same CATH superfamily
1KN7A 3IAOA 2QSIA 3OA7A 2FYNC 4WY4D 3V2NA 2O1JA 1NU1D 1VF5D 3N4XA 2IFNA 3V6IA 1JY3P 4IFFA 4N78D 1JB0J 3CI9A 2P2UA 1IO4A 2R3SA 1RY3A 2W90A 4XA4A 2HLOA 2OYHB 1R8EA 3H1LD 3PRJA 1FAVA 2JR8A 2H89C 2C9LY 3LW5J 4IL6X 3H1JD 1KFNA 4JYBA 1N73A 2QJPC 1NJIQ 3MZWB 2E75B 3EFFK 2QJYB 3TNUB 2FYUJ 5AVXB 1S2EA 2QRXA 1L4AA 1L0NJ 1AV1A 3HBUP 3HD7D 2YKOA 2XQHA 2ZJ7A 1BSNA 3V2PA 2NPSB 2HYNA 2W8ZA 3IFMA 2YNYA 1T3UA 1EDIA 3RGUA 1AJYA 1PGPA 3LIDA 1LTJA 4WY4B 1S5LE 1OM8A 1KYOD 4PJ0H 1R5LA 2JWAA 1X22A 1QL1A 2E42A 1SFCD 1SMPA 2ZXEB 3CC7P 5KAFH 1LT1A 2KI7B 1USEA 2ZVDA 2WPRA 1NTZD 2OTKE 1N7LA 4JQ0D 1KV4A 1BCCJ 3AEBC 3L36A 3L75J 4IOIH 2CPBA 1P84D 2HPCB 3IR9A 1GW3A 5AW7B 4N6JA 1JY2O 1PP9D 2H8PD 1L0LE 1JO5A 2HFED 5BU5A 1H0TA 1T3JA 4ZNCA 3H1KD 4K3AA 3NTNA 3M9QA 4TT3H 3U1CA 1S72P 1VQKP 3CWBE 4IL6H 3VMXA 2Y0EA 2B87A 2Z8XA 2AXTH 3RK3D 2A45I 4I35A 3HD7B 3BVHA 2Z4EA 3R4YA 1OVUA 4OWFA 1SQPK 2I1JA 2MJZA 2QJKB 4GODA 1EZVI 3RK2C 4DT5A 3HUSB 4C7NB 2A45G 1QEXA 3MIWA 3SFDC 1S3JA 3U1RA 2GM4A 1WMKA 2K9YA 1T2KD 5AW8B 2QG4A 1OW8A 1BCCD 1SFCB 4WWIA 2ZFCA 3T97A 2GUVA 1RF0C 3NXSA 1NU1K 5CJ4A 3L71D 3JC22 1VQ4P 3L72D 1GL2C 1EZVG 2K88A 2BEQD 1SQBD 4OGQC 1NOHA 2B88A 1Y8AA 3HTKA 2FXMA 2ZJSE 5BVZA 2AEJA 3LW5H 1M56D 1PV3A 1AF0A 3HE4B 1P84H 3MHVA 4C46A 1H89A 1RH5B 1ZN5A 1XTCC 2YMKA 2OYIB 1SQXD 1DD4A 1SQPG 2IX7C 2FXOA 5KJ7D 3F89A 1G2CA 3H1HD 4LLHA 3U59A 4H13D 5K5GB 1OFCX 3S1KA 1SQVE 5GTHE 4EYYQ 3RK3B 1M1JB 1RE4C 5DJTB 1LTTC 1Q81Q 2WSSH 3II6A 2E76B 2Q5UA 1NU1G 3JSVC 1HTLC 2D2CC 3VP8A 2IZ1A 4U7JA 4N3YB 1FZBA 3C1LA 1OW7A 5M1BA 3M9HA 1L0LJ 4L73A 1S9KE 2IBZE 1H71P 2KZIA 1GW4A 4PV1D 4PJ0E 3G9RA 3H1LG 1L2PA 3CWBJ 2B89A 2YIUC 1MFTA 4ZKPA 3CX5H 2ZXXA 4UB6H 3FWLA 3H1JG 4M3LA 2GUSA 4DJGA 3AEFC 5APXA 1QVFO 3KYQA 1S5LX 1JCDA 1JEKA 3IF4A 1KC8Q 1NVOA 1UIIA 2KNCA 1YYCA 5CBNA 1U7MA 4BRYB 4I1LA 3TDKA 2K9JB 1DH3A 3KPEA 1KYOI 1FZGA 3TYYA 3R2PA 2FYUK 3L73E 5L8RJ 2YO2A 1L0NK 3GMAA 2AXTE 3VMYA 3LIEA 3JCUE 1EXJA 2G8YA 3A0BE 3QWOC 4L76A 3W68A 3RL0g 3Q3DA 1P84I 2FKWB 3WUVA 3GHGC 3L74E 1ZP0C 1Y9BA 2KUBA 1GL2A 2R44A 1PGJA 4H0LD 3A70A 2ZT9D 5B5EE 1NTZG 2Z5HA 1GD2E 2IYOA 3N7NA 2QVAA 1FZCB 2QA4P 3CD6P 4PV1B 3F5HA 3D70A 1LP1A 4U3FE 1YTZT 1SQVJ 2B9BA 3G71P 1PPJE 2H43A 1PZQA 2QIWA 3GW6A 1FZEA 2WSFJ 5KTBA 2N1TD 2MKVA 3A5TA 1MKMA 2P58A 1ZMEC 1S5LH 1K05A 2G3AA 1CI6B 2WVRA 1VQOP 1U57A 2E75C 1NTME 3BCCD 3B5NB 2QJYC 1KILE 2O01H 1VQPP 3AEDC 3G4SP 4AYCA 1RE3C 3GLMA 1OWAA 2M0BA 2LXCB 3D6ZA 1HGVA 1HBWA 1BCCG 2NPSC 4H0LB 4A7PA 2FY8A 2Z8ZA 2H7HA 5AVRB 3L71G 2ZT9B 5AVZB 2I8DA 4PD4E 4WY4C 1SQVD 1KAPP 2OYOA 1JNMA 2Q3EA 2L91A 1ZR4A 2ITAA 3L73J 1M8OB 1L4AD 3E1IA 4H44D 1SQXG 1SS1A 3HDAP 1KB9E 1OVRA 4AQRD 3O6QB 3S4RA 5TJHA 4IFDK 3CXHE 3H1HG 2PAJA 2W6BA 3P32A 2V4HA 1LTSC 3FXEA 3L74J 3CPWO 2Q3IA 1FOSE 4R4MA 4MN4C 2AXCA 1MV8A 1QL2A 1N7SA 3RL0D 2YKPA 5AVWB 2I1KA 2P7JA 2QUAA 1JY3O 1N2DC 3GF7A 3GG2A 1KFMA 1IC2A 5KLVE 4U3FJ 3C8VA 1UIXA 4D6TE 4ZMDA 3V4WA 1HJ0A 2WPSA 3HD7C 3ULTA 1M57D 2QJKC 2KK7A 1TU3F 3SWKA 1DX7A 5B66E 1L0LK 3HUSC 1H88A 2P10A 3A3YB 2O01N 5AVSB 2P67A 3BRTB 3Q5RA 1SFCC 1NTMJ 1EC5A 5GTHH 2N9YB 3AE1C 5BU8B 2QEXP 2HR3A 4GOEA 2JO1A 4H44B 3V5BA 1J1DC 1T8ZA 3I55P 2IYPA 2WSFH 1CSBA 1JUNA 1KILC 3HRNA 5KLIB 1RE3A 3CCRP 1FZAA 4I7ZB 2OYIC 1ZV8A 1SLQA 3RL0B 3AE2C 4U3FD 2H88C 5CXLA 1U7JA 1IZNB 2XV5A 1VF5B 3H1IE 1ZRTE 1J2JB 3RK3C 3IN6A 1JCCA 4WY4A 1M1JC 1G9KA 1EDLA 3A7OA 1LTBC 3A0HE 1A02F 4Y28J 4Y99B 3AE3C 2E76C 3PJSK 1JIWP 3Q5SA 4YXDC 1RF1B 2NZ2A 1GMJA 2HG5D 2FYUD 1P9HA 4ZKUA 2HPCA 2OGUA 3L70E 1L0ND 3KQGA 3OAKA 1NWQA 2OTLP 1HGZA 2YO0A 2YO1A 2R32A 1SQVK 1BE3E 4UB8H 3KXDA 2IFMA 3JCUH 5KKZB 2FYNB 3A0BH 5KLVJ 3P8CD 2O1KA 2M3BA 4D6TJ 2KLVA 2WTYA 2LXBA 3CCSP 1A02J 5E79E 1SQQE 3BCCG 5CCGC 5AW1B 2RN0A 4YTPC 4HB1A 1AA0A 5B5EH 3CCMP 1NAFA 1O0TA 4EOTA 2P1JA 3B4SA 1QX8A 2FFDB 1URQC 1AQ5A 4YPCA 1EDKA 3S6LA 2PFXA 2OQQA 1FDMA 3CX5D 1K73Q 3L75D 4L75A 1OM6A 2WT7B 2RH0A 4DT0A 3HUSA 1BDDA 1RHZB 1K9MQ 1YJ9P 2LKMA 3S9OA 1OM7A 3FXDA 1VQMP 2WPVB 1SQVG 1WRGA 1NKNA 2PP6A 3HTKB 2QUBA 2L5GB 1GDTA 1FZCC 2V7QJ 2BCCE 1G2CB 1KILA 4PV1C 2FYZA 4D6TD 3RK2D 2OYIA 3H1IJ 1D7MA 4RJTA 1VL2A 5AW3B 3HE5B 1DEEG 2O01J 1BDCA 5C39A 3VP9A 2ZYAA 2LR2A 1NGMB 5CMZA 3CLQA 3M0DC 1JMMA 1AQTA 1YJNP 2CPSA 3RBZA 1OMIA 4PD4H 3H25A 4OGQD 2A06E 5KAIE 2KP8A 3L70J 1VQ7P 2E74D 5AVVB 3CCUP 1XTGB 3AE9C 2KZJA 3B5NC 5AW9B 3E1RA 4GT1A 3ITKA 3O8ZA 1Z56A 2KB7P 1BE3J 4WBAA 2AGMA 3FGAD 3KHUA 3L73G 3B71A 3I56P 3AEEC 1KB9H 2R5DA 3H6PA 4TLFA 2W27A 3CXHH 5CHXA 3G6EP 2KSJA 2ZVOB 1YIJP 2OARA 3A2AA 3PTZA 2YXQB 3GF3A 1SQQJ 4H0LC 1FC2C 2J59M 2BASA 1LT9B 2ZT9C 3H1ID 2ZYGA 3L74G 1T6AA 1X8YA 1ZRTD 4N78E 5CCGA 5APTA 1BGYE 2D2CD 3CCVP 1KQFB 1NTMK 2QM8A 1LWUB 4H13B 4BRYA 1GZLA 1URQA 4UB8E 4HKZH 3H1LE 1ZW0A 1KZUB 1YBKA 4RESB 2YKQA 2RMZA 3USSA 4U3FG 1LNQA 1L0LD 1RF0A 3D6YA 3L70D 3AE5C 5B66H 1VQ9P 3TSIA 1M90Q 3CWBD 4HYTB 4OGQB 1SRPA 1BE3D 2E74B 1LJ2A 2BCCJ 5AVUB 1RQVA 2C0XA 3PLNA 1LP1B 2WZ7A 4OVNF 1FZCA 1NTMG 2FYUG 2QM7A 5AW6B 1L0NG 1W2BO 2M5AA 2OYHC 3ABVC 5DJUB 1RE4A 2GA1A 1NKZB 1KYOE 1FE6A 1HF9A 2V7QH 5CCHC 1J1EB 1GO8P 5H2FE 1N7SD 2Q6QA 1NTZE 2AEFA 3M0AA 3M0DA 3CX5I 2D2CB 5D7WA 1GO7P 1FZFA 4LC1A 1NTKE 1YI2P 3AE7C 5KLVK 5TISE 4NPFX 3CXHI 3LAAA 1PIXA 3A0HH 1CI6A 5APQA 1PP9E 4H44C 1Q82Q 2XKMA 1G1IA 3B5NA 4L74A 1YTZI 3L75G 2YIUB 3SWFA 3H1KE 1NH4A 2BCCD 2Q1KA 5KLIC 3A6ZA 4I7ZC 2XZRA 1IFJA 3CCJP 1VQ6P 2HODA 1YQ4C 3RK3E 3RL0C 3H32B 5APWA 2IZ0A 3M91A 3VOPA 1VF5C 2KOGA 1BGYJ 2C0WA 1HJBA 2J58A 2WSCJ 4JYCA 3KZIE 3H1LJ 1AFOA 3WU2E 4Y99C 2ZJ6A 2KS1B 5CVWA 4CPGA 1Q7YQ 3MUDC 5E79H 1OIPA 1KQLA 4BXLA 5APUA 4D6TG 1JY2N 1RF1C 1S9KD 1JTHB 2IBZD 2WMMA 2N1TB 1GU4A 3O6QA 4RKUJ 1N7SB 4AUWA 3GHGA 3L71E 4HH2A 2PRRA 3L72E 4K35A 2R3CA 4YXWH 1HVVA 3TGUE 1SQBE 2K1AA 1FU1A 1GK6A 1M1KQ 1IK7A 1GU5A 3AEAC 3HBVP 5KKZC 3EFGA 1FBMA 3PP5A 1KQSO 3VN0A 1IFNA 1SQXE 3HB2P 1KD1Q 3OW2O 3H1HE 1BGYD 1QGKB 3L73D 5GTIE 2FFDC 1W2EA 1JM0A 1G1JA 3VYIA 2OYHA 2A45H 1OX3A 4WVZA 1N73B 1NTZJ 1IK9A 4ASWA 4EI2A 1YQ3C 5CCHA 2K37A 1NTKJ 1L4AB 3L74D 2WSEJ 3AE8C 5APYA 3H1IG 3BASA 4RO0A 1K04A 4KHXA 1PP9J 3TNUA 3Q2YA 1SQQK 1Y47A 1FOSF 1QLED 1DD3A 1OMJA 1SATA 3H1KJ 2M3EA 3PH0A 1Q2NA 3AE4C 3RBXA 4B86A 2DW3A 4DZOA 5KAIH 1LTJB 2YXRB 3NMDA 2NPSA 3L4FA 1JMBA 1L0LG 3P8MC 4R4LA 3PHLA 3CC2P 3L70G 1PPJD 3VMAA 3SWYA 3VI1A 1M7LA 1PGOA 3FWNA 4DCKA 1PFIA 3CWBG 2Y9YA 3ZDMA 1BE3G 1VPCA 1FJPA 1BSHA 1NYHA 2WPQA 4GOFA 1NTMD 4JBZA 1AKLA 1NTKD 1SQQG 3MUDA 1H0TB 2RKLA 1K7QA 1T2KC 1RF1A 2ZYDA 4ASVA 4JPZB 1KILD 3L71J 2Q9IA 3Q5PA 2WITA 2WSCH 3L72J 2SPZA 5AW4B 3TGUJ 2POHA 1K8AQ 1SQBJ 1JY2P 2B87B 4EDFA 4W7YA 2JJLA 1MZ9A 5AW2B 4PD4D 2J5UA 2N9BA 1SQXJ 2QE7H 2W6JH 2Y0CA 1LT9C 3H1HJ 3HD7A 1S4XA 3MD0A 2E76D 5KJ7C 4HJGH 2UWJE 1HWTC 1LWUC 4C7NA 4H13C 1KB9D 4QMAA 2FFDA 3T97B 3AECC 2BCCG 3CXHD 2W83C 2QJPB 3WUUA 2XDJA 1IJDB 1SFCA 2WT7A 2K3RA 4I6MC 3NFQA 1KYOH 3M9BA 2IBZI 3D71A 2IPPA 3BCCE 1GK4A 3TGUD 3BATA 4GDOA 5H2FH 1J1DB 1SVFA 5KLVD 2BEZF 1LTIC 5CCGD 2E74C 1NO4A 3TF5A 1SP4A 3FX0A 1KILB 1FS0E 3EWKA 3HE4A 5TISH 5AVTB 2WSEH 5AW5B 2A06G 4Z1MH 1URQD 2IBZG 1QVGO 2IDBA 1IFDA 1W5CE 1DEBA 1USDA 1VQLP 5CJ0A 3TK1A 2JP3A 1EZVE 1IFPA 1ZXGA 1E5WA 3L37A 1MUUA 1M1JA 3UIAA 1GL2D 2KXPB 1FDIA 1HUCA 2M8RA 3K5BA 3CCEP 3HE5A 1YJWP 1J1EC 3CCLP 1Q90D 1EQ7A 3AEGC 1RQUA 1OVVA 3U1AA 1KTMA 3M06A 1SQPE 1CZQA 3C9IA 2ML2A 3W67A 3WUTA 3BRVB 3MP7B 1NAYA 3KZIH 1BGYG 3WMM0 1CW5A 2Y0DA 2JWDA 3WU2H 2AEMA 3WP8A 2ZAEB 4IFMA 5KAFE 2W6AA 1R5SA 1LTGC 3CMEP 1NU1E 4NPEA 2KNCB 3L35A 3CL3D 3B8EB 2R5BA 2XNDH 1KMIZ 4XFJA 1NTZK 4W80A 3AE6C 1KQGB 1ZLLA 1NTKK 1VQNP 1LT9A 3RK2B 5AVQB 1URQB 2K9JA 2KLUA 5KJ7A 1AVYA 3B5ND 1LWUA 2JKVA 3H1JE 3G3ZA 4IL6E 2KSEA 1FDOA 1GL2B 1PPJG 1LGHB 5GTIH 2JEEA 2N1TC 1K7IA 3BCCJ 1N86A 1FJKA 1N7SC 1JY3N 1PGQA 4JF7A 2KIKA 3I5CA 1WT6A 3SSUA 1EXIA 3EQ2A 3CCQP 4BWNA 4O9BA 4OH8B 2E5TA 1SQQD 5EFWB 1NTKG 1X9VA 1HH0A 1PL5A 4NPDA 4PD4I 2M5AB 2YO3A 2Z5IA 2O3JA 3KDPB 5APVA 3MTUE 1PP9G 4KJMA 2C9NY 1VQ8P 3SFEC 1K7GA 2ZVNB 3Q1MA 4EIJA 1Q86Q 1N8RQ 1EDJA 1ZOYC 3QH9A 1DIPA 3H1KG 5CBOA 1IFMA 1IFIA 1VDFA 1N73C 2KYVA 1SQBK 1AVOA 2CK3H 5APSA 1SQPJ 2E43A 5AVYB 1KB9I 1KORA 1P84E 2PGDA 2NRGA 1L4AC 2XNXA 2Y9ZA 1YITP 2FYUE 3V2RA 3MGNA 1SQXK 2OTJP 4W7ZA 4LGDE 1L0NE 3CMAP 3LA9A 4GKGA 1NU1J 2WWWA 1OXZA 3V4QA 2HODB 4DOJA 1LTJC 1LTAC 3OJAB 3P8CE 5AW0B 4C7RA 1X79B 2XU6A 2YMYA 1X0TA 1EZVD 1VQ5P 5CCHD 3V2QA 2WQYC 3L72G 3H32A 3TGUG 1O0QA 1S1CX 1ZR2A 1SQBG 1YHQP 4WB4A 1OW6A 1NHLA 2Q7CA 2E75D 1GTWA 5KLVG 2E5YA 2FXPA 4GIFA 2JDIH 2VRSA 3H1JJ 2A06D 3P7KA 3CX5E 4KT0J 1SQPD 1BCCE 1OZHA 3L75E 3CC4P 4UB6E 1E79H 2KS1A 1H8AA 3VTPC 4I2LC 3GHGB 1JOCA 2NPSD 1MFZA 1JTHA 3E7KA 4XE5B 2FBWC 3VMZA 2N1TA
chains in the Genus database with same CATH topology
1AKLA 3VP9A 3OA7A 3MUDA 1K7QA 5CMZA 1T2KC 1YTZT 3CLQA 4WY4D 3M0DC 3V2NA 1JMMA 1RF1A 2CPSA 2O1JA 2Q9IA 1KILD 2WITA 2WSCH 3N4XA 2IFNA 2H43A 5AW4B 2POHA 1JY3P 1JY2P 4IFFA 1FZEA 4W7YA 2KP8A 4N78D 5AVVB 2JJLA 2P2UA 1XTGB 3CI9A 1MZ9A 5AW2B 5KTBA 3B5NC 1IO4A 2N1TD 5AW9B 3A5TA 1RY3A 3O8ZA 4GT1A 4XA4A 2HLOA 2OYHB 1Z56A 2KB7P 2N9BA 4WBAA 2AGMA 1CI6B 1FAVA 2R5DA 1LT9C 3HD7A 2C9LY 3B5NB 3MD0A 3H6PA 2W27A 5CHXA 5KJ7C 2KSJA 1KFNA 2OARA 3A2AA 4JYBA 1N73A 2O01H 2J59M 2BASA 1LT9B 4AYCA 1HWTC 1LWUC 1RE3C 1OWAA 4C7NA 2FFDA 1HGVA 3TNUB 1X8YA 5AVXB 1HBWA 1L4AA 4N78E 5CCGA 5APTA 2NPSC 2XDJA 1NTMK 2Z8ZA 1IJDB 1SFCA 2QM8A 2H7HA 5AVRB 2WT7A 3HBUP 3HD7D 1LWUB 2YKOA 5AVZB 2XQHA 1GZLA 1URQA 4I6MC 3NFQA 2ZJ7A 4WY4C 3V2PA 3M9BA 1KAPP 1KZUB 2NPSB 2HYNA 2IPPA 1JNMA 4RESB 3IFMA 2YKQA 1T3UA 2YNYA 1GK4A 3BATA 1ZR4A 1J1DB 3LIDA 1SVFA 1RF0A 1LTJA 4WY4B 1L4AD 1LTIC 1OM8A 5CCGD 1NO4A 3E1IA 1SP4A 1KILB 3HE4A 1QL1A 3TSIA 1SFCD 2E42A 1SMPA 2ZXEB 3HDAP 5AVTB 4AQRD 2WSEH 5AW5B 4HYTB 1URQD 4IFDK 1SRPA 2PAJA 1IFDA 2W6BA 2ZVDA 2WPRA 3P32A 1DEBA 1N7LA 5CJ0A 1LTSC 3TK1A 2Q3IA 1FOSE 5AVUB 3L36A 1MV8A 2C0XA 2CPBA 1QL2A 2HPCB 1N7SA 3RL0D 1E5WA 2WZ7A 1MUUA 3L37A 1M1JA 1FZCA 3UIAA 2YKPA 3IR9A 1GL2D 5AVWB 2I1KA 1GW3A 5AW7B 2P7JA 1HUCA 1JY3O 1N2DC 1JY2O 2M8RA 2QM7A 4N6JA 2QUAA 5AW6B 3HE5A 1J1EC 2H8PD 1KFMA 1EQ7A 1IC2A 1JO5A 2HFED 5BU5A 2OYHC 1T3JA 3U1AA 1RE4A 3M06A 1NKZB 1CZQA 3C9IA 2WPSA 3NTNA 3M9QA 3V4WA 3U1CA 2ML2A 3HD7C 5CCHC 1J1EB 3ULTA 3BRVB 3VMXA 1GO8P 1N7SD 3WMM0 1CW5A 2Z8XA 3RK3D 3M0AA 3M0DA 2A45I 5D7WA 4I35A 1GO7P 1FZFA 1DX7A 4LC1A 1L0LK 3HD7B 3HUSC 3BVHA 3WP8A 1H88A 3A3YB 5KLVK 4IFMA 2Z4EA 2W6AA 3LAAA 1LTGC 5AVSB 1SQPK 2I1JA 2MJZA 2P67A 1CI6A 5APQA 3BRTB 3L35A 2XKMA 1SFCC 3CL3D 3B8EB 3RK2C 1G1IA 3B5NA 2R5BA 3HUSB 4C7NB 2A45G 3MIWA 1YTZI 5BU8B 1NTZK 4W80A 3U1RA 2GM4A 1T2KD 3SWFA 5AW8B 1NH4A 1ZLLA 1NTKK 1SFCB 3A6ZA 3V5BA 1LT9A 1J1DC 3RK2B 1T8ZA 5AVQB 2ZFCA 2XZRA 3T97A 1IFJA 2GUVA 2HODA 1URQB 1RF0C 3NXSA 5KJ7A 3RL0C 1NU1K 2WSFH 3H32B 5CJ4A 1CSBA 5APWA 1JUNA 1GL2C 1KILC 3M91A 3VOPA 2KOGA 3HRNA 2C0WA 1HJBA 3B5ND 1LWUA 1RE3A 1NOHA 1FZAA 2J58A 3HTKA 2OYIC 3G3ZA 2FXMA 1ZV8A 5BVZA 1SLQA 4JYCA 3RL0B 3LW5H 5CXLA 1GL2B 1LGHB 1AF0A 2XV5A 1AFOA 3HE4B 2JEEA 4Y99C 2N1TC 4C46A 2ZJ6A 1H89A 1ZN5A 5CVWA 1K7IA 1XTCC 1N86A 1FJKA 2OYIB 2IX7C 1KQLA 1J2JB 1N7SC 5APUA 5KJ7D 1JY3N 3RK3C 1JY2N 1RF1C 1JCCA 4WY4A 1M1JC 1S9KD 1G9KA 3A7OA 1G2CA 1LTBC 1JTHB 4JF7A 1A02F 4LLHA 4Y99B 2N1TB 3I5CA 1GU4A 1WT6A 3U59A 3EQ2A 1JIWP 1N7SB 4AUWA 4O9BA 3RK3B 3GHGA 4HH2A 4OH8B 1RF1B 1M1JB 1RE4C 2R3CA 1LTTC 1HVVA 1X9VA 3II6A 2HG5D 1HH0A 1P9HA 4ZKUA 1FU1A 1GK6A 2Q5UA 2HPCA 2YO3A 1GU5A 2Z5IA 3KDPB 5APVA 3HBVP 3MTUE 1HTLC 3KQGA 3VP8A 4N3YB 2C9NY 1FZBA 3OAKA 1NWQA 1HGZA 1K7GA 3EFGA 2YO0A 2YO1A 2R32A 4EIJA 1FBMA 3PP5A 1SQVK 3VN0A 1IFNA 3HB2P 3M9HA 2IFMA 1IFMA 1IFIA 1S9KE 1VDFA 1N73C 3P8CD 2KYVA 1H71P 1GW4A 1SQBK 2O1KA 2M3BA 2E43A 5APSA 5AVYB 2FFDC 1W2EA 2KLVA 1G1JA 3VYIA 2WTYA 1A02J 2OYHA 2A45H 1L4AC 4ZKPA 5CCGC 5AW1B 1N73B 2XNXA 1IK9A 1NAFA 4EOTA 1O0TA 2P1JA 3V2RA 3MGNA 2GUSA 4M3LA 1SQXK 1URQC 5APXA 5CCHA 2FFDB 1AQ5A 4W7ZA 3S6LA 3KYQA 4LGDE 1L4AB 1JCDA 1FDMA 5APYA 3LA9A 3BASA 4GKGA 2WWWA 1OM6A 2WT7B 1YYCA 4KHXA 1OXZA 3HUSA 4I1LA 3TNUA 3V4QA 2HODB 4DOJA 1LTJC 1SQQK 1LTAC 3OJAB 1DH3A 3KPEA 1FOSF 2LKMA 3P8CE 5AW0B 1OMJA 1OM7A 4C7RA 1FZGA 1SATA 1X79B 3TYYA 3R2PA 2XU6A 2YMYA 2FYUK 2YO2A 1WRGA 1NKNA 2PP6A 5CCHD 3V2QA 4B86A 3HTKB 1L0NK 4DZOA 1LTJB 2QUBA 3NMDA 3VMYA 3LIEA 2L5GB 1GDTA 3H32A 1O0QA 2NPSA 1ZR2A 4WB4A 3L4FA 3P8MC 1NHLA 2Q7CA 1GTWA 4GIFA 2FKWB 3SWYA 3VI1A 1M7LA 2VRSA 1FZCC 3GHGC 3P7KA 1PFIA 1G2CB 1GL2A 1KILA 2FYZA 3A70A 3RK2D 1H8AA 2Z5HA 1VPCA 3VTPC 1GD2E 1FJPA 2OYIA 3N7NA 4I2LC 1FZCB 3GHGB 1JOCA 2NPSD 2WPQA 1MFZA 1JTHA 5AW3B 4XE5B 3VMZA 3HE5B 2N1TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AKL A;  5AVY B;  1OM8 A;  1K7Q A;  5CMZ A;  1T2K C;  1SP4 A;  3A6Z A;  3V5B A;  3VYI A;  2WTY A;  1A02 J;  3HE4 A;  5AVQ B;  2E42 A;  2ZFC A;  2XZR A;  3T97 A;  1SMP A;  2ZXE B;  3HDA P;  5AW1 B;  3NXS A;  5AVT B;  4AQR D;  5AW5 B;  4HYT B;  1SRP A;  1CSB A;  5APW A;  5AW4 B;  1JUN A;  3M91 A;  1NAF A;  1O0T A;  4EOT A;  2ZVD A;  2WPR A;  3P32 A;  3MGN A;  4M3L A;  5APX A;  3TK1 A;  2Q3I A;  1FOS E;  1HJB A;  3S6L A;  2KP8 A;  3HTK A;  5AVV B;  2JJL A;  2P2U A;  5AVU B;  3L36 A;  5AW2 B;  1MV8 A;  1SLQ A;  4JYC A;  5APY A;  1IO4 A;  3LA9 A;  4GKG A;  5AW9 B;  2WWW A;  5CXL A;  3A5T A;  1OM6 A;  3L37 A;  1MUU A;  1YYC A;  2WT7 B;  4KHX A;  2XV5 A;  4GT1 A;  3O8Z A;  3UIA A;  1AF0 A;  3IR9 A;  1OXZ A;  3HE4 B;  5AVW B;  4C46 A;  5AW7 B;  3TNU A;  2N9B A;  2P7J A;  1HUC A;  2QM7 A;  3V4Q A;  1H89 A;  2QUA A;  2ZJ6 A;  5CVW A;  1K7I A;  2AGM A;  1DH3 A;  1CI6 B;  1FOS F;  5AW6 B;  1FAV A;  3HE5 A;  1KQL A;  1J2J B;  5APU A;  5AW0 B;  2R5D A;  1OMJ A;  2E43 A;  1OM7 A;  1SAT A;  3TYY A;  2C9L Y;  1G9K A;  1S9K D;  3A7O A;  3MD0 A;  2XU6 A;  2W27 A;  3M06 A;  2YO2 A;  1A02 F;  1CZQ A;  3A2A A;  2WPS A;  3I5C A;  3NTN A;  4JYB A;  3V4W A;  4B86 A;  4DZO A;  1GU4 A;  2QUB A;  3NMD A;  3VMY A;  3LIE A;  1JIW P;  2ML2 A;  1O0Q A;  3ULT A;  3VMX A;  4AUW A;  2BAS A;  1GO8 P;  4AYC A;  1HWT C;  1OWA A;  3P8M C;  4C7N A;  2Q7C A;  1GTW A;  2Z8X A;  2R3C A;  3M0A A;  3M0D A;  3TNU B;  1X8Y A;  5AVX B;  1HBW A;  3VI1 A;  5D7W A;  4I35 A;  1GO7 P;  5APT A;  1P9H A;  1GK6 A;  2VRS A;  4LC1 A;  2Q5U A;  2YO3 A;  3P7K A;  2Z5I A;  1GU5 A;  1H88 A;  2Z8Z A;  3WP8 A;  1G2C B;  3A3Y B;  3KDP B;  2QM8 A;  2H7H A;  5APV A;  2W6A A;  5AVR B;  3KQG A;  2WT7 A;  3HBV P;  3HBU P;  5AVZ B;  2XQH A;  2C9N Y;  3LAA A;  3OAK A;  1NWQ A;  1GZL A;  5AVS B;  4I6M C;  3NFQ A;  1K7G A;  3A70 A;  2P67 A;  1H8A A;  2Z5H A;  2YO0 A;  2ZJ7 A;  3VTP C;  2YO1 A;  2R32 A;  1GD2 E;  1CI6 A;  5APQ A;  3M9B A;  4I2L C;  3L35 A;  1KAP P;  3B8E B;  2IPP A;  3VN0 A;  1JNM A;  4RES B;  3HB2 P;  2R5B A;  2YNY A;  2WPQ A;  3M9H A;  4C7N B;  1MFZ A;  1GK4 A;  1S9K E;  5AW3 B;  4XE5 B;  3LID A;  1H71 P;  3U1R A;  3VMZ A;  3HE5 B;  1T2K D;  3SWF A;  5AW8 B;  5APS A; 
#chains in the Genus database with same CATH topology
 1KN7 A;  3IAO A;  2QSI A;  3OA7 A;  2FYN C;  4WY4 D;  3V2N A;  2O1J A;  1NU1 D;  1VF5 D;  3N4X A;  2IFN A;  3V6I A;  1JY3 P;  4IFF A;  4N78 D;  1JB0 J;  3CI9 A;  2P2U A;  1IO4 A;  2R3S A;  1RY3 A;  2W90 A;  4XA4 A;  2HLO A;  2OYH B;  1R8E A;  3H1L D;  3PRJ A;  1FAV A;  2JR8 A;  2H89 C;  2C9L Y;  3LW5 J;  4IL6 X;  3H1J D;  1KFN A;  4JYB A;  1N73 A;  2QJP C;  1NJI Q;  3MZW B;  2E75 B;  3EFF K;  2QJY B;  3TNU B;  2FYU J;  5AVX B;  1S2E A;  2QRX A;  1L4A A;  1L0N J;  1AV1 A;  3HBU P;  3HD7 D;  2YKO A;  2XQH A;  2ZJ7 A;  1BSN A;  3V2P A;  2NPS B;  2HYN A;  2W8Z A;  3IFM A;  2YNY A;  1T3U A;  1EDI A;  3RGU A;  1AJY A;  1PGP A;  3LID A;  1LTJ A;  4WY4 B;  1S5L E;  1OM8 A;  1KYO D;  4PJ0 H;  1R5L A;  2JWA A;  1X22 A;  1QL1 A;  2E42 A;  1SFC D;  1SMP A;  2ZXE B;  3CC7 P;  5KAF H;  1LT1 A;  2KI7 B;  1USE A;  2ZVD A;  2WPR A;  1NTZ D;  2OTK E;  1N7L A;  4JQ0 D;  1KV4 A;  1BCC J;  3AEB C;  3L36 A;  3L75 J;  4IOI H;  2CPB A;  1P84 D;  2HPC B;  3IR9 A;  1GW3 A;  5AW7 B;  4N6J A;  1JY2 O;  1PP9 D;  2H8P D;  1L0L E;  1JO5 A;  2HFE D;  5BU5 A;  1H0T A;  1T3J A;  4ZNC A;  3H1K D;  4K3A A;  3NTN A;  3M9Q A;  4TT3 H;  3U1C A;  1S72 P;  1VQK P;  3CWB E;  4IL6 H;  3VMX A;  2Y0E A;  2B87 A;  2Z8X A;  2AXT H;  3RK3 D;  2A45 I;  4I35 A;  3HD7 B;  3BVH A;  2Z4E A;  3R4Y A;  1OVU A;  4OWF A;  1SQP K;  2I1J A;  2MJZ A;  2QJK B;  4GOD A;  1EZV I;  3RK2 C;  4DT5 A;  3HUS B;  4C7N B;  2A45 G;  1QEX A;  3MIW A;  3SFD C;  1S3J A;  3U1R A;  2GM4 A;  1WMK A;  2K9Y A;  1T2K D;  5AW8 B;  2QG4 A;  1OW8 A;  1BCC D;  1SFC B;  4WWI A;  2ZFC A;  3T97 A;  2GUV A;  1RF0 C;  3NXS A;  1NU1 K;  5CJ4 A;  3L71 D;  3JC2 2;  1VQ4 P;  3L72 D;  1GL2 C;  1EZV G;  2K88 A;  2BEQ D;  1SQB D;  4OGQ C;  1NOH A;  2B88 A;  1Y8A A;  3HTK A;  2FXM A;  2ZJS E;  5BVZ A;  2AEJ A;  3LW5 H;  1M56 D;  1PV3 A;  1AF0 A;  3HE4 B;  1P84 H;  3MHV A;  4C46 A;  1H89 A;  1RH5 B;  1ZN5 A;  1XTC C;  2YMK A;  2OYI B;  1SQX D;  1DD4 A;  1SQP G;  2IX7 C;  2FXO A;  5KJ7 D;  3F89 A;  1G2C A;  3H1H D;  4LLH A;  3U59 A;  4H13 D;  5K5G B;  1OFC X;  3S1K A;  1SQV E;  5GTH E;  4EYY Q;  3RK3 B;  1M1J B;  1RE4 C;  5DJT B;  1LTT C;  1Q81 Q;  2WSS H;  3II6 A;  2E76 B;  2Q5U A;  1NU1 G;  3JSV C;  1HTL C;  2D2C C;  3VP8 A;  2IZ1 A;  4U7J A;  4N3Y B;  1FZB A;  3C1L A;  1OW7 A;  5M1B A;  3M9H A;  1L0L J;  4L73 A;  1S9K E;  2IBZ E;  1H71 P;  2KZI A;  1GW4 A;  4PV1 D;  4PJ0 E;  3G9R A;  3H1L G;  1L2P A;  3CWB J;  2B89 A;  2YIU C;  1MFT A;  4ZKP A;  3CX5 H;  2ZXX A;  4UB6 H;  3FWL A;  3H1J G;  4M3L A;  2GUS A;  4DJG A;  3AEF C;  5APX A;  1QVF O;  3KYQ A;  1S5L X;  1JCD A;  1JEK A;  3IF4 A;  1KC8 Q;  1NVO A;  1UII A;  2KNC A;  1YYC A;  5CBN A;  1U7M A;  4BRY B;  4I1L A;  3TDK A;  2K9J B;  1DH3 A;  3KPE A;  1KYO I;  1FZG A;  3TYY A;  3R2P A;  2FYU K;  3L73 E;  5L8R J;  2YO2 A;  1L0N K;  3GMA A;  2AXT E;  3VMY A;  3LIE A;  3JCU E;  1EXJ A;  2G8Y A;  3A0B E;  3QWO C;  4L76 A;  3W68 A;  3RL0 g;  3Q3D A;  1P84 I;  2FKW B;  3WUV A;  3GHG C;  3L74 E;  1ZP0 C;  1Y9B A;  2KUB A;  1GL2 A;  2R44 A;  1PGJ A;  4H0L D;  3A70 A;  2ZT9 D;  5B5E E;  1NTZ G;  2Z5H A;  1GD2 E;  2IYO A;  3N7N A;  2QVA A;  1FZC B;  2QA4 P;  3CD6 P;  4PV1 B;  3F5H A;  3D70 A;  1LP1 A;  4U3F E;  1YTZ T;  1SQV J;  2B9B A;  3G71 P;  1PPJ E;  2H43 A;  1PZQ A;  2QIW A;  3GW6 A;  1FZE A;  2WSF J;  5KTB A;  2N1T D;  2MKV A;  3A5T A;  1MKM A;  2P58 A;  1ZME C;  1S5L H;  1K05 A;  2G3A A;  1CI6 B;  2WVR A;  1VQO P;  1U57 A;  2E75 C;  1NTM E;  3BCC D;  3B5N B;  2QJY C;  1KIL E;  2O01 H;  1VQP P;  3AED C;  3G4S P;  4AYC A;  1RE3 C;  3GLM A;  1OWA A;  2M0B A;  2LXC B;  3D6Z A;  1HGV A;  1HBW A;  1BCC G;  2NPS C;  4H0L B;  4A7P A;  2FY8 A;  2Z8Z A;  2H7H A;  5AVR B;  3L71 G;  2ZT9 B;  5AVZ B;  2I8D A;  4PD4 E;  4WY4 C;  1SQV D;  1KAP P;  2OYO A;  1JNM A;  2Q3E A;  2L91 A;  1ZR4 A;  2ITA A;  3L73 J;  1M8O B;  1L4A D;  3E1I A;  4H44 D;  1SQX G;  1SS1 A;  3HDA P;  1KB9 E;  1OVR A;  4AQR D;  3O6Q B;  3S4R A;  5TJH A;  4IFD K;  3CXH E;  3H1H G;  2PAJ A;  2W6B A;  3P32 A;  2V4H A;  1LTS C;  3FXE A;  3L74 J;  3CPW O;  2Q3I A;  1FOS E;  4R4M A;  4MN4 C;  2AXC A;  1MV8 A;  1QL2 A;  1N7S A;  3RL0 D;  2YKP A;  5AVW B;  2I1K A;  2P7J A;  2QUA A;  1JY3 O;  1N2D C;  3GF7 A;  3GG2 A;  1KFM A;  1IC2 A;  5KLV E;  4U3F J;  3C8V A;  1UIX A;  4D6T E;  4ZMD A;  3V4W A;  1HJ0 A;  2WPS A;  3HD7 C;  3ULT A;  1M57 D;  2QJK C;  2KK7 A;  1TU3 F;  3SWK A;  1DX7 A;  5B66 E;  1L0L K;  3HUS C;  1H88 A;  2P10 A;  3A3Y B;  2O01 N;  5AVS B;  2P67 A;  3BRT B;  3Q5R A;  1SFC C;  1NTM J;  1EC5 A;  5GTH H;  2N9Y B;  3AE1 C;  5BU8 B;  2QEX P;  2HR3 A;  4GOE A;  2JO1 A;  4H44 B;  3V5B A;  1J1D C;  1T8Z A;  3I55 P;  2IYP A;  2WSF H;  1CSB A;  1JUN A;  1KIL C;  3HRN A;  5KLI B;  1RE3 A;  3CCR P;  1FZA A;  4I7Z B;  2OYI C;  1ZV8 A;  1SLQ A;  3RL0 B;  3AE2 C;  4U3F D;  2H88 C;  5CXL A;  1U7J A;  1IZN B;  2XV5 A;  1VF5 B;  3H1I E;  1ZRT E;  1J2J B;  3RK3 C;  3IN6 A;  1JCC A;  4WY4 A;  1M1J C;  1G9K A;  1EDL A;  3A7O A;  1LTB C;  3A0H E;  1A02 F;  4Y28 J;  4Y99 B;  3AE3 C;  2E76 C;  3PJS K;  1JIW P;  3Q5S A;  4YXD C;  1RF1 B;  2NZ2 A;  1GMJ A;  2HG5 D;  2FYU D;  1P9H A;  4ZKU A;  2HPC A;  2OGU A;  3L70 E;  1L0N D;  3KQG A;  3OAK A;  1NWQ A;  2OTL P;  1HGZ A;  2YO0 A;  2YO1 A;  2R32 A;  1SQV K;  1BE3 E;  4UB8 H;  3KXD A;  2IFM A;  3JCU H;  5KKZ B;  2FYN B;  3A0B H;  5KLV J;  3P8C D;  2O1K A;  2M3B A;  4D6T J;  2KLV A;  2WTY A;  2LXB A;  3CCS P;  1A02 J;  5E79 E;  1SQQ E;  3BCC G;  5CCG C;  5AW1 B;  2RN0 A;  4YTP C;  4HB1 A;  1AA0 A;  5B5E H;  3CCM P;  1NAF A;  1O0T A;  4EOT A;  2P1J A;  3B4S A;  1QX8 A;  2FFD B;  1URQ C;  1AQ5 A;  4YPC A;  1EDK A;  3S6L A;  2PFX A;  2OQQ A;  1FDM A;  3CX5 D;  1K73 Q;  3L75 D;  4L75 A;  1OM6 A;  2WT7 B;  2RH0 A;  4DT0 A;  3HUS A;  1BDD A;  1RHZ B;  1K9M Q;  1YJ9 P;  2LKM A;  3S9O A;  1OM7 A;  3FXD A;  1VQM P;  2WPV B;  1SQV G;  1WRG A;  1NKN A;  2PP6 A;  3HTK B;  2QUB A;  2L5G B;  1GDT A;  1FZC C;  2V7Q J;  2BCC E;  1G2C B;  1KIL A;  4PV1 C;  2FYZ A;  4D6T D;  3RK2 D;  2OYI A;  3H1I J;  1D7M A;  4RJT A;  1VL2 A;  5AW3 B;  3HE5 B;  1DEE G;  2O01 J;  1BDC A;  5C39 A;  3VP9 A;  2ZYA A;  2LR2 A;  1NGM B;  5CMZ A;  3CLQ A;  3M0D C;  1JMM A;  1AQT A;  1YJN P;  2CPS A;  3RBZ A;  1OMI A;  4PD4 H;  3H25 A;  4OGQ D;  2A06 E;  5KAI E;  2KP8 A;  3L70 J;  1VQ7 P;  2E74 D;  5AVV B;  3CCU P;  1XTG B;  3AE9 C;  2KZJ A;  3B5N C;  5AW9 B;  3E1R A;  4GT1 A;  3ITK A;  3O8Z A;  1Z56 A;  2KB7 P;  1BE3 J;  4WBA A;  2AGM A;  3FGA D;  3KHU A;  3L73 G;  3B71 A;  3I56 P;  3AEE C;  1KB9 H;  2R5D A;  3H6P A;  4TLF A;  2W27 A;  3CXH H;  5CHX A;  3G6E P;  2KSJ A;  2ZVO B;  1YIJ P;  2OAR A;  3A2A A;  3PTZ A;  2YXQ B;  3GF3 A;  1SQQ J;  4H0L C;  1FC2 C;  2J59 M;  2BAS A;  1LT9 B;  2ZT9 C;  3H1I D;  2ZYG A;  3L74 G;  1T6A A;  1X8Y A;  1ZRT D;  4N78 E;  5CCG A;  5APT A;  1BGY E;  2D2C D;  3CCV P;  1KQF B;  1NTM K;  2QM8 A;  1LWU B;  4H13 B;  4BRY A;  1GZL A;  1URQ A;  4UB8 E;  4HKZ H;  3H1L E;  1ZW0 A;  1KZU B;  1YBK A;  4RES B;  2YKQ A;  2RMZ A;  3USS A;  4U3F G;  1LNQ A;  1L0L D;  1RF0 A;  3D6Y A;  3L70 D;  3AE5 C;  5B66 H;  1VQ9 P;  3TSI A;  1M90 Q;  3CWB D;  4HYT B;  4OGQ B;  1SRP A;  1BE3 D;  2E74 B;  1LJ2 A;  2BCC J;  5AVU B;  1RQV A;  2C0X A;  3PLN A;  1LP1 B;  2WZ7 A;  4OVN F;  1FZC A;  1NTM G;  2FYU G;  2QM7 A;  5AW6 B;  1L0N G;  1W2B O;  2M5A A;  2OYH C;  3ABV C;  5DJU B;  1RE4 A;  2GA1 A;  1NKZ B;  1KYO E;  1FE6 A;  1HF9 A;  2V7Q H;  5CCH C;  1J1E B;  1GO8 P;  5H2F E;  1N7S D;  2Q6Q A;  1NTZ E;  2AEF A;  3M0A A;  3M0D A;  3CX5 I;  2D2C B;  5D7W A;  1GO7 P;  1FZF A;  4LC1 A;  1NTK E;  1YI2 P;  3AE7 C;  5KLV K;  5TIS E;  4NPF X;  3CXH I;  3LAA A;  1PIX A;  3A0H H;  1CI6 A;  5APQ A;  1PP9 E;  4H44 C;  1Q82 Q;  2XKM A;  1G1I A;  3B5N A;  4L74 A;  1YTZ I;  3L75 G;  2YIU B;  3SWF A;  3H1K E;  1NH4 A;  2BCC D;  2Q1K A;  5KLI C;  3A6Z A;  4I7Z C;  2XZR A;  1IFJ A;  3CCJ P;  1VQ6 P;  2HOD A;  1YQ4 C;  3RK3 E;  3RL0 C;  3H32 B;  5APW A;  2IZ0 A;  3M91 A;  3VOP A;  1VF5 C;  2KOG A;  1BGY J;  2C0W A;  1HJB A;  2J58 A;  2WSC J;  4JYC A;  3KZI E;  3H1L J;  1AFO A;  3WU2 E;  4Y99 C;  2ZJ6 A;  2KS1 B;  5CVW A;  4CPG A;  1Q7Y Q;  3MUD C;  5E79 H;  1OIP A;  1KQL A;  4BXL A;  5APU A;  4D6T G;  1JY2 N;  1RF1 C;  1S9K D;  1JTH B;  2IBZ D;  2WMM A;  2N1T B;  1GU4 A;  3O6Q A;  4RKU J;  1N7S B;  4AUW A;  3GHG A;  3L71 E;  4HH2 A;  2PRR A;  3L72 E;  4K35 A;  2R3C A;  4YXW H;  1HVV A;  3TGU E;  1SQB E;  2K1A A;  1FU1 A;  1GK6 A;  1M1K Q;  1IK7 A;  1GU5 A;  3AEA C;  3HBV P;  5KKZ C;  3EFG A;  1FBM A;  3PP5 A;  1KQS O;  3VN0 A;  1IFN A;  1SQX E;  3HB2 P;  1KD1 Q;  3OW2 O;  3H1H E;  1BGY D;  1QGK B;  3L73 D;  5GTI E;  2FFD C;  1W2E A;  1JM0 A;  1G1J A;  3VYI A;  2OYH A;  2A45 H;  1OX3 A;  4WVZ A;  1N73 B;  1NTZ J;  1IK9 A;  4ASW A;  4EI2 A;  1YQ3 C;  5CCH A;  2K37 A;  1NTK J;  1L4A B;  3L74 D;  2WSE J;  3AE8 C;  5APY A;  3H1I G;  3BAS A;  4RO0 A;  1K04 A;  4KHX A;  1PP9 J;  3TNU A;  3Q2Y A;  1SQQ K;  1Y47 A;  1FOS F;  1QLE D;  1DD3 A;  1OMJ A;  1SAT A;  3H1K J;  2M3E A;  3PH0 A;  1Q2N A;  3AE4 C;  3RBX A;  4B86 A;  2DW3 A;  4DZO A;  5KAI H;  1LTJ B;  2YXR B;  3NMD A;  2NPS A;  3L4F A;  1JMB A;  1L0L G;  3P8M C;  4R4L A;  3PHL A;  3CC2 P;  3L70 G;  1PPJ D;  3VMA A;  3SWY A;  3VI1 A;  1M7L A;  1PGO A;  3FWN A;  4DCK A;  1PFI A;  3CWB G;  2Y9Y A;  3ZDM A;  1BE3 G;  1VPC A;  1FJP A;  1BSH A;  1NYH A;  2WPQ A;  4GOF A;  1NTM D;  4JBZ A;  1AKL A;  1NTK D;  1SQQ G;  3MUD A;  1H0T B;  2RKL A;  1K7Q A;  1T2K C;  1RF1 A;  2ZYD A;  4ASV A;  4JPZ B;  1KIL D;  3L71 J;  2Q9I A;  3Q5P A;  2WIT A;  2WSC H;  3L72 J;  2SPZ A;  5AW4 B;  3TGU J;  2POH A;  1K8A Q;  1SQB J;  1JY2 P;  2B87 B;  4EDF A;  4W7Y A;  2JJL A;  1MZ9 A;  5AW2 B;  4PD4 D;  2J5U A;  2N9B A;  1SQX J;  2QE7 H;  2W6J H;  2Y0C A;  1LT9 C;  3H1H J;  3HD7 A;  1S4X A;  3MD0 A;  2E76 D;  5KJ7 C;  4HJG H;  2UWJ E;  1HWT C;  1LWU C;  4C7N A;  4H13 C;  1KB9 D;  4QMA A;  2FFD A;  3T97 B;  3AEC C;  2BCC G;  3CXH D;  2W83 C;  2QJP B;  3WUU A;  2XDJ A;  1IJD B;  1SFC A;  2WT7 A;  2K3R A;  4I6M C;  3NFQ A;  1KYO H;  3M9B A;  2IBZ I;  3D71 A;  2IPP A;  3BCC E;  1GK4 A;  3TGU D;  3BAT A;  4GDO A;  5H2F H;  1J1D B;  1SVF A;  5KLV D;  2BEZ F;  1LTI C;  5CCG D;  2E74 C;  1NO4 A;  3TF5 A;  1SP4 A;  3FX0 A;  1KIL B;  1FS0 E;  3EWK A;  3HE4 A;  5TIS H;  5AVT B;  2WSE H;  5AW5 B;  2A06 G;  4Z1M H;  1URQ D;  2IBZ G;  1QVG O;  2IDB A;  1IFD A;  1W5C E;  1DEB A;  1USD A;  1VQL P;  5CJ0 A;  3TK1 A;  2JP3 A;  1EZV E;  1IFP A;  1ZXG A;  1E5W A;  3L37 A;  1MUU A;  1M1J A;  3UIA A;  1GL2 D;  2KXP B;  1FDI A;  1HUC A;  2M8R A;  3K5B A;  3CCE P;  3HE5 A;  1YJW P;  1J1E C;  3CCL P;  1Q90 D;  1EQ7 A;  3AEG C;  1RQU A;  1OVV A;  3U1A A;  1KTM A;  3M06 A;  1SQP E;  1CZQ A;  3C9I A;  2ML2 A;  3W67 A;  3WUT A;  3BRV B;  3MP7 B;  1NAY A;  3KZI H;  1BGY G;  3WMM 0;  1CW5 A;  2Y0D A;  2JWD A;  3WU2 H;  2AEM A;  3WP8 A;  2ZAE B;  4IFM A;  5KAF E;  2W6A A;  1R5S A;  1LTG C;  3CME P;  1NU1 E;  4NPE A;  2KNC B;  3L35 A;  3CL3 D;  3B8E B;  2R5B A;  2XND H;  1KMI Z;  4XFJ A;  1NTZ K;  4W80 A;  3AE6 C;  1KQG B;  1ZLL A;  1NTK K;  1VQN P;  1LT9 A;  3RK2 B;  5AVQ B;  1URQ B;  2K9J A;  2KLU A;  5KJ7 A;  1AVY A;  3B5N D;  1LWU A;  2JKV A;  3H1J E;  3G3Z A;  4IL6 E;  2KSE A;  1FDO A;  1GL2 B;  1PPJ G;  1LGH B;  5GTI H;  2JEE A;  2N1T C;  1K7I A;  3BCC J;  1N86 A;  1FJK A;  1N7S C;  1JY3 N;  1PGQ A;  4JF7 A;  2KIK A;  3I5C A;  1WT6 A;  3SSU A;  1EXI A;  3EQ2 A;  3CCQ P;  4BWN A;  4O9B A;  4OH8 B;  2E5T A;  1SQQ D;  5EFW B;  1NTK G;  1X9V A;  1HH0 A;  1PL5 A;  4NPD A;  4PD4 I;  2M5A B;  2YO3 A;  2Z5I A;  2O3J A;  3KDP B;  5APV A;  3MTU E;  1PP9 G;  4KJM A;  2C9N Y;  1VQ8 P;  3SFE C;  1K7G A;  2ZVN B;  3Q1M A;  4EIJ A;  1Q86 Q;  1N8R Q;  1EDJ A;  1ZOY C;  3QH9 A;  1DIP A;  3H1K G;  5CBO A;  1IFM A;  1IFI A;  1VDF A;  1N73 C;  2KYV A;  1SQB K;  1AVO A;  2CK3 H;  5APS A;  1SQP J;  2E43 A;  5AVY B;  1KB9 I;  1KOR A;  1P84 E;  2PGD A;  2NRG A;  1L4A C;  2XNX A;  2Y9Z A;  1YIT P;  2FYU E;  3V2R A;  3MGN A;  1SQX K;  2OTJ P;  4W7Z A;  4LGD E;  1L0N E;  3CMA P;  3LA9 A;  4GKG A;  1NU1 J;  2WWW A;  1OXZ A;  3V4Q A;  2HOD B;  4DOJ A;  1LTJ C;  1LTA C;  3OJA B;  3P8C E;  5AW0 B;  4C7R A;  1X79 B;  2XU6 A;  2YMY A;  1X0T A;  1EZV D;  1VQ5 P;  5CCH D;  3V2Q A;  2WQY C;  3L72 G;  3H32 A;  3TGU G;  1O0Q A;  1S1C X;  1ZR2 A;  1SQB G;  1YHQ P;  4WB4 A;  1OW6 A;  1NHL A;  2Q7C A;  2E75 D;  1GTW A;  5KLV G;  2E5Y A;  2FXP A;  4GIF A;  2JDI H;  2VRS A;  3H1J J;  2A06 D;  3P7K A;  3CX5 E;  4KT0 J;  1SQP D;  1BCC E;  1OZH A;  3L75 E;  3CC4 P;  4UB6 E;  1E79 H;  2KS1 A;  1H8A A;  3VTP C;  4I2L C;  3GHG B;  1JOC A;  2NPS D;  1MFZ A;  1JTH A;  3E7K A;  4XE5 B;  2FBW C;  3VMZ A;  2N1T A; 
#chains in the Genus database with same CATH homology
 1AKL A;  3VP9 A;  3OA7 A;  3MUD A;  1K7Q A;  5CMZ A;  1T2K C;  1YTZ T;  3CLQ A;  4WY4 D;  3M0D C;  3V2N A;  1JMM A;  1RF1 A;  2CPS A;  2O1J A;  2Q9I A;  1KIL D;  2WIT A;  2WSC H;  3N4X A;  2IFN A;  2H43 A;  5AW4 B;  2POH A;  1JY3 P;  1JY2 P;  4IFF A;  1FZE A;  4W7Y A;  2KP8 A;  4N78 D;  5AVV B;  2JJL A;  2P2U A;  1XTG B;  3CI9 A;  1MZ9 A;  5AW2 B;  5KTB A;  3B5N C;  1IO4 A;  2N1T D;  5AW9 B;  3A5T A;  1RY3 A;  3O8Z A;  4GT1 A;  4XA4 A;  2HLO A;  2OYH B;  1Z56 A;  2KB7 P;  2N9B A;  4WBA A;  2AGM A;  1CI6 B;  1FAV A;  2R5D A;  1LT9 C;  3HD7 A;  2C9L Y;  3B5N B;  3MD0 A;  3H6P A;  2W27 A;  5CHX A;  5KJ7 C;  2KSJ A;  1KFN A;  2OAR A;  3A2A A;  4JYB A;  1N73 A;  2O01 H;  2J59 M;  2BAS A;  1LT9 B;  4AYC A;  1HWT C;  1LWU C;  1RE3 C;  1OWA A;  4C7N A;  2FFD A;  1HGV A;  3TNU B;  1X8Y A;  5AVX B;  1HBW A;  1L4A A;  4N78 E;  5CCG A;  5APT A;  2NPS C;  2XDJ A;  1NTM K;  2Z8Z A;  1IJD B;  1SFC A;  2QM8 A;  2H7H A;  5AVR B;  2WT7 A;  3HBU P;  3HD7 D;  1LWU B;  2YKO A;  5AVZ B;  2XQH A;  1GZL A;  1URQ A;  4I6M C;  3NFQ A;  2ZJ7 A;  4WY4 C;  3V2P A;  3M9B A;  1KAP P;  1KZU B;  2NPS B;  2HYN A;  2IPP A;  1JNM A;  4RES B;  3IFM A;  2YKQ A;  1T3U A;  2YNY A;  1GK4 A;  3BAT A;  1ZR4 A;  1J1D B;  3LID A;  1SVF A;  1RF0 A;  1LTJ A;  4WY4 B;  1L4A D;  1LTI C;  1OM8 A;  5CCG D;  1NO4 A;  3E1I A;  1SP4 A;  1KIL B;  3HE4 A;  1QL1 A;  3TSI A;  1SFC D;  2E42 A;  1SMP A;  2ZXE B;  3HDA P;  5AVT B;  4AQR D;  2WSE H;  5AW5 B;  4HYT B;  1URQ D;  4IFD K;  1SRP A;  2PAJ A;  1IFD A;  2W6B A;  2ZVD A;  2WPR A;  3P32 A;  1DEB A;  1N7L A;  5CJ0 A;  1LTS C;  3TK1 A;  2Q3I A;  1FOS E;  5AVU B;  3L36 A;  1MV8 A;  2C0X A;  2CPB A;  1QL2 A;  2HPC B;  1N7S A;  3RL0 D;  1E5W A;  2WZ7 A;  1MUU A;  3L37 A;  1M1J A;  1FZC A;  3UIA A;  2YKP A;  3IR9 A;  1GL2 D;  5AVW B;  2I1K A;  1GW3 A;  5AW7 B;  2P7J A;  1HUC A;  1JY3 O;  1N2D C;  1JY2 O;  2M8R A;  2QM7 A;  4N6J A;  2QUA A;  5AW6 B;  3HE5 A;  1J1E C;  2H8P D;  1KFM A;  1EQ7 A;  1IC2 A;  1JO5 A;  2HFE D;  5BU5 A;  2OYH C;  1T3J A;  3U1A A;  1RE4 A;  3M06 A;  1NKZ B;  1CZQ A;  3C9I A;  2WPS A;  3NTN A;  3M9Q A;  3V4W A;  3U1C A;  2ML2 A;  3HD7 C;  5CCH C;  1J1E B;  3ULT A;  3BRV B;  3VMX A;  1GO8 P;  1N7S D;  3WMM 0;  1CW5 A;  2Z8X A;  3RK3 D;  3M0A A;  3M0D A;  2A45 I;  5D7W A;  4I35 A;  1GO7 P;  1FZF A;  1DX7 A;  4LC1 A;  1L0L K;  3HD7 B;  3HUS C;  3BVH A;  3WP8 A;  1H88 A;  3A3Y B;  5KLV K;  4IFM A;  2Z4E A;  2W6A A;  3LAA A;  1LTG C;  5AVS B;  1SQP K;  2I1J A;  2MJZ A;  2P67 A;  1CI6 A;  5APQ A;  3BRT B;  3L35 A;  2XKM A;  1SFC C;  3CL3 D;  3B8E B;  3RK2 C;  1G1I A;  3B5N A;  2R5B A;  3HUS B;  4C7N B;  2A45 G;  3MIW A;  1YTZ I;  5BU8 B;  1NTZ K;  4W80 A;  3U1R A;  2GM4 A;  1T2K D;  3SWF A;  5AW8 B;  1NH4 A;  1ZLL A;  1NTK K;  1SFC B;  3A6Z A;  3V5B A;  1LT9 A;  1J1D C;  3RK2 B;  1T8Z A;  5AVQ B;  2ZFC A;  2XZR A;  3T97 A;  1IFJ A;  2GUV A;  2HOD A;  1URQ B;  1RF0 C;  3NXS A;  5KJ7 A;  3RL0 C;  1NU1 K;  2WSF H;  3H32 B;  5CJ4 A;  1CSB A;  5APW A;  1JUN A;  1GL2 C;  1KIL C;  3M91 A;  3VOP A;  2KOG A;  3HRN A;  2C0W A;  1HJB A;  3B5N D;  1LWU A;  1RE3 A;  1NOH A;  1FZA A;  2J58 A;  3HTK A;  2OYI C;  3G3Z A;  2FXM A;  1ZV8 A;  5BVZ A;  1SLQ A;  4JYC A;  3RL0 B;  3LW5 H;  5CXL A;  1GL2 B;  1LGH B;  1AF0 A;  2XV5 A;  1AFO A;  3HE4 B;  2JEE A;  4Y99 C;  2N1T C;  4C46 A;  2ZJ6 A;  1H89 A;  1ZN5 A;  5CVW A;  1K7I A;  1XTC C;  1N86 A;  1FJK A;  2OYI B;  2IX7 C;  1KQL A;  1J2J B;  1N7S C;  5APU A;  5KJ7 D;  1JY3 N;  3RK3 C;  1JY2 N;  1RF1 C;  1JCC A;  4WY4 A;  1M1J C;  1S9K D;  1G9K A;  3A7O A;  1G2C A;  1LTB C;  1JTH B;  4JF7 A;  1A02 F;  4LLH A;  4Y99 B;  2N1T B;  3I5C A;  1GU4 A;  1WT6 A;  3U59 A;  3EQ2 A;  1JIW P;  1N7S B;  4AUW A;  4O9B A;  3RK3 B;  3GHG A;  4HH2 A;  4OH8 B;  1RF1 B;  1M1J B;  1RE4 C;  2R3C A;  1LTT C;  1HVV A;  1X9V A;  3II6 A;  2HG5 D;  1HH0 A;  1P9H A;  4ZKU A;  1FU1 A;  1GK6 A;  2Q5U A;  2HPC A;  2YO3 A;  1GU5 A;  2Z5I A;  3KDP B;  5APV A;  3HBV P;  3MTU E;  1HTL C;  3KQG A;  3VP8 A;  4N3Y B;  2C9N Y;  1FZB A;  3OAK A;  1NWQ A;  1HGZ A;  1K7G A;  3EFG A;  2YO0 A;  2YO1 A;  2R32 A;  4EIJ A;  1FBM A;  3PP5 A;  1SQV K;  3VN0 A;  1IFN A;  3HB2 P;  3M9H A;  2IFM A;  1IFM A;  1IFI A;  1S9K E;  1VDF A;  1N73 C;  3P8C D;  2KYV A;  1H71 P;  1GW4 A;  1SQB K;  2O1K A;  2M3B A;  2E43 A;  5APS A;  5AVY B;  2FFD C;  1W2E A;  2KLV A;  1G1J A;  3VYI A;  2WTY A;  1A02 J;  2OYH A;  2A45 H;  1L4A C;  4ZKP A;  5CCG C;  5AW1 B;  1N73 B;  2XNX A;  1IK9 A;  1NAF A;  4EOT A;  1O0T A;  2P1J A;  3V2R A;  3MGN A;  2GUS A;  4M3L A;  1SQX K;  1URQ C;  5APX A;  5CCH A;  2FFD B;  1AQ5 A;  4W7Z A;  3S6L A;  3KYQ A;  4LGD E;  1L4A B;  1JCD A;  1FDM A;  5APY A;  3LA9 A;  3BAS A;  4GKG A;  2WWW A;  1OM6 A;  2WT7 B;  1YYC A;  4KHX A;  1OXZ A;  3HUS A;  4I1L A;  3TNU A;  3V4Q A;  2HOD B;  4DOJ A;  1LTJ C;  1SQQ K;  1LTA C;  3OJA B;  1DH3 A;  3KPE A;  1FOS F;  2LKM A;  3P8C E;  5AW0 B;  1OMJ A;  1OM7 A;  4C7R A;  1FZG A;  1SAT A;  1X79 B;  3TYY A;  3R2P A;  2XU6 A;  2YMY A;  2FYU K;  2YO2 A;  1WRG A;  1NKN A;  2PP6 A;  5CCH D;  3V2Q A;  4B86 A;  3HTK B;  1L0N K;  4DZO A;  1LTJ B;  2QUB A;  3NMD A;  3VMY A;  3LIE A;  2L5G B;  1GDT A;  3H32 A;  1O0Q A;  2NPS A;  1ZR2 A;  4WB4 A;  3L4F A;  3P8M C;  1NHL A;  2Q7C A;  1GTW A;  4GIF A;  2FKW B;  3SWY A;  3VI1 A;  1M7L A;  2VRS A;  1FZC C;  3GHG C;  3P7K A;  1PFI A;  1G2C B;  1GL2 A;  1KIL A;  2FYZ A;  3A70 A;  3RK2 D;  1H8A A;  2Z5H A;  1VPC A;  3VTP C;  1GD2 E;  1FJP A;  2OYI A;  3N7N A;  4I2L C;  1FZC B;  3GHG B;  1JOC A;  2NPS D;  2WPQ A;  1MFZ A;  1JTH A;  5AW3 B;  4XE5 B;  3VMZ A;  3HE5 B;  2N1T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...