3NTNA

Crystal structure of uspa1 head and neck domain from moraxella catarrhalis
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
214
structure length
211
Chain Sequence
ENSTVGGGGYNQAKGRNSTVAGGYNNEATGTDSTIAGGRKNQATGKGSFAAGIDNKANADNAVALGNKNTIEGENSVAIGSNNTVKKGQQNVFILGSNTDTTNAQNGSVLLGHNTAGKAATIVNSAEVGGLSLTGFAGASNGTVSVGKKGKERQIVHVGAGEISDTSTDAVNGSQLHALATVVAQNKADIKDLDDEVGLLGEEINKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords UspA1
publication title Correlation of in situ mechanosensitive responses of the Moraxella catarrhalis adhesin UspA1 with fibronectin and receptor CEACAM1 binding.
pubmed doi rcsb
source organism Moraxella catarrhalis
total genus 71
structure length 211
sequence length 214
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
A PF18792 UspA1_rep Ubiquitous surface protein adhesin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3ntnA02
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3ntnA01
3V4QA 4RESB 3HDAP 3TK1A 1GO8P 3ULTA 1OWAA 4AQRD 1X8YA 2AGMA 3LA9A 1SMPA 1GU4A 1FOSF 4I6MC 3VMYA 3M0AA 5APVA 4M3LA 3U1RA 3M91A 2ZJ7A 5APWA 1OM8A 2ML2A 2Q3IA 3IR9A 4AYCA 3HBVP 5CXLA 2P2UA 2P7JA 1SP4A 2E42A 5AVXB 5APTA 3NTNA 3HTKA 5AVYB 1DH3A 1P9HA 1NWQA 4JYCA 2WTYA 4DZOA 1K7GA 4KHXA 1YYCA 5AVQB 1S9KD 1S9KE 4C7NB 1GTWA 1AKLA 5AVRB 3V5BA 3HE5B 3SWFA 3NXSA 5AW4B 5D7WA 1SRPA 2R5DA 1HUCA 1SLQA 1OMJA 1FOSE 2ZJ6A 1JUNA 1CI6B 3A5TA 4I2LC 3LIEA 5APXA 1J2JB 3VYIA 2BASA 5APYA 3OAKA 1T2KD 2Z5IA 2Z5HA 3A2AA 3A7OA 1CZQA 2R32A 5AW0B 3VMXA 4EOTA 2R5BA 5AW1B 1O0QA 3HE4A 2Z8XA 1MUUA 3NMDA 5AVTB 1IO4A 1KAPP 2XQHA 4LC1A 5AW8B 2JJLA 3VTPC 1H71P 5APQA 2WWWA 5AVZB 3S6LA 3NFQA 5AVVB 3T97A 1CSBA 5AVUB 1K7IA 1GK4A 2WT7A 4I35A 3V4WA 1GU5A 1AF0A 3LIDA 2N9BA 5AW3B 2WPQA 2VRSA 1GD2E 2ZVDA 1MV8A 2XZRA 1JNMA 1OXZA 3KQGA 3O8ZA 3M9BA 4C46A 4JYBA 1GO7P 1G9KA 3M0DA 3TNUB 1KQLA 3P7KA 1JIWP 3A6ZA 2YNYA 5AVWB 2Z8ZA 3TYYA 2H7HA 2WPSA 2YO3A 4HYTB 1A02F 1HWTC 3LAAA 2R3CA 5AW5B 2W6AA 1OM6A 2ZFCA 1GK6A 5AW7B 3HB2P 4AUWA 3P32A 3A70A 3A3YB 1MFZA 1FAVA 3KDPB 3I5CA 5CMZA 5AW2B 5CVWA 3VMZA 1H89A 3MGNA 1OM7A 5AVSB 4C7NA 3L37A 3HE5A 2Q5UA 3P8MC 2Q7CA 1A02J 2WPRA 1H8AA 1O0TA 2C9NY 1H88A 4GT1A 3UIAA 5AW9B 1G2CB 2QM7A 1CI6A 2KP8A 1K7QA 3TNUA 2W27A 2E43A 3L35A 3HE4B 3M06A 5APUA 2YO0A 2ZXEB 1HJBA 2IPPA 2YO2A 4B86A 3VI1A 3B8EB 5AW6B 2XV5A 3L36A 3HBUP 1HBWA 2WT7B 3M9HA 2QUAA 2QUBA 2YO1A 4GKGA 1SATA 2XU6A 2P67A 3WP8A 1T2KC 2QM8A 3VN0A 1NAFA 3MD0A 1GZLA 4XE5B 2C9LY 5APSA
chains in the Genus database with same CATH superfamily
4U3FD 1LT9C 1QVFO 3L74E 1WMKA 2D2CC 3L73D 1FC2C 2IZ0A 3L4FA 2P2UA 1M8OB 1KZUB 1FZCC 2OTJP 1SQBD 1YYCA 3MUDC 4H0LB 1AVYA 3V5BA 2E75B 1SRPA 1HUCA 2MKVA 2YMKA 3LIEA 5CCHA 3H1JE 1USEA 3L75J 3AE4C 2NPSC 1Q82Q 3BCCJ 1GL2B 2ZJSE 5AVVB 1SQPE 3CWBD 3MZWB 2VRSA 4JBZA 2Y9YA 3H1KG 2XZRA 3KZIE 1OXZA 4GOFA 3FWNA 1KYOI 3KPEA 4WY4A 1KB9H 1VQLP 1OM6A 2IYPA 3H1ID 3A70A 1RF0C 1EZVG 2XKMA 1NU1E 1RF1C 1H89A 2RH0A 4N3YB 4JF7A 2C9NY 3VP9A 4GIFA 1LGHB 2W90A 1OVVA 4HH2A 5KJ7A 2KZJA 3Q5PA 5CBNA 3M9HA 1KORA 1VQPP 1OFCX 4U7JA 2L91A 3TGUE 4RKUJ 2M5AB 4IFMA 1M1JC 1SQQG 4A7PA 1J1EB 4M3LA 4U3FG 1ZRTE 1R5SA 3CPWO 2IBZE 1K04A 1X79B 4H44C 1AKLA 3A0HE 1OVRA 2FXOA 2O3JA 5AW4B 4WB4A 2IDBA 1BGYJ 1OIPA 1QEXA 3A7OA 5AW1B 4L74A 3L75E 2A06E 2E5TA 3NFQA 3BCCE 3AE3C 5AW3B 1RHZB 2ZVDA 5CJ0A 3AE7C 1BDCA 1VQ5P 3C1LA 3CWBG 4C46A 2QIWA 3JSVC 3CX5D 1Q81Q 4Y99C 1JEKA 1DEEG 5AW5B 2OYHB 3IF4A 3RK2B 1K8AQ 2Y0DA 3V2PA 3H1IG 2JEEA 2Z4EA 1PFIA 1IK9A 2FYNB 3EFGA 1KILB 2ZVOB 1JY2O 3VI1A 3HUSC 1GL2A 2I1KA 3AE2C 4TLFA 5KAFE 1Y9BA 1U7MA 4HKZH 3H1LD 5APSA 4DJGA 2AEMA 2FKWB 1X22A 4WBAA 3CCSP 3M91A 3IR9A 1KYOH 1SP4A 4CPGA 1FU1A 4H13D 4IL6H 2NRGA 2WVRA 3L70J 1NTMD 1GTWA 2AEJA 4I7ZB 2FYUJ 3VP8A 3CXHD 3HD7D 3VYIA 2BASA 1RE3A 1M56D 4R4MA 1BGYE 2OYIC 2Z8XA 3K5BA 1VPCA 1VQOP 3H1HJ 1Y47A 4RO0A 3W67A 1AF0A 2WITA 3TDKA 1LTBC 4GOEA 1KILE 3KQGA 2KLVA 1KQGB 1HJ0A 2W6BA 5AVWB 2FXPA 4EI2A 3JCUH 1P84D 1NYHA 3HB2P 3RK3D 3P8CD 2Q7CA 4BXLA 1FZBA 4H13B 3KYQA 3AECC 1SFCB 2KNCA 2K1AA 3T97B 2QJKB 5KLIC 3RL0C 3FXEA 2O1KA 5GTHH 3CCLP 2KXPB 2AGMA 3H1LG 1LP1B 1Q86Q 3SWKA 3AEFC 4PD4I 4EIJA 1L0LG 4C7RA 2OYHA 2V4HA 1Q90D 2LR2A 4Z1MH 1JOCA 2NZ2A 3OA7A 3L70E 2OARA 1LTJB 1NTMG 2QEXP 2FYUE 3RK3B 1O0QA 2Q6QA 2YXQB 3D6ZA 2Y9ZA 1KILA 5TJHA 1IK7A 5CCHD 2FFDB 1PPJD 3RL0g 5CCGD 2Y0EA 2K88A 3H1HE 3GHGC 5GTIH 4BWNA 1KB9E 2HPCA 1PZQA 3BRVB 1SQPK 2YXRB 3O6QB 2RKLA 2KB7P 1BSNA 2FXMA 1YTZT 1HWTC 3Q2YA 2BCCD 4L73A 2HYNA 2QE7H 1YI2P 4HB1A 1LJ2A 3Q3DA 4WY4D 1BE3J 1BCCJ 2E74D 5CJ4A 4OGQC 4R4LA 3M06A 2KYVA 1SQXK 2ZYAA 4IOIH 5AW6B 4KJMA 3AEBC 2XU6A 3G71P 3QWOC 1PP9J 2QA4P 5KJ7D 1LT1A 3L74D 1VF5D 2QRXA 3ZDMA 2O01N 2J59M 5KLVK 2M3BA 4ZNCA 1IFNA 5AVQB 1ZMEC 1IFJA 3NXSA 1VQ4P 1OMJA 2IFMA 3H1JD 2KSEA 3OAKA 1LWUC 1CZQA 2R5BA 1ZR4A 3NMDA 1SFCA 2E74B 1EXJA 5AVZB 2A45G 3T97A 1SQPD 4IFDK 3F5HA 2GA1A 4KT0J 2N9BA 1MV8A 2OTLP 3CC2P 1PPJG 3M0DA 2HODA 3SFDC 4ZKPA 2YO3A 1EDKA 1A02F 3GLMA 1SVFA 1YJWP 5E79H 3KDPB 3CCEP 1NU1D 2BCCG 2Q9IA 2OGUA 1J1DB 4PD4H 1S72P 2Q5UA 4MN4C 3UIAA 3RBZA 1BCCE 1LTJA 1XTCC 2HLOA 1D7MA 3TNUA 1E5WA 1NKNA 4H0LD 1OX3A 2E75D 4IFFA 2WT7B 1SQXJ 3IN6A 2I1JA 1FE6A 1AJYA 2L5GB 2YIUB 3TGUD 1PGQA 3MD0A 1N7SB 1GL2D 3CD6P 1KYOE 4AQRD 1PP9E 2WSEH 3H1KJ 4XA4A 1ZRTD 2R3SA 2LKMA 4K3AA 3TSIA 3CMEP 5KLVJ 2IBZD 4D6TJ 2HR3A 5H2FH 4C7NB 2QSIA 1EDLA 5D7WA 1Z56A 3G3ZA 4L75A 2R5DA 2IX7C 3BASA 1NTKK 2B9BA 3H32B 3L75D 2A06D 3H1JG 5APQA 3MIWA 3BCCD 3MP7B 1EQ7A 2R44A 1LNQA 1URQB 1JNMA 1JY3P 3JCUE 5BU8B 4L76A 1W2BO 1M90Q 1T3JA 1H0TB 4LGDE 2ZYDA 3G4SP 2KZIA 2PAJA 5CCGA 1IFDA 1YJ9P 1ZP0C 4K35A 1MFTA 1FAVA 1NH4A 1SS1A 2YKOA 3MGNA 3L37A 2WPRA 4N78E 1T3UA 1NU1G 3GF7A 3WU2H 1G2CB 4H13C 2E43A 5GTHE 3CCRP 3HD7C 2I8DA 1SQXE 3E1IA 3CCVP 2QJPC 3TK1A 1L0ND 3M0AA 4GODA 4JQ0D 1OM8A 3N7NA 3CWBJ 2WSCH 3B5NA 4PV1B 2E42A 3H1KE 1DH3A 2M8RA 2JWAA 4JYCA 4DZOA 4KHXA 3AE8C 3L71J 5KLVE 4D6TE 3SWFA 2ZT9B 2KIKA 1FOSE 1JUNA 1N7LA 3FX0A 5APYA 1VL2A 5KAIE 3RK2D 5AW0B 1BGYD 1GMJA 3RK3C 2XQHA 3VTPC 5GTIE 1S4XA 4N6JA 2DW3A 5K5GB 2POHA 1NTKJ 2WT7A 2FFDC 2P58A 2E5YA 3L73G 2FYUK 1JY3N 3IFMA 1N7SA 1KILD 1P84H 1USDA 1PGPA 2XNDH 1QX8A 1SQBG 3P7KA 1JIWP 2LXBA 3LAAA 2KNCB 2WSFH 5CMZA 5AW2B 1ZR2A 1TU3F 4C7NA 1NKZB 1VQ6P 2J5UA 1AVOA 2W27A 2N1TA 3HE4B 1L4AA 4IL6X 1GW4A 2IPPA 3H32A 2XV5A 3AE9C 1HVVA 1SATA 2G3AA 4WWIA 3WP8A 1URQA 3E7KA 3FXDA 3KHUA 3HDAP 4PJ0E 1GO8P 2KS1B 3S4RA 1FDMA 2QJYB 5CCHC 4ZKUA 2ZJ7A 1H0TA 1L0NG 1EZVI 2C0XA 3I56P 5APTA 3NTNA 2YMYA 3CWBE 2A45H 3L72J 4BRYB 4UB6H 4YPCA 1N73B 1M7LA 3C9IA 2KUBA 2HPCB 3L70D 1AQTA 1T6AA 4QMAA 2RN0A 3L71E 1WT6A 1G2CA 2FYUD 5KKZC 2FYZA 3VMXA 2E76B 4WY4C 2H88C 5AW8B 1RE4A 2E74C 3D70A 3B71A 2WPQA 3H1HD 1NTKE 1KB9D 1SFCD 2W83C 3O8ZA 5EFWB 5E79E 2Z8ZA 2P10A 2PFXA 3OJAB 2JR8A 3V2RA 1G1IA 4PD4E 5KJ7C 3JC22 1FS0E 3SSUA 3I5CA 2K37A 1VF5C 4W7ZA 1LT9B 1J1DC 1L0LJ 2AEFA 1H88A 3LW5H 2D2CB 5CHXA 1NAYA 2ZXEB 1OVUA 1FZCB 2O01H 2QUAA 2YKPA 2WSCJ 4GKGA 4YXDC 1ZW0A 2YIUC 3B4SA 1OM7A 2W6JH 1G1JA 5APWA 2WPVB 5H2FE 1WRGA 1YITP 2PRRA 2P7JA 2YKQA 2WTYA 3L72E 5APXA 2HODB 1NTZK 3KZIH 3L70G 3HE4A 1KAPP 2JJLA 1CSBA 1K7IA 1GK4A 1RH5B 1RF1B 4H0LC 5TISH 2E75C 4JYBA 2KS1A 3H1HG 4NPDA 3TNUB 4HYTB 2KK7A 1SQVK 5AW7B 1GL2C 1RY3A 1MFZA 4BRYA 3WU2E 1S5LH 3CMAP 2SPZA 1KFMA 4YTPC 1N73A 2G8YA 1M1JB 4UB8H 1O0TA 1H8AA 1BCCD 1YQ3C 1L0LE 1PGOA 2LXCB 3PTZA 1M57D 1HJBA 2RMZA 1UIIA 3AE6C 4H44B 1KMIZ 4XE5B 5B66H 1R5LA 1OZHA 4ZMDA 4W80A 1JCCA 1KYOD 2QG4A 3Q1MA 1PP9D 1N8RQ 1LTSC 3VMYA 3CX5I 2OTKE 1RE3C 3PH0A 3FGAD 3AEDC 1YBKA 3H25A 2WQYC 3B5ND 1W2EA 1S9KE 1RQUA 2ITAA 1LT9A 1X0TA 1Y8AA 1SLQA 1VQKP 1CI6B 4Y99B 3A5TA 2KOGA 3U1CA 1S1CX 2Z5IA 3TF5A 1T2KD 1J1EC 4LC1A 2H43A 1NTZJ 1DD3A 2H89C 1FZCA 1FZAA 1AA0A 3MUDA 1GD2E 1HTLC 1GO7P 1AV1A 1G9KA 3PJSK 1QVGO 1IFPA 2NPSA 1N7SD 3HUSB 3V6IA 3LW5J 2CPSA 1RQVA 1JO5A 5B5EH 2XNXA 1SQVJ 4HJGH 2GM4A 2O01J 2KI7B 4GT1A 3CXHI 1SQQK 1K7QA 3AEEC 3B5NB 4B86A 3GF3A 1IFIA 1HBWA 1RF0A 1JCDA 2N1TD 2OYHC 1L4AD 1RF1A 1NHLA 3RK2C 1SQXD 4RESB 1AQ5A 1U57A 3ULTA 2CPBA 1EXIA 1BE3E 2Q1KA 2FYNC 3CCMP 2OYIB 3ITKA 4LLHA 2ML2A 1URQD 1FZFA 1FDIA 1PP9G 3H1KD 1KILC 1JY3O 1P84I 1PPJE 2ZXXA 3A0BH 2HFED 1KC8Q 1IC2A 5AVRB 3HE5B 5KLVD 4D6TD 1M1JA 2BEZF 1J2JB 1NJIQ 1DEBA 4IL6E 2M3EA 1VQ7P 3L74G 3R4YA 5AVUB 1S2EA 2Q3EA 4I35A 2OQQA 2K9YA 1NTZE 4I7ZC 1L2PA 3V2QA 2JP3A 5C39A 2N1TB 2KLUA 1L4AB 3GG2A 5KLIB 2PP6A 3CI9A 3CX5H 4AUWA 3II6A 1PIXA 5CVWA 5CBOA 3AEAC 4PV1D 1SQPG 1SQVE 1CI6A 2A45I 1SQQJ 2ZT9D 4OGQD 3AE5C 2QUBA 3BATA 4U3FJ 2P67A 3GW6A 5DJTB 3S1KA 4EYYQ 2ZVNB 3L73J 2BEQD 1GDTA 1GU4A 1SQXG 3E1RA 4AYCA 3HBVP 2P1JA 5CXLA 3HUSA 1SFCC 1Q2NA 3HTKA 1SQBJ 2QJKC 2AXTH 1IZNB 3GHGB 1N86A 3L71D 1YTZI 3M0DC 3EQ2A 1LTIC 2Z5HA 3TGUG 5KLVG 4D6TG 3Q5RA 1UIXA 1MUUA 2WWWA 3CXHH 5TISE 1AFOA 3S6LA 3Q5SA 1ZOYC 4YXWH 1YJNP 1EC5A 3PP5A 1NTKD 5M1BA 4OGQB 2IBZG 1LTJC 3MTUE 1S5LE 2H7HA 2OYIA 3H1IJ 1BSHA 1EZVE 3H6PA 4PD4D 4UB8E 1DX7A 1YIJP 3D6YA 1HH0A 1L0NJ 3L75G 2A06G 1HF9A 3HE5A 3BCCG 1NVOA 5AW9B 1VQ9P 1OW7A 3QH9A 5B66E 1JTHB 3L36A 3HBUP 2OYOA 2M0BA 1Q7YQ 1SQQE 2YO1A 1L0LK 3BVHA 2E76D 3I55P 2H8PD 4U3FE 3V4QA 1FDOA 1DD4A 2PGDA 1KN7A 1LWUB 4W7YA 4DOJA 1NTMK 3L73E 3U59A 1S3JA 4RJTA 1OMIA 2WSEJ 3R2PA 1W5CE 1KQFB 1NWQA 3IAOA 3KXDA 1SQBE 3V2NA 4JPZB 3L72D 2WZ7A 3CL3D 1OW6A 5CCGC 2GUVA 5AVTB 3L71G 1CW5A 2D2CD 2B89A 4DT0A 5B5EE 3N4XA 1NTKG 3A6ZA 4ASWA 1EDIA 2C0WA 2R3CA 3M9QA 2ZFCA 3WUVA 2JWDA 3H1IE 2IBZI 1BGYG 2NPSD 4EDFA 3G6EP 3GHGA 2KSJA 3VMZA 5AVSB 1KFNA 1K73Q 1A02J 1L0NE 1JB0J 2QM7A 3C8VA 1L0LD 3PLNA 2YO0A 3B5NC 3H1LJ 3HRNA 4GDOA 3SFEC 1T2KC 3VN0A 1GZLA 3OW2O 3CCUP 1E79H 1QL2A 3EWKA 1FOSF 3A0BE 4OH8B 2B87B 3PHLA 3AEGC 3MHVA 5AVXB 3USSA 1NTMJ 3WMM0 2FBWC 1QLED 1S9KD 1U7JA 1JY2P 1JM0A 2M5AA 1N7SC 1NOHA 2O1JA 3W68A 1BDDA 1NO4A 3L72G 2IZ1A 2V7QH 2NPSB 2WSSH 1IO4A 1S5LX 3CC7P 1ZLLA 1KD1Q 1JTHA 5KTBA 3LIDA 3WUTA 3CCJP 2J58A 1IFMA 2IYOA 2CK3H 3CX5E 2Y0CA 1LWUA 4OVNF 4H44D 2N1TC 1L4AC 1GK6A 2FY8A 2FYUG 3HD7B 4WVZA 3S9OA 2QJPB 1URQC 4OWFA 2WSFJ 1K05A 1VQ8P 1K9MQ 2JDIH 3D71A 3H1LE 2K9JB 3VOPA 1X8YA 3LA9A 1BE3D 1FJKA 4I6MC 3U1RA 2AXTE 1RE4C 3F89A 5AVYB 5KAIH 5BU5A 1N2DC 1JY2N 1NTME 1LTTC 1LTAC 2K3RA 1XTGB 1QL1A 3CXHE 3A2AA 2R32A 4EOTA 3A0HH 3CCQP 2IFNA 1ZN5A 4PV1C 1VQNP 2XDJA 2GUSA 4DT5A 1OW8A 1GU5A 3V4WA 1NTZD 1X9VA 3AE1C 1IJDB 2ZT9C 2BCCJ 1HGVA 1KQLA 1NU1K 3TYYA 4O9BA 1MZ9A 4NPEA 1KTMA 2B87A 1MKMA 1PGJA 1P84E 3A3YB 3RGUA 3RK3E 2ZYGA 3P8CE 1M1KQ 1SQVD 2JKVA 1PL5A 2KP8A 4PJ0H 2UWJE 1FJPA 3BRTB 3HTKB 3RBXA 4Y28J 1NAFA 1FBMA 3L74J 1KB9I 2W8ZA 2N9YB 1OWAA 4N78D 1SMPA 3CLQA 3U1AA 5KKZB 5APVA 1PV3A 5DJUB 5KAFH 4WY4B 4XFJA 2Q3IA 3EFFK 1BE3G 1KV4A 2V7QJ 1BCCG 1R8EA 2B88A 1VQMP 1P9HA 1ZV8A 3HD7A 2JO1A 1K7GA 4DCKA 1GW3A 3H1JJ 2ZJ6A 1ZXGA 3RL0D 4I2LC 1LP1A 3G9RA 2QJYC 4UB6E 1KQSO 1SQPJ 4I1LA 1SQBK 1H71P 5BVZA 1JMMA 4ASVA 1VF5B 3SWYA 3ABVC 3CC4P 2QVAA 1N73C 4NPFX 3VMAA 3M9BA 2K9JA 2ZAEB 1NTZG 1T8ZA 2WMMA 2YNYA 2HG5D 2WPSA 1EZVD 1NGMB 2E76C 1YHQP 2W6AA 2BCCE 2AXCA 1NU1J 3P32A 2FFDA 5L8RJ 2MJZA 1QGKB 1LTGC 1FZEA 3GMAA 3P8MC 1JMBA 1DIPA 1HGZA 3WUUA 3O6QA 3L35A 5APUA 1SQVG 1FZGA 2YO2A 3B8EB 4TT3H 1YQ4C 1L0NK 3FWLA 3TGUJ 1EDJA 3PRJA 1VDFA 3RL0B 1SQQD 2QM8A 2C9LY
chains in the Genus database with same CATH topology
5KJ7D 2H8PD 1LT9C 3V4QA 1LWUB 4W7YA 1G1JA 4DOJA 5APWA 1NTMK 1WRGA 3U59A 2J59M 5KLVK 2M3BA 3L4FA 2P2UA 2P7JA 1KZUB 2YKQA 3R2PA 1IFNA 1FZCC 1NWQA 2WTYA 1YYCA 5AVQB 3V2NA 3V5BA 1IFJA 3NXSA 1SRPA 1HUCA 1OMJA 2WZ7A 5APXA 2IFMA 3CL3D 3LIEA 5CCHA 3OAKA 1LWUC 2HODB 1NTZK 1CZQA 2R5BA 2NPSC 3HE4A 1ZR4A 5CCGC 2GUVA 3NMDA 5AVTB 1KAPP 2JJLA 1GL2B 1SFCA 5AVZB 2A45G 5AVVB 3T97A 1CSBA 1CW5A 1K7IA 1GK4A 4IFDK 1RF1B 2N9BA 2VRSA 1MV8A 2XZRA 1OXZA 4JYBA 3M0DA 3KPEA 3N4XA 3TNUB 2HODA 3A6ZA 4WY4A 2YO3A 4HYTB 4ZKPA 1A02F 2C0WA 2R3CA 1SVFA 3M9QA 1SQVK 2ZFCA 1OM6A 5AW7B 1GL2C 1RY3A 3A70A 1MFZA 3KDPB 1RF0C 2XKMA 2NPSD 1KFMA 2Q9IA 3GHGA 2KSJA 1RF1C 3VMZA 1H89A 1N73A 1J1DB 5AVSB 1M1JB 4N3YB 1KFNA 4JF7A 2Q5UA 1A02J 1O0TA 1H8AA 2C9NY 3UIAA 2QM7A 1LTJA 1XTCC 2HLOA 4GIFA 3VP9A 3TNUA 1E5WA 1LGHB 1NKNA 2YO0A 4HH2A 3B5NC 1HJBA 5KJ7A 4IFFA 3HRNA 2WT7B 3M9HA 2I1JA 2L5GB 1T2KC 3VN0A 3MD0A 1N7SB 1GZLA 4XE5B 1GL2D 4IFMA 4W80A 1JCCA 1M1JC 4AQRD 1QL2A 1FOSF 1LTSC 2WSEH 3VMYA 1J1EB 4M3LA 1RE3C 4XA4A 4OH8B 2LKMA 5AVXB 3WMM0 3TSIA 3B5ND 1W2EA 1S9KD 1X79B 4C7NB 1S9KE 1AKLA 1JY2P 1LT9A 1N7SC 1NOHA 2O1JA 5AW4B 1Z56A 5D7WA 3G3ZA 4WB4A 2R5DA 1SLQA 1CI6B 4Y99B 3A5TA 2KOGA 3U1CA 1NO4A 1T2KD 2Z5IA 2IX7C 3A7OA 1J1EC 2NPSB 5AW1B 3BASA 1NTKK 1IO4A 4LC1A 3H32B 2H43A 5APQA 3NFQA 1ZLLA 1JTHA 5KTBA 1FZCA 1FZAA 3MIWA 3LIDA 5AW3B 3MUDA 1GD2E 1EQ7A 2ZVDA 1URQB 5CJ0A 2J58A 1IFMA 1JNMA 1JY3P 4C46A 1HTLC 5BU8B 1GO7P 1G9KA 1LWUA 1T3JA 4Y99C 4LGDE 2N1TC 2NPSA 2PAJA 1L4AC 5CCGA 1IFDA 1N7SD 3HUSB 5AW5B 1GK6A 2CPSA 1JO5A 2OYHB 3HD7B 2XNXA 1FAVA 1NH4A 3RK2B 2YKOA 2GM4A 3MGNA 3V2PA 1URQC 2JEEA 3L37A 2Z4EA 2WPRA 1IK9A 4N78E 1T3UA 1PFIA 3EFGA 4GT1A 1G2CB 1SQQK 1K7QA 2E43A 3B5NB 1KILB 1JY2O 4B86A 3VI1A 3HUSC 1GL2A 1IFIA 1HBWA 2I1KA 1RF0A 1JCDA 2N1TD 3HD7C 2OYHC 1L4AD 1RF1A 1NHLA 3RK2C 5APSA 3E1IA 3VOPA 4RESB 2FKWB 3TK1A 1AQ5A 3ULTA 2CPBA 1X8YA 4WBAA 3LA9A 1FJKA 4I6MC 3M0AA 3U1RA 3M91A 1OM8A 3N7NA 2OYIB 4LLHA 2ML2A 3IR9A 1URQD 2WSCH 3B5NA 1FZFA 1SP4A 2E42A 1KILC 1FU1A 1JY3O 1RE4C 5AVYB 1DH3A 2M8RA 5BU5A 4JYCA 2HFED 4DZOA 1N2DC 1JY2N 4KHXA 1GTWA 1LTTC 1LTAC 1IC2A 5AVRB 3HE5B 3SWFA 1M1JA 3VP8A 1XTGB 1FOSE 1JUNA 1QL1A 1N7LA 3HD7D 1J2JB 3VYIA 2BASA 5APYA 1RE3A 3A2AA 3RK2D 2R32A 1DEBA 5AW0B 4EOTA 2OYIC 3RK3C 2IFNA 2Z8XA 1VPCA 2XQHA 3VTPC 1ZN5A 4N6JA 2XDJA 2GUSA 5AVUB 2POHA 2WT7A 2FFDC 4I35A 3V4WA 1GU5A 1AF0A 2WITA 2FYUK 1LTBC 1X9VA 1JY3N 3IFMA 1N7SA 1KILD 3KQGA 2KLVA 1IJDB 3V2QA 2W6BA 1HGVA 1KQLA 1NU1K 3P7KA 2N1TB 5AVWB 1JIWP 1L4AB 3TYYA 4O9BA 3LAAA 1MZ9A 2PP6A 3CI9A 3HB2P 4AUWA 3A3YB 3II6A 2WSFH 5CMZA 3RK3D 5AW2B 5CVWA 3P8CD 3P8CE 1ZR2A 4C7NA 1NKZB 2Q7CA 1CI6A 2KP8A 1FZBA 3KYQA 2W27A 2A45I 2N1TA 3HE4B 1L4AA 1SFCB 1GW4A 2IPPA 1FJPA 3H32A 3BRTB 2XV5A 3HTKB 1HVVA 2QUBA 3BATA 3RL0C 1SATA 2P67A 3WP8A 1NAFA 1FBMA 1URQA 2O1KA 3HDAP 1GO8P 1OWAA 2AGMA 4N78D 1GDTA 1SMPA 3CLQA 3U1AA 1GU4A 1FDMA 5APVA 5CCHC 4ZKUA 2ZJ7A 4WY4B 2Q3IA 4AYCA 3HBVP 2P1JA 5CXLA 3HUSA 2C0XA 1SFCC 5APTA 3NTNA 3HTKA 4EIJA 2YMYA 4C7RA 2A45H 1P9HA 2OYHA 1ZV8A 3HD7A 3GHGB 1K7GA 1N73B 1M7LA 3C9IA 1JOCA 1GW3A 1N86A 2HPCB 3OA7A 2ZJ6A 2OARA 1LTJB 3RL0D 4I2LC 1YTZI 3M0DC 3EQ2A 1WT6A 1G2CA 1LTIC 2Z5HA 2FYZA 3VMXA 3RK3B 4I1LA 1SQBK 4WY4C 1O0QA 1MUUA 5AW8B 1H71P 5BVZA 1KILA 1RE4A 2WWWA 3S6LA 1AFOA 1JMMA 5CCHD 2FFDB 3SWYA 5CCGD 2WPQA 3GHGC 3PP5A 1N73C 1SFCD 3O8ZA 3M9BA 2HPCA 3BRVB 1T8ZA 1SQPK 1LTJC 3MTUE 2YNYA 2HG5D 2Z8ZA 2H7HA 2WPSA 2OYIA 2KB7P 3OJAB 2FXMA 1YTZT 1HWTC 3H6PA 2W6AA 3V2RA 1G1IA 2HYNA 5KJ7C 3P32A 2FFDA 1DX7A 3I5CA 4WY4D 2MJZA 4W7ZA 1HH0A 1LTGC 1LT9B 1FZEA 1J1DC 5CJ4A 3HE5A 3P8MC 1H88A 5AW9B 1HGZA 3LW5H 5CHXA 3L35A 5APUA 3M06A 2KYVA 1SQXK 2ZXEB 1FZGA 2YO2A 3B8EB 1JTHB 5AW6B 1FZCB 3L36A 1L0NK 3HBUP 2O01H 2QUAA 2YKPA 1VDFA 3RL0B 2YO1A 1L0LK 4GKGA 3BVHA 2XU6A 2QM8A 2C9LY 1OM7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  4RES B;  3HDA P;  3TK1 A;  1GO8 P;  3ULT A;  1OWA A;  4AQR D;  1X8Y A;  2AGM A;  3LA9 A;  1SMP A;  1GU4 A;  1FOS F;  4I6M C;  3VMY A;  3M0A A;  5APV A;  4M3L A;  3U1R A;  3M91 A;  2ZJ7 A;  5APW A;  1OM8 A;  2ML2 A;  2Q3I A;  3IR9 A;  4AYC A;  3HBV P;  5CXL A;  2P2U A;  2P7J A;  1SP4 A;  2E42 A;  5AVX B;  5APT A;  3NTN A;  3HTK A;  5AVY B;  1DH3 A;  1P9H A;  1NWQ A;  4JYC A;  2WTY A;  4DZO A;  1K7G A;  4KHX A;  1YYC A;  5AVQ B;  1S9K D;  1S9K E;  4C7N B;  1GTW A;  1AKL A;  5AVR B;  3V5B A;  3HE5 B;  3SWF A;  3NXS A;  5AW4 B;  5D7W A;  1SRP A;  2R5D A;  1HUC A;  1SLQ A;  1OMJ A;  1FOS E;  2ZJ6 A;  1JUN A;  1CI6 B;  3A5T A;  4I2L C;  3LIE A;  5APX A;  1J2J B;  3VYI A;  2BAS A;  5APY A;  3OAK A;  1T2K D;  2Z5I A;  2Z5H A;  3A2A A;  3A7O A;  1CZQ A;  2R32 A;  5AW0 B;  3VMX A;  4EOT A;  2R5B A;  5AW1 B;  1O0Q A;  3HE4 A;  2Z8X A;  1MUU A;  3NMD A;  5AVT B;  1IO4 A;  1KAP P;  2XQH A;  4LC1 A;  5AW8 B;  2JJL A;  3VTP C;  1H71 P;  5APQ A;  2WWW A;  5AVZ B;  3S6L A;  3NFQ A;  5AVV B;  3T97 A;  1CSB A;  5AVU B;  1K7I A;  1GK4 A;  2WT7 A;  4I35 A;  3V4W A;  1GU5 A;  1AF0 A;  3LID A;  2N9B A;  5AW3 B;  2WPQ A;  2VRS A;  1GD2 E;  2ZVD A;  1MV8 A;  2XZR A;  1JNM A;  1OXZ A;  3KQG A;  3O8Z A;  3M9B A;  4C46 A;  4JYB A;  1GO7 P;  1G9K A;  3M0D A;  3TNU B;  1KQL A;  3P7K A;  1JIW P;  3A6Z A;  2YNY A;  5AVW B;  2Z8Z A;  3TYY A;  2H7H A;  2WPS A;  2YO3 A;  4HYT B;  1A02 F;  1HWT C;  3LAA A;  2R3C A;  5AW5 B;  2W6A A;  1OM6 A;  2ZFC A;  1GK6 A;  5AW7 B;  3HB2 P;  4AUW A;  3P32 A;  3A70 A;  3A3Y B;  1MFZ A;  1FAV A;  3KDP B;  3I5C A;  5CMZ A;  5AW2 B;  5CVW A;  3VMZ A;  1H89 A;  3MGN A;  1OM7 A;  5AVS B;  4C7N A;  3L37 A;  3HE5 A;  2Q5U A;  3P8M C;  2Q7C A;  1A02 J;  2WPR A;  1H8A A;  1O0T A;  2C9N Y;  1H88 A;  4GT1 A;  3UIA A;  5AW9 B;  1G2C B;  2QM7 A;  1CI6 A;  2KP8 A;  1K7Q A;  3TNU A;  2W27 A;  2E43 A;  3L35 A;  3HE4 B;  3M06 A;  5APU A;  2YO0 A;  2ZXE B;  1HJB A;  2IPP A;  2YO2 A;  4B86 A;  3VI1 A;  3B8E B;  5AW6 B;  2XV5 A;  3L36 A;  3HBU P;  1HBW A;  2WT7 B;  3M9H A;  2QUA A;  2QUB A;  2YO1 A;  4GKG A;  1SAT A;  2XU6 A;  2P67 A;  3WP8 A;  1T2K C;  2QM8 A;  3VN0 A;  1NAF A;  3MD0 A;  1GZL A;  4XE5 B;  2C9L Y;  5APS A; 
#chains in the Genus database with same CATH topology
 4U3F D;  1LT9 C;  1QVF O;  3L74 E;  1WMK A;  2D2C C;  3L73 D;  1FC2 C;  2IZ0 A;  3L4F A;  2P2U A;  1M8O B;  1KZU B;  1FZC C;  2OTJ P;  1SQB D;  1YYC A;  3MUD C;  4H0L B;  1AVY A;  3V5B A;  2E75 B;  1SRP A;  1HUC A;  2MKV A;  2YMK A;  3LIE A;  5CCH A;  3H1J E;  1USE A;  3L75 J;  3AE4 C;  2NPS C;  1Q82 Q;  3BCC J;  1GL2 B;  2ZJS E;  5AVV B;  1SQP E;  3CWB D;  3MZW B;  2VRS A;  4JBZ A;  2Y9Y A;  3H1K G;  2XZR A;  3KZI E;  1OXZ A;  4GOF A;  3FWN A;  1KYO I;  3KPE A;  4WY4 A;  1KB9 H;  1VQL P;  1OM6 A;  2IYP A;  3H1I D;  3A70 A;  1RF0 C;  1EZV G;  2XKM A;  1NU1 E;  1RF1 C;  1H89 A;  2RH0 A;  4N3Y B;  4JF7 A;  2C9N Y;  3VP9 A;  4GIF A;  1LGH B;  2W90 A;  1OVV A;  4HH2 A;  5KJ7 A;  2KZJ A;  3Q5P A;  5CBN A;  3M9H A;  1KOR A;  1VQP P;  1OFC X;  4U7J A;  2L91 A;  3TGU E;  4RKU J;  2M5A B;  4IFM A;  1M1J C;  1SQQ G;  4A7P A;  1J1E B;  4M3L A;  4U3F G;  1ZRT E;  1R5S A;  3CPW O;  2IBZ E;  1K04 A;  1X79 B;  4H44 C;  1AKL A;  3A0H E;  1OVR A;  2FXO A;  2O3J A;  5AW4 B;  4WB4 A;  2IDB A;  1BGY J;  1OIP A;  1QEX A;  3A7O A;  5AW1 B;  4L74 A;  3L75 E;  2A06 E;  2E5T A;  3NFQ A;  3BCC E;  3AE3 C;  5AW3 B;  1RHZ B;  2ZVD A;  5CJ0 A;  3AE7 C;  1BDC A;  1VQ5 P;  3C1L A;  3CWB G;  4C46 A;  2QIW A;  3JSV C;  3CX5 D;  1Q81 Q;  4Y99 C;  1JEK A;  1DEE G;  5AW5 B;  2OYH B;  3IF4 A;  3RK2 B;  1K8A Q;  2Y0D A;  3V2P A;  3H1I G;  2JEE A;  2Z4E A;  1PFI A;  1IK9 A;  2FYN B;  3EFG A;  1KIL B;  2ZVO B;  1JY2 O;  3VI1 A;  3HUS C;  1GL2 A;  2I1K A;  3AE2 C;  4TLF A;  5KAF E;  1Y9B A;  1U7M A;  4HKZ H;  3H1L D;  5APS A;  4DJG A;  2AEM A;  2FKW B;  1X22 A;  4WBA A;  3CCS P;  3M91 A;  3IR9 A;  1KYO H;  1SP4 A;  4CPG A;  1FU1 A;  4H13 D;  4IL6 H;  2NRG A;  2WVR A;  3L70 J;  1NTM D;  1GTW A;  2AEJ A;  4I7Z B;  2FYU J;  3VP8 A;  3CXH D;  3HD7 D;  3VYI A;  2BAS A;  1RE3 A;  1M56 D;  4R4M A;  1BGY E;  2OYI C;  2Z8X A;  3K5B A;  1VPC A;  1VQO P;  3H1H J;  1Y47 A;  4RO0 A;  3W67 A;  1AF0 A;  2WIT A;  3TDK A;  1LTB C;  4GOE A;  1KIL E;  3KQG A;  2KLV A;  1KQG B;  1HJ0 A;  2W6B A;  5AVW B;  2FXP A;  4EI2 A;  3JCU H;  1P84 D;  1NYH A;  3HB2 P;  3RK3 D;  3P8C D;  2Q7C A;  4BXL A;  1FZB A;  4H13 B;  3KYQ A;  3AEC C;  1SFC B;  2KNC A;  2K1A A;  3T97 B;  2QJK B;  5KLI C;  3RL0 C;  3FXE A;  2O1K A;  5GTH H;  3CCL P;  2KXP B;  2AGM A;  3H1L G;  1LP1 B;  1Q86 Q;  3SWK A;  3AEF C;  4PD4 I;  4EIJ A;  1L0L G;  4C7R A;  2OYH A;  2V4H A;  1Q90 D;  2LR2 A;  4Z1M H;  1JOC A;  2NZ2 A;  3OA7 A;  3L70 E;  2OAR A;  1LTJ B;  1NTM G;  2QEX P;  2FYU E;  3RK3 B;  1O0Q A;  2Q6Q A;  2YXQ B;  3D6Z A;  2Y9Z A;  1KIL A;  5TJH A;  1IK7 A;  5CCH D;  2FFD B;  1PPJ D;  3RL0 g;  5CCG D;  2Y0E A;  2K88 A;  3H1H E;  3GHG C;  5GTI H;  4BWN A;  1KB9 E;  2HPC A;  1PZQ A;  3BRV B;  1SQP K;  2YXR B;  3O6Q B;  2RKL A;  2KB7 P;  1BSN A;  2FXM A;  1YTZ T;  1HWT C;  3Q2Y A;  2BCC D;  4L73 A;  2HYN A;  2QE7 H;  1YI2 P;  4HB1 A;  1LJ2 A;  3Q3D A;  4WY4 D;  1BE3 J;  1BCC J;  2E74 D;  5CJ4 A;  4OGQ C;  4R4L A;  3M06 A;  2KYV A;  1SQX K;  2ZYA A;  4IOI H;  5AW6 B;  4KJM A;  3AEB C;  2XU6 A;  3G71 P;  3QWO C;  1PP9 J;  2QA4 P;  5KJ7 D;  1LT1 A;  3L74 D;  1VF5 D;  2QRX A;  3ZDM A;  2O01 N;  2J59 M;  5KLV K;  2M3B A;  4ZNC A;  1IFN A;  5AVQ B;  1ZME C;  1IFJ A;  3NXS A;  1VQ4 P;  1OMJ A;  2IFM A;  3H1J D;  2KSE A;  3OAK A;  1LWU C;  1CZQ A;  2R5B A;  1ZR4 A;  3NMD A;  1SFC A;  2E74 B;  1EXJ A;  5AVZ B;  2A45 G;  3T97 A;  1SQP D;  4IFD K;  3F5H A;  2GA1 A;  4KT0 J;  2N9B A;  1MV8 A;  2OTL P;  3CC2 P;  1PPJ G;  3M0D A;  2HOD A;  3SFD C;  4ZKP A;  2YO3 A;  1EDK A;  1A02 F;  3GLM A;  1SVF A;  1YJW P;  5E79 H;  3KDP B;  3CCE P;  1NU1 D;  2BCC G;  2Q9I A;  2OGU A;  1J1D B;  4PD4 H;  1S72 P;  2Q5U A;  4MN4 C;  3UIA A;  3RBZ A;  1BCC E;  1LTJ A;  1XTC C;  2HLO A;  1D7M A;  3TNU A;  1E5W A;  1NKN A;  4H0L D;  1OX3 A;  2E75 D;  4IFF A;  2WT7 B;  1SQX J;  3IN6 A;  2I1J A;  1FE6 A;  1AJY A;  2L5G B;  2YIU B;  3TGU D;  1PGQ A;  3MD0 A;  1N7S B;  1GL2 D;  3CD6 P;  1KYO E;  4AQR D;  1PP9 E;  2WSE H;  3H1K J;  4XA4 A;  1ZRT D;  2R3S A;  2LKM A;  4K3A A;  3TSI A;  3CME P;  5KLV J;  2IBZ D;  4D6T J;  2HR3 A;  5H2F H;  4C7N B;  2QSI A;  1EDL A;  5D7W A;  1Z56 A;  3G3Z A;  4L75 A;  2R5D A;  2IX7 C;  3BAS A;  1NTK K;  2B9B A;  3H32 B;  3L75 D;  2A06 D;  3H1J G;  5APQ A;  3MIW A;  3BCC D;  3MP7 B;  1EQ7 A;  2R44 A;  1LNQ A;  1URQ B;  1JNM A;  1JY3 P;  3JCU E;  5BU8 B;  4L76 A;  1W2B O;  1M90 Q;  1T3J A;  1H0T B;  4LGD E;  2ZYD A;  3G4S P;  2KZI A;  2PAJ A;  5CCG A;  1IFD A;  1YJ9 P;  1ZP0 C;  4K35 A;  1MFT A;  1FAV A;  1NH4 A;  1SS1 A;  2YKO A;  3MGN A;  3L37 A;  2WPR A;  4N78 E;  1T3U A;  1NU1 G;  3GF7 A;  3WU2 H;  1G2C B;  4H13 C;  2E43 A;  5GTH E;  3CCR P;  3HD7 C;  2I8D A;  1SQX E;  3E1I A;  3CCV P;  2QJP C;  3TK1 A;  1L0N D;  3M0A A;  4GOD A;  4JQ0 D;  1OM8 A;  3N7N A;  3CWB J;  2WSC H;  3B5N A;  4PV1 B;  2E42 A;  3H1K E;  1DH3 A;  2M8R A;  2JWA A;  4JYC A;  4DZO A;  4KHX A;  3AE8 C;  3L71 J;  5KLV E;  4D6T E;  3SWF A;  2ZT9 B;  2KIK A;  1FOS E;  1JUN A;  1N7L A;  3FX0 A;  5APY A;  1VL2 A;  5KAI E;  3RK2 D;  5AW0 B;  1BGY D;  1GMJ A;  3RK3 C;  2XQH A;  3VTP C;  5GTI E;  1S4X A;  4N6J A;  2DW3 A;  5K5G B;  2POH A;  1NTK J;  2WT7 A;  2FFD C;  2P58 A;  2E5Y A;  3L73 G;  2FYU K;  1JY3 N;  3IFM A;  1N7S A;  1KIL D;  1P84 H;  1USD A;  1PGP A;  2XND H;  1QX8 A;  1SQB G;  3P7K A;  1JIW P;  2LXB A;  3LAA A;  2KNC B;  2WSF H;  5CMZ A;  5AW2 B;  1ZR2 A;  1TU3 F;  4C7N A;  1NKZ B;  1VQ6 P;  2J5U A;  1AVO A;  2W27 A;  2N1T A;  3HE4 B;  1L4A A;  4IL6 X;  1GW4 A;  2IPP A;  3H32 A;  2XV5 A;  3AE9 C;  1HVV A;  1SAT A;  2G3A A;  4WWI A;  3WP8 A;  1URQ A;  3E7K A;  3FXD A;  3KHU A;  3HDA P;  4PJ0 E;  1GO8 P;  2KS1 B;  3S4R A;  1FDM A;  2QJY B;  5CCH C;  4ZKU A;  2ZJ7 A;  1H0T A;  1L0N G;  1EZV I;  2C0X A;  3I56 P;  5APT A;  3NTN A;  2YMY A;  3CWB E;  2A45 H;  3L72 J;  4BRY B;  4UB6 H;  4YPC A;  1N73 B;  1M7L A;  3C9I A;  2KUB A;  2HPC B;  3L70 D;  1AQT A;  1T6A A;  4QMA A;  2RN0 A;  3L71 E;  1WT6 A;  1G2C A;  2FYU D;  5KKZ C;  2FYZ A;  3VMX A;  2E76 B;  4WY4 C;  2H88 C;  5AW8 B;  1RE4 A;  2E74 C;  3D70 A;  3B71 A;  2WPQ A;  3H1H D;  1NTK E;  1KB9 D;  1SFC D;  2W83 C;  3O8Z A;  5EFW B;  5E79 E;  2Z8Z A;  2P10 A;  2PFX A;  3OJA B;  2JR8 A;  3V2R A;  1G1I A;  4PD4 E;  5KJ7 C;  3JC2 2;  1FS0 E;  3SSU A;  3I5C A;  2K37 A;  1VF5 C;  4W7Z A;  1LT9 B;  1J1D C;  1L0L J;  2AEF A;  1H88 A;  3LW5 H;  2D2C B;  5CHX A;  1NAY A;  2ZXE B;  1OVU A;  1FZC B;  2O01 H;  2QUA A;  2YKP A;  2WSC J;  4GKG A;  4YXD C;  1ZW0 A;  2YIU C;  3B4S A;  1OM7 A;  2W6J H;  1G1J A;  5APW A;  2WPV B;  5H2F E;  1WRG A;  1YIT P;  2PRR A;  2P7J A;  2YKQ A;  2WTY A;  3L72 E;  5APX A;  2HOD B;  1NTZ K;  3KZI H;  3L70 G;  3HE4 A;  1KAP P;  2JJL A;  1CSB A;  1K7I A;  1GK4 A;  1RH5 B;  1RF1 B;  4H0L C;  5TIS H;  2E75 C;  4JYB A;  2KS1 A;  3H1H G;  4NPD A;  3TNU B;  4HYT B;  2KK7 A;  1SQV K;  5AW7 B;  1GL2 C;  1RY3 A;  1MFZ A;  4BRY A;  3WU2 E;  1S5L H;  3CMA P;  2SPZ A;  1KFM A;  4YTP C;  1N73 A;  2G8Y A;  1M1J B;  4UB8 H;  1O0T A;  1H8A A;  1BCC D;  1YQ3 C;  1L0L E;  1PGO A;  2LXC B;  3PTZ A;  1M57 D;  1HJB A;  2RMZ A;  1UII A;  3AE6 C;  4H44 B;  1KMI Z;  4XE5 B;  5B66 H;  1R5L A;  1OZH A;  4ZMD A;  4W80 A;  1JCC A;  1KYO D;  2QG4 A;  3Q1M A;  1PP9 D;  1N8R Q;  1LTS C;  3VMY A;  3CX5 I;  2OTK E;  1RE3 C;  3PH0 A;  3FGA D;  3AED C;  1YBK A;  3H25 A;  2WQY C;  3B5N D;  1W2E A;  1S9K E;  1RQU A;  2ITA A;  1LT9 A;  1X0T A;  1Y8A A;  1SLQ A;  1VQK P;  1CI6 B;  4Y99 B;  3A5T A;  2KOG A;  3U1C A;  1S1C X;  2Z5I A;  3TF5 A;  1T2K D;  1J1E C;  4LC1 A;  2H43 A;  1NTZ J;  1DD3 A;  2H89 C;  1FZC A;  1FZA A;  1AA0 A;  3MUD A;  1GD2 E;  1HTL C;  1GO7 P;  1AV1 A;  1G9K A;  3PJS K;  1QVG O;  1IFP A;  2NPS A;  1N7S D;  3HUS B;  3V6I A;  3LW5 J;  2CPS A;  1RQV A;  1JO5 A;  5B5E H;  2XNX A;  1SQV J;  4HJG H;  2GM4 A;  2O01 J;  2KI7 B;  4GT1 A;  3CXH I;  1SQQ K;  1K7Q A;  3AEE C;  3B5N B;  4B86 A;  3GF3 A;  1IFI A;  1HBW A;  1RF0 A;  1JCD A;  2N1T D;  2OYH C;  1L4A D;  1RF1 A;  1NHL A;  3RK2 C;  1SQX D;  4RES B;  1AQ5 A;  1U57 A;  3ULT A;  2CPB A;  1EXI A;  1BE3 E;  2Q1K A;  2FYN C;  3CCM P;  2OYI B;  3ITK A;  4LLH A;  2ML2 A;  1URQ D;  1FZF A;  1FDI A;  1PP9 G;  3H1K D;  1KIL C;  1JY3 O;  1P84 I;  1PPJ E;  2ZXX A;  3A0B H;  2HFE D;  1KC8 Q;  1IC2 A;  5AVR B;  3HE5 B;  5KLV D;  4D6T D;  1M1J A;  2BEZ F;  1J2J B;  1NJI Q;  1DEB A;  4IL6 E;  2M3E A;  1VQ7 P;  3L74 G;  3R4Y A;  5AVU B;  1S2E A;  2Q3E A;  4I35 A;  2OQQ A;  2K9Y A;  1NTZ E;  4I7Z C;  1L2P A;  3V2Q A;  2JP3 A;  5C39 A;  2N1T B;  2KLU A;  1L4A B;  3GG2 A;  5KLI B;  2PP6 A;  3CI9 A;  3CX5 H;  4AUW A;  3II6 A;  1PIX A;  5CVW A;  5CBO A;  3AEA C;  4PV1 D;  1SQP G;  1SQV E;  1CI6 A;  2A45 I;  1SQQ J;  2ZT9 D;  4OGQ D;  3AE5 C;  2QUB A;  3BAT A;  4U3F J;  2P67 A;  3GW6 A;  5DJT B;  3S1K A;  4EYY Q;  2ZVN B;  3L73 J;  2BEQ D;  1GDT A;  1GU4 A;  1SQX G;  3E1R A;  4AYC A;  3HBV P;  2P1J A;  5CXL A;  3HUS A;  1SFC C;  1Q2N A;  3HTK A;  1SQB J;  2QJK C;  2AXT H;  1IZN B;  3GHG B;  1N86 A;  3L71 D;  1YTZ I;  3M0D C;  3EQ2 A;  1LTI C;  2Z5H A;  3TGU G;  5KLV G;  4D6T G;  3Q5R A;  1UIX A;  1MUU A;  2WWW A;  3CXH H;  5TIS E;  1AFO A;  3S6L A;  3Q5S A;  1ZOY C;  4YXW H;  1YJN P;  1EC5 A;  3PP5 A;  1NTK D;  5M1B A;  4OGQ B;  2IBZ G;  1LTJ C;  3MTU E;  1S5L E;  2H7H A;  2OYI A;  3H1I J;  1BSH A;  1EZV E;  3H6P A;  4PD4 D;  4UB8 E;  1DX7 A;  1YIJ P;  3D6Y A;  1HH0 A;  1L0N J;  3L75 G;  2A06 G;  1HF9 A;  3HE5 A;  3BCC G;  1NVO A;  5AW9 B;  1VQ9 P;  1OW7 A;  3QH9 A;  5B66 E;  1JTH B;  3L36 A;  3HBU P;  2OYO A;  2M0B A;  1Q7Y Q;  1SQQ E;  2YO1 A;  1L0L K;  3BVH A;  2E76 D;  3I55 P;  2H8P D;  4U3F E;  3V4Q A;  1FDO A;  1DD4 A;  2PGD A;  1KN7 A;  1LWU B;  4W7Y A;  4DOJ A;  1NTM K;  3L73 E;  3U59 A;  1S3J A;  4RJT A;  1OMI A;  2WSE J;  3R2P A;  1W5C E;  1KQF B;  1NWQ A;  3IAO A;  3KXD A;  1SQB E;  3V2N A;  4JPZ B;  3L72 D;  2WZ7 A;  3CL3 D;  1OW6 A;  5CCG C;  2GUV A;  5AVT B;  3L71 G;  1CW5 A;  2D2C D;  2B89 A;  4DT0 A;  5B5E E;  3N4X A;  1NTK G;  3A6Z A;  4ASW A;  1EDI A;  2C0W A;  2R3C A;  3M9Q A;  2ZFC A;  3WUV A;  2JWD A;  3H1I E;  2IBZ I;  1BGY G;  2NPS D;  4EDF A;  3G6E P;  3GHG A;  2KSJ A;  3VMZ A;  5AVS B;  1KFN A;  1K73 Q;  1A02 J;  1L0N E;  1JB0 J;  2QM7 A;  3C8V A;  1L0L D;  3PLN A;  2YO0 A;  3B5N C;  3H1L J;  3HRN A;  4GDO A;  3SFE C;  1T2K C;  3VN0 A;  1GZL A;  3OW2 O;  3CCU P;  1E79 H;  1QL2 A;  3EWK A;  1FOS F;  3A0B E;  4OH8 B;  2B87 B;  3PHL A;  3AEG C;  3MHV A;  5AVX B;  3USS A;  1NTM J;  3WMM 0;  2FBW C;  1QLE D;  1S9K D;  1U7J A;  1JY2 P;  1JM0 A;  2M5A A;  1N7S C;  1NOH A;  2O1J A;  3W68 A;  1BDD A;  1NO4 A;  3L72 G;  2IZ1 A;  2V7Q H;  2NPS B;  2WSS H;  1IO4 A;  1S5L X;  3CC7 P;  1ZLL A;  1KD1 Q;  1JTH A;  5KTB A;  3LID A;  3WUT A;  3CCJ P;  2J58 A;  1IFM A;  2IYO A;  2CK3 H;  3CX5 E;  2Y0C A;  1LWU A;  4OVN F;  4H44 D;  2N1T C;  1L4A C;  1GK6 A;  2FY8 A;  2FYU G;  3HD7 B;  4WVZ A;  3S9O A;  2QJP B;  1URQ C;  4OWF A;  2WSF J;  1K05 A;  1VQ8 P;  1K9M Q;  2JDI H;  3D71 A;  3H1L E;  2K9J B;  3VOP A;  1X8Y A;  3LA9 A;  1BE3 D;  1FJK A;  4I6M C;  3U1R A;  2AXT E;  1RE4 C;  3F89 A;  5AVY B;  5KAI H;  5BU5 A;  1N2D C;  1JY2 N;  1NTM E;  1LTT C;  1LTA C;  2K3R A;  1XTG B;  1QL1 A;  3CXH E;  3A2A A;  2R32 A;  4EOT A;  3A0H H;  3CCQ P;  2IFN A;  1ZN5 A;  4PV1 C;  1VQN P;  2XDJ A;  2GUS A;  4DT5 A;  1OW8 A;  1GU5 A;  3V4W A;  1NTZ D;  1X9V A;  3AE1 C;  1IJD B;  2ZT9 C;  2BCC J;  1HGV A;  1KQL A;  1NU1 K;  3TYY A;  4O9B A;  1MZ9 A;  4NPE A;  1KTM A;  2B87 A;  1MKM A;  1PGJ A;  1P84 E;  3A3Y B;  3RGU A;  3RK3 E;  2ZYG A;  3P8C E;  1M1K Q;  1SQV D;  2JKV A;  1PL5 A;  2KP8 A;  4PJ0 H;  2UWJ E;  1FJP A;  3BRT B;  3HTK B;  3RBX A;  4Y28 J;  1NAF A;  1FBM A;  3L74 J;  1KB9 I;  2W8Z A;  2N9Y B;  1OWA A;  4N78 D;  1SMP A;  3CLQ A;  3U1A A;  5KKZ B;  5APV A;  1PV3 A;  5DJU B;  5KAF H;  4WY4 B;  4XFJ A;  2Q3I A;  3EFF K;  1BE3 G;  1KV4 A;  2V7Q J;  1BCC G;  1R8E A;  2B88 A;  1VQM P;  1P9H A;  1ZV8 A;  3HD7 A;  2JO1 A;  1K7G A;  4DCK A;  1GW3 A;  3H1J J;  2ZJ6 A;  1ZXG A;  3RL0 D;  4I2L C;  1LP1 A;  3G9R A;  2QJY C;  4UB6 E;  1KQS O;  1SQP J;  4I1L A;  1SQB K;  1H71 P;  5BVZ A;  1JMM A;  4ASV A;  1VF5 B;  3SWY A;  3ABV C;  3CC4 P;  2QVA A;  1N73 C;  4NPF X;  3VMA A;  3M9B A;  2K9J A;  2ZAE B;  1NTZ G;  1T8Z A;  2WMM A;  2YNY A;  2HG5 D;  2WPS A;  1EZV D;  1NGM B;  2E76 C;  1YHQ P;  2W6A A;  2BCC E;  2AXC A;  1NU1 J;  3P32 A;  2FFD A;  5L8R J;  2MJZ A;  1QGK B;  1LTG C;  1FZE A;  3GMA A;  3P8M C;  1JMB A;  1DIP A;  1HGZ A;  3WUU A;  3O6Q A;  3L35 A;  5APU A;  1SQV G;  1FZG A;  2YO2 A;  3B8E B;  4TT3 H;  1YQ4 C;  1L0N K;  3FWL A;  3TGU J;  1EDJ A;  3PRJ A;  1VDF A;  3RL0 B;  1SQQ D;  2QM8 A;  2C9L Y; 
#chains in the Genus database with same CATH homology
 5KJ7 D;  2H8P D;  1LT9 C;  3V4Q A;  1LWU B;  4W7Y A;  1G1J A;  4DOJ A;  5APW A;  1NTM K;  1WRG A;  3U59 A;  2J59 M;  5KLV K;  2M3B A;  3L4F A;  2P2U A;  2P7J A;  1KZU B;  2YKQ A;  3R2P A;  1IFN A;  1FZC C;  1NWQ A;  2WTY A;  1YYC A;  5AVQ B;  3V2N A;  3V5B A;  1IFJ A;  3NXS A;  1SRP A;  1HUC A;  1OMJ A;  2WZ7 A;  5APX A;  2IFM A;  3CL3 D;  3LIE A;  5CCH A;  3OAK A;  1LWU C;  2HOD B;  1NTZ K;  1CZQ A;  2R5B A;  2NPS C;  3HE4 A;  1ZR4 A;  5CCG C;  2GUV A;  3NMD A;  5AVT B;  1KAP P;  2JJL A;  1GL2 B;  1SFC A;  5AVZ B;  2A45 G;  5AVV B;  3T97 A;  1CSB A;  1CW5 A;  1K7I A;  1GK4 A;  4IFD K;  1RF1 B;  2N9B A;  2VRS A;  1MV8 A;  2XZR A;  1OXZ A;  4JYB A;  3M0D A;  3KPE A;  3N4X A;  3TNU B;  2HOD A;  3A6Z A;  4WY4 A;  2YO3 A;  4HYT B;  4ZKP A;  1A02 F;  2C0W A;  2R3C A;  1SVF A;  3M9Q A;  1SQV K;  2ZFC A;  1OM6 A;  5AW7 B;  1GL2 C;  1RY3 A;  3A70 A;  1MFZ A;  3KDP B;  1RF0 C;  2XKM A;  2NPS D;  1KFM A;  2Q9I A;  3GHG A;  2KSJ A;  1RF1 C;  3VMZ A;  1H89 A;  1N73 A;  1J1D B;  5AVS B;  1M1J B;  4N3Y B;  1KFN A;  4JF7 A;  2Q5U A;  1A02 J;  1O0T A;  1H8A A;  2C9N Y;  3UIA A;  2QM7 A;  1LTJ A;  1XTC C;  2HLO A;  4GIF A;  3VP9 A;  3TNU A;  1E5W A;  1LGH B;  1NKN A;  2YO0 A;  4HH2 A;  3B5N C;  1HJB A;  5KJ7 A;  4IFF A;  3HRN A;  2WT7 B;  3M9H A;  2I1J A;  2L5G B;  1T2K C;  3VN0 A;  3MD0 A;  1N7S B;  1GZL A;  4XE5 B;  1GL2 D;  4IFM A;  4W80 A;  1JCC A;  1M1J C;  4AQR D;  1QL2 A;  1FOS F;  1LTS C;  2WSE H;  3VMY A;  1J1E B;  4M3L A;  1RE3 C;  4XA4 A;  4OH8 B;  2LKM A;  5AVX B;  3WMM 0;  3TSI A;  3B5N D;  1W2E A;  1S9K D;  1X79 B;  4C7N B;  1S9K E;  1AKL A;  1JY2 P;  1LT9 A;  1N7S C;  1NOH A;  2O1J A;  5AW4 B;  1Z56 A;  5D7W A;  3G3Z A;  4WB4 A;  2R5D A;  1SLQ A;  1CI6 B;  4Y99 B;  3A5T A;  2KOG A;  3U1C A;  1NO4 A;  1T2K D;  2Z5I A;  2IX7 C;  3A7O A;  1J1E C;  2NPS B;  5AW1 B;  3BAS A;  1NTK K;  1IO4 A;  4LC1 A;  3H32 B;  2H43 A;  5APQ A;  3NFQ A;  1ZLL A;  1JTH A;  5KTB A;  1FZC A;  1FZA A;  3MIW A;  3LID A;  5AW3 B;  3MUD A;  1GD2 E;  1EQ7 A;  2ZVD A;  1URQ B;  5CJ0 A;  2J58 A;  1IFM A;  1JNM A;  1JY3 P;  4C46 A;  1HTL C;  5BU8 B;  1GO7 P;  1G9K A;  1LWU A;  1T3J A;  4Y99 C;  4LGD E;  2N1T C;  2NPS A;  2PAJ A;  1L4A C;  5CCG A;  1IFD A;  1N7S D;  3HUS B;  5AW5 B;  1GK6 A;  2CPS A;  1JO5 A;  2OYH B;  3HD7 B;  2XNX A;  1FAV A;  1NH4 A;  3RK2 B;  2YKO A;  2GM4 A;  3MGN A;  3V2P A;  1URQ C;  2JEE A;  3L37 A;  2Z4E A;  2WPR A;  1IK9 A;  4N78 E;  1T3U A;  1PFI A;  3EFG A;  4GT1 A;  1G2C B;  1SQQ K;  1K7Q A;  2E43 A;  3B5N B;  1KIL B;  1JY2 O;  4B86 A;  3VI1 A;  3HUS C;  1GL2 A;  1IFI A;  1HBW A;  2I1K A;  1RF0 A;  1JCD A;  2N1T D;  3HD7 C;  2OYH C;  1L4A D;  1RF1 A;  1NHL A;  3RK2 C;  5APS A;  3E1I A;  3VOP A;  4RES B;  2FKW B;  3TK1 A;  1AQ5 A;  3ULT A;  2CPB A;  1X8Y A;  4WBA A;  3LA9 A;  1FJK A;  4I6M C;  3M0A A;  3U1R A;  3M91 A;  1OM8 A;  3N7N A;  2OYI B;  4LLH A;  2ML2 A;  3IR9 A;  1URQ D;  2WSC H;  3B5N A;  1FZF A;  1SP4 A;  2E42 A;  1KIL C;  1FU1 A;  1JY3 O;  1RE4 C;  5AVY B;  1DH3 A;  2M8R A;  5BU5 A;  4JYC A;  2HFE D;  4DZO A;  1N2D C;  1JY2 N;  4KHX A;  1GTW A;  1LTT C;  1LTA C;  1IC2 A;  5AVR B;  3HE5 B;  3SWF A;  1M1J A;  3VP8 A;  1XTG B;  1FOS E;  1JUN A;  1QL1 A;  1N7L A;  3HD7 D;  1J2J B;  3VYI A;  2BAS A;  5APY A;  1RE3 A;  3A2A A;  3RK2 D;  2R32 A;  1DEB A;  5AW0 B;  4EOT A;  2OYI C;  3RK3 C;  2IFN A;  2Z8X A;  1VPC A;  2XQH A;  3VTP C;  1ZN5 A;  4N6J A;  2XDJ A;  2GUS A;  5AVU B;  2POH A;  2WT7 A;  2FFD C;  4I35 A;  3V4W A;  1GU5 A;  1AF0 A;  2WIT A;  2FYU K;  1LTB C;  1X9V A;  1JY3 N;  3IFM A;  1N7S A;  1KIL D;  3KQG A;  2KLV A;  1IJD B;  3V2Q A;  2W6B A;  1HGV A;  1KQL A;  1NU1 K;  3P7K A;  2N1T B;  5AVW B;  1JIW P;  1L4A B;  3TYY A;  4O9B A;  3LAA A;  1MZ9 A;  2PP6 A;  3CI9 A;  3HB2 P;  4AUW A;  3A3Y B;  3II6 A;  2WSF H;  5CMZ A;  3RK3 D;  5AW2 B;  5CVW A;  3P8C D;  3P8C E;  1ZR2 A;  4C7N A;  1NKZ B;  2Q7C A;  1CI6 A;  2KP8 A;  1FZB A;  3KYQ A;  2W27 A;  2A45 I;  2N1T A;  3HE4 B;  1L4A A;  1SFC B;  1GW4 A;  2IPP A;  1FJP A;  3H32 A;  3BRT B;  2XV5 A;  3HTK B;  1HVV A;  2QUB A;  3BAT A;  3RL0 C;  1SAT A;  2P67 A;  3WP8 A;  1NAF A;  1FBM A;  1URQ A;  2O1K A;  3HDA P;  1GO8 P;  1OWA A;  2AGM A;  4N78 D;  1GDT A;  1SMP A;  3CLQ A;  3U1A A;  1GU4 A;  1FDM A;  5APV A;  5CCH C;  4ZKU A;  2ZJ7 A;  4WY4 B;  2Q3I A;  4AYC A;  3HBV P;  2P1J A;  5CXL A;  3HUS A;  2C0X A;  1SFC C;  5APT A;  3NTN A;  3HTK A;  4EIJ A;  2YMY A;  4C7R A;  2A45 H;  1P9H A;  2OYH A;  1ZV8 A;  3HD7 A;  3GHG B;  1K7G A;  1N73 B;  1M7L A;  3C9I A;  1JOC A;  1GW3 A;  1N86 A;  2HPC B;  3OA7 A;  2ZJ6 A;  2OAR A;  1LTJ B;  3RL0 D;  4I2L C;  1YTZ I;  3M0D C;  3EQ2 A;  1WT6 A;  1G2C A;  1LTI C;  2Z5H A;  2FYZ A;  3VMX A;  3RK3 B;  4I1L A;  1SQB K;  4WY4 C;  1O0Q A;  1MUU A;  5AW8 B;  1H71 P;  5BVZ A;  1KIL A;  1RE4 A;  2WWW A;  3S6L A;  1AFO A;  1JMM A;  5CCH D;  2FFD B;  3SWY A;  5CCG D;  2WPQ A;  3GHG C;  3PP5 A;  1N73 C;  1SFC D;  3O8Z A;  3M9B A;  2HPC A;  3BRV B;  1T8Z A;  1SQP K;  1LTJ C;  3MTU E;  2YNY A;  2HG5 D;  2Z8Z A;  2H7H A;  2WPS A;  2OYI A;  2KB7 P;  3OJA B;  2FXM A;  1YTZ T;  1HWT C;  3H6P A;  2W6A A;  3V2R A;  1G1I A;  2HYN A;  5KJ7 C;  3P32 A;  2FFD A;  1DX7 A;  3I5C A;  4WY4 D;  2MJZ A;  4W7Z A;  1HH0 A;  1LTG C;  1LT9 B;  1FZE A;  1J1D C;  5CJ4 A;  3HE5 A;  3P8M C;  1H88 A;  5AW9 B;  1HGZ A;  3LW5 H;  5CHX A;  3L35 A;  5APU A;  3M06 A;  2KYV A;  1SQX K;  2ZXE B;  1FZG A;  2YO2 A;  3B8E B;  1JTH B;  5AW6 B;  1FZC B;  3L36 A;  1L0N K;  3HBU P;  2O01 H;  2QUA A;  2YKP A;  1VDF A;  3RL0 B;  2YO1 A;  1L0L K;  4GKG A;  3BVH A;  2XU6 A;  2QM8 A;  2C9L Y;  1OM7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...