3HDAP

Prtc methionine mutants: m226a_desy
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
419
structure length
382
Chain Sequence
b'NVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHEIGHALGLAHPGYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 124
structure length 382
sequence length 419
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hdaP02
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hdaP01
3K7NA 1B8YA 3ELMA 1K7QA 3WV2A 2XS3A 2SRTA 5D1TA 1PWUA 4H84A 2OI0A 2W13A 3A70A 4PKSA 2X3BA 3HYGA 4JPAA 4WZVA 3P24A 2OXWA 1ZP5A 3K7LA 4ILWD 3HB2P 3OHOA 2Z8ZA 4H2EA 2CLTA 1SLMA 2X3AA 4GR3A 1HFCA 5I43A 1JJ9A 1K7IA 5D2BA 4DV8A 3F18A 3UVCA 4CTHA 4WK7A 1QICA 1G4KA 3KWVC 5I0LA 1QJIA 2Z8XA 1PWPA 1OMJA 2DDFA 1BIWA 3LQBA 2HU6A 1K7GA 1RM8A 1YOUA 3KMCA 4AXQA 2FV9A 4DF9A 2I47A 4AIGA 3KHIA 3LE9A 1UTTA 2DDYA 1G49A 456CA 1B3DA 2JNPA 1R54A 1KUKA 3LEAA 2E2DA 1GE5A 4IJOA 3O64A 2KRJA 966CA 2ML2A 1GKCA 1R1JA 4WKEA 1DTHA 5I3MA 2X7MA 1Z3JA 2YO1A 1H71P 2DW2A 3O2XA 4H49A 1IAGA 2N8RA 1GE7A 3N2UA 1AF0A 4EFSA 1PWVA 2PJTA 4HX3A 2OW1A 1KUIA 3EHXA 2J83A 4GUYA 3OHLA 5LABA 2YO0A 3DWBA 1EB6A 3DPFA 4DD8A 1GE6A 1BM6A 4G9LA 1UMTA 3EDZA 1I73A 1FBLA 1Y8JA 1MMPA 5I4OA 4GF1A 3LUNA 3HBVP 2W14A 1JIWP 4PKUA 2RJPA 2AIGP 1O0TA 3B8ZA 2USNA 1IAEA 4XM7A 3ZVSA 1EAKA 1YP1A 1R1IA 2TCLA 3LJTA 1OO9A 1ZTQA 2JSDA 3Q2GA 3TS4A 2J0TA 2L0RA 1IACA 4JA1A 5D1SA 1HY7A 3L0TA 4XM6A 2WO8A 3U1RA 1HOVA 1C3IA 4H1QA 3L0VA 3HY7A 2CKIA 4WF6A 1XFUA 1BKCE 1SU3A 3I7IA 2ZJ7A 1IAAA 1YQYA 3I7GA 2OXUA 5BPAA 2D1NA 2O36A 1YCMA 5I2ZA 2ZVDA 1XURA 3LUMA 1HFSA 1G05A 2JIHA 3BA0A 1SLNA 4HMAA 1RMZA 830CA 1BQOA 4I03A 2RJQA 1ZVXA 3EWJA 2WOAA 4GQLA 4A3WA 1ASTA 1CGFA 2OVXA 1MMQA 1BKCI 2MLRA 3KEKA 3GBOA 3EHYA 1PWQA 5CUHA 1CGEA 4XCTA 4XBHA 2X3CA 2POJA 3VI1A 1CK7A 3LILA 2Y6CA 5BOTA 4H76A 3NTNA 1BZSA 3WV3A 2QPJA 3KMEA 1MNCA 1JAPA 3VTGA 1J7NA 1C8TA 3A6ZA 4PKVA 4GR8A 2Z2DA 3TSKA 3RTTA 1XFZA 4H30A 4FVLA 4PKWA 1CQRA 2QUBA 3USNA 2W15A 1D8MA 1QUAA 1BKCA 1ND1A 1DMTA 2K9CA 3WP8A 1UEAA 2E3XA 5CXAA 1IADA 1FLSA 1KUGA 3TVCA 3HBUP 1FM1A 1L6JA 2XS4A 1O0QA 2Y6DA 1JAQA 4L19A 3LKAA 4PKQA 4AYKA 3LJZA 4GWMA 1R1HA 3S6LA 5B5PA 2DW1A 3N2VA 2OY2A 2W0DA 2QUAA 4GWNA 1MMRA 4FXYP 1JAOA 2AGMA 1GO8P 2OXZA 3F15A 1JKYA 3AYKA 5D3CA 1JH1A 4IUWA 3DL1A 3F17A 1BUDA 3LK8A 4Q1LA 4PKRA 4I35A 1S4BP 3F1AA 1D7XA 1BSWA 1C7KA 1USNA 4G0DA 1P9HA 3LA9A 2XQHA 2MZIA 3KRYA 1XFWA 3LIKA 3LQ0A 3NX7A 1R55A 4ON1A 3ZXHA 4L63A 2JT5A 2OW9A 3EDHA 1AKLA 2OW2A 2A8HA 4A7BA 2DW0A 3LAAA 2V4BA 1CIZA 5JMYA 2EROA 3LMCA 1G9KA 4IN9A 1QIBA 2D1OA 1CXVA 5CVWA 3AYUA 5D1UA 1XUCA 1CGLA 3KECA 3EDIA 2YB9A 3DSLA 1BQQM 3HDAP 5CXLA 1GXDA 2MLSA 1ZXCA 3HY9A 1GKDA 5L79A 3F16A 3EDGA 4H3XA 5BOYA 1KAPP 1OM7A 1XFVA 1XFXA 1ZS0A 3LIRA 1D5JA 3LGPA 5L7FA 1QIAA 1OS2A 1G12A 4FXQA 1I76A 4PKTA 5CZMA 5B5OA 3DNGA 1KUHA 3F19A 2O3EA 1OM6A 2ERPA 3MA2A 4L6TA 1I1IP 2AYKA 3E8RA 1QJJA 1A85A 3ZUKA 4AUOA 3TT4A 4H82A 1UTZA 4XM8A 1HV5A 1Y0VA 4J4MA 1AYKA 1JANA 1OS9A 2OW0A 1SRPA 3HDBA 1A86A 1UMSA 3G42A 2YIGA 1XFYA 1JK3A 3G5CA 1KUFA 1KBCA 1PWWA 1XUDA 4JQGA 1SMPA 4R3VA 2JT6A 1IABA 4ZR5A 5D7WA 4DPEA 3RTSA 4JP4A 2OZRA 1BUVM 1CAQA 1ZXVA 2OVZA 3AIGA 1ROSA 1SATA 2ZJ6A 1D8FA 3ULTA 1Q3AA 2MZHA 3KEJA 1HTDA 3SHIA 3CKIA 4GR0A 3V96B 3B92A 1MMBA 4JIJA 1WNIA 4WKIA 2ERQA 3DPEA 2FV5A 4FU4A 3WV1A 1JIZA 2OY4A 3P1VA 4QKZA 5H8XA 2K2GA 2WO9A 2MZEA 1Y93A 2W12A 3Q2HA 5I12A 3B2ZA 1EUBA 3LJGA 1OM8A 1ATLA 1GO7P
chains in the Genus database with same CATH superfamily
3K7NA 1B8YA 3ELMA 1K7QA 3WV2A 2XS3A 2SRTA 5D1TA 3DTEA 1PWUA 4H84A 2OI0A 2W13A 3A70A 4PKSA 2X3BA 3HYGA 4JPAA 4WZVA 3P24A 2OXWA 1ZP5A 3K7LA 4ILWD 3HB2P 1OZ9A 3OHOA 2Z8ZA 4H2EA 2CLTA 1SLMA 2X3AA 4GR3A 1HFCA 5I43A 1JJ9A 1K7IA 3DTIA 5D2BA 4DV8A 3F18A 3UVCA 4CTHA 4WK7A 1QICA 1G4KA 3KWVC 5I0LA 1QJIA 2Z8XA 1PWPA 1OMJA 2DDFA 1BIWA 3LQBA 2HU6A 1K7GA 1RM8A 1YOUA 3KMCA 4AXQA 2FV9A 4DF9A 2I47A 4AIGA 3KHIA 3LE9A 1UTTA 2DDYA 1G49A 456CA 1B3DA 2JNPA 1R54A 1KUKA 3LEAA 2E2DA 1GE5A 4IJOA 3O64A 2KRJA 966CA 2ML2A 1GKCA 1R1JA 4WKEA 1DTHA 5I3MA 2X7MA 1Z3JA 2YO1A 1H71P 2DW2A 3O2XA 4H49A 1IAGA 2N8RA 1GE7A 3N2UA 1AF0A 4EFSA 1PWVA 2PJTA 4HX3A 2OW1A 1KUIA 3EHXA 2J83A 4GUYA 3OHLA 5LABA 2YO0A 3DWBA 1EB6A 3DPFA 4DD8A 1GE6A 1BM6A 4G9LA 1UMTA 3EDZA 1I73A 1FBLA 1Y8JA 1MMPA 5I4OA 4GF1A 3LUNA 3HBVP 2W14A 1JIWP 4PKUA 2RJPA 2AIGP 1O0TA 3B8ZA 2USNA 1IAEA 4XM7A 3ZVSA 1EAKA 1YP1A 1R1IA 2TCLA 3LJTA 1OO9A 1ZTQA 2JSDA 3Q2GA 3TS4A 2J0TA 2L0RA 1IACA 4JA1A 5D1SA 1HY7A 3L0TA 4XM6A 2WO8A 3U1RA 1HOVA 1C3IA 4H1QA 3L0VA 3HY7A 2CKIA 4WF6A 1XFUA 1BKCE 1SU3A 3I7IA 2ZJ7A 1IAAA 1YQYA 3I7GA 2OXUA 5BPAA 2D1NA 2O36A 1YCMA 5I2ZA 2ZVDA 1XURA 3LUMA 1HFSA 1G05A 2JIHA 3BA0A 1SLNA 4HMAA 1RMZA 830CA 1BQOA 4I03A 2RJQA 1ZVXA 3EWJA 2WOAA 4GQLA 4A3WA 1ASTA 1CGFA 2OVXA 1MMQA 1BKCI 2MLRA 3KEKA 3GBOA 3EHYA 1PWQA 5CUHA 1CGEA 4XCTA 4XBHA 2X3CA 4L7AA 2POJA 2YUFA 3VI1A 1CK7A 3LILA 2Y6CA 5BOTA 4H76A 3NTNA 1BZSA 3WV3A 2QPJA 1XM5A 1MNCA 1JAPA 3KMEA 3VTGA 1J7NA 1C8TA 3A6ZA 4PKVA 4GR8A 2Z2DA 3TSKA 3RTTA 1XFZA 4H30A 4FVLA 4PKWA 1CQRA 2QUBA 3USNA 2W15A 1D8MA 1QUAA 1BKCA 1ND1A 1DMTA 2K9CA 3WP8A 1UEAA 2E3XA 5CXAA 1IADA 1FLSA 1KUGA 3TVCA 3HBUP 1FM1A 4DT5A 1L6JA 2XS4A 1O0QA 2Y6DA 1JAQA 4L19A 3LKAA 4PKQA 4AYKA 3LJZA 4GWMA 1R1HA 3S6LA 5B5PA 2DW1A 3N2VA 2OY2A 2W0DA 2QUAA 4GWNA 1MMRA 4FXYP 1JAOA 2AGMA 1GO8P 2OXZA 3F15A 1JKYA 3AYKA 5D3CA 1JH1A 4IUWA 3DL1A 3F17A 1BUDA 3LK8A 4Q1LA 4PKRA 4I35A 1S4BP 3F1AA 1D7XA 1BSWA 1C7KA 1USNA 4G0DA 1P9HA 3LA9A 2XQHA 2MZIA 3KRYA 1XFWA 3LIKA 3LQ0A 3NX7A 1R55A 4ON1A 3ZXHA 4L63A 2JT5A 2OW9A 3EDHA 1AKLA 2OW2A 2A8HA 4A7BA 2DW0A 3LAAA 2V4BA 1CIZA 5JMYA 2EROA 3LMCA 1G9KA 4IN9A 1QIBA 2D1OA 1CXVA 5CVWA 3AYUA 1XAXA 5D1UA 1XUCA 1CGLA 3KECA 3EDIA 2YB9A 3DSLA 1BQQM 3HDAP 5CXLA 1GXDA 2MLSA 1ZXCA 3HY9A 1GKDA 5L79A 3F16A 3EDGA 4H3XA 5BOYA 1KAPP 1OM7A 1XFVA 1XFXA 1ZS0A 3LIRA 1D5JA 3LGPA 5L7FA 1QIAA 1OS2A 1G12A 4FXQA 1I76A 4PKTA 5CZMA 5B5OA 3DNGA 1KUHA 3F19A 2O3EA 1OM6A 2ERPA 3MA2A 4L6TA 1TVIA 1I1IP 2AYKA 3E8RA 1QJJA 1A85A 3ZUKA 4AUOA 3TT4A 4H82A 1UTZA 4XM8A 1HV5A 1Y0VA 4J4MA 1AYKA 1JANA 1OS9A 2OW0A 1SRPA 3HDBA 1A86A 1UMSA 3G42A 2YIGA 1XFYA 1JK3A 3G5CA 1KUFA 1KBCA 1PWWA 1XUDA 4JQGA 1SMPA 4R3VA 2JT6A 1IABA 4ZR5A 5D7WA 4DPEA 3RTSA 4JP4A 2OZRA 1BUVM 1CAQA 3DTKA 1ZXVA 2OVZA 3AIGA 1ROSA 1SATA 2ZJ6A 1D8FA 3ULTA 1Q3AA 2MZHA 3KEJA 1HTDA 3SHIA 3CKIA 4GR0A 3V96B 3B92A 1MMBA 4JIJA 1WNIA 4WKIA 2ERQA 3DPEA 2FV5A 4FU4A 3WV1A 1JIZA 2OY4A 3P1VA 4QKZA 5H8XA 2K2GA 2WO9A 2MZEA 1Y93A 2W12A 3Q2HA 5I12A 3B2ZA 1EUBA 3LJGA 1OM8A 1ATLA 1GO7P
chains in the Genus database with same CATH topology
3K7NA 1B8YA 3ELMA 1K7QA 3WV2A 2XS3A 2SRTA 5D1TA 3DTEA 1PWUA 4H84A 2OI0A 2W13A 3A70A 4PKSA 2X3BA 3HYGA 4JPAA 4WZVA 3P24A 2OXWA 1ZP5A 3K7LA 4ILWD 3HB2P 3OHOA 2Z8ZA 4H2EA 2CLTA 1SLMA 2X3AA 4GR3A 1HFCA 5I43A 1JJ9A 1K7IA 3DTIA 5D2BA 4DV8A 3F18A 3UVCA 4CTHA 4WK7A 1QICA 1G4KA 3KWVC 5I0LA 1QJIA 2Z8XA 1PWPA 1OMJA 2DDFA 1BIWA 3LQBA 2HU6A 1K7GA 1RM8A 1YOUA 3KMCA 4AXQA 2FV9A 4DF9A 2I47A 4AIGA 3KHIA 3LE9A 1UTTA 2DDYA 1G49A 456CA 1B3DA 2JNPA 1R54A 1KUKA 3LEAA 2E2DA 1GE5A 4IJOA 3O64A 2KRJA 966CA 2ML2A 1GKCA 1R1JA 4WKEA 1DTHA 5I3MA 2X7MA 1Z3JA 2YO1A 1H71P 2DW2A 3O2XA 4H49A 1IAGA 2N8RA 1GE7A 3N2UA 1AF0A 4EFSA 1PWVA 2PJTA 4HX3A 2OW1A 1KUIA 3EHXA 2J83A 4GUYA 3OHLA 5LABA 2YO0A 3DWBA 1EB6A 3DPFA 4DD8A 1GE6A 1BM6A 4G9LA 1UMTA 3EDZA 1I73A 1FBLA 1Y8JA 1MMPA 5I4OA 4GF1A 3LUNA 3HBVP 2W14A 1JIWP 4PKUA 2RJPA 2AIGP 1O0TA 3B8ZA 2USNA 1IAEA 4XM7A 3ZVSA 1EAKA 1YP1A 1R1IA 2TCLA 3LJTA 1OO9A 1ZTQA 2JSDA 3Q2GA 3TS4A 2J0TA 2L0RA 1IACA 4JA1A 5D1SA 1HY7A 3L0TA 4XM6A 2WO8A 3U1RA 1HOVA 1C3IA 4H1QA 3L0VA 3HY7A 2CKIA 4WF6A 1XFUA 1BKCE 1SU3A 3I7IA 2ZJ7A 1IAAA 1YQYA 3I7GA 2OXUA 5BPAA 2D1NA 2O36A 1YCMA 5I2ZA 2ZVDA 1XURA 3LUMA 1HFSA 1G05A 2JIHA 3BA0A 1SLNA 4HMAA 1RMZA 830CA 1BQOA 4I03A 2RJQA 1ZVXA 3EWJA 2WOAA 4GQLA 4A3WA 1ASTA 1CGFA 2OVXA 1MMQA 1BKCI 2MLRA 3KEKA 3GBOA 3EHYA 1PWQA 5CUHA 1CGEA 4XCTA 4XBHA 2X3CA 4L7AA 2POJA 2YUFA 3VI1A 1CK7A 3LILA 2Y6CA 5BOTA 4H76A 3NTNA 1BZSA 3WV3A 2QPJA 3KMEA 1MNCA 1JAPA 3VTGA 1J7NA 1C8TA 3A6ZA 4PKVA 4GR8A 2Z2DA 3TSKA 3RTTA 1XFZA 4H30A 4FVLA 4PKWA 1CQRA 2QUBA 3USNA 2W15A 1D8MA 1QUAA 1BKCA 1ND1A 1DMTA 2K9CA 3WP8A 1UEAA 2E3XA 5CXAA 1IADA 1FLSA 1KUGA 3TVCA 3HBUP 1FM1A 1L6JA 2XS4A 1O0QA 2Y6DA 1JAQA 4L19A 3LKAA 4PKQA 4AYKA 3LJZA 4GWMA 1R1HA 3S6LA 5B5PA 2DW1A 3N2VA 2OY2A 2W0DA 2QUAA 4GWNA 1MMRA 4FXYP 1JAOA 2AGMA 1GO8P 2OXZA 3F15A 1JKYA 3AYKA 5D3CA 1JH1A 4IUWA 3DL1A 3F17A 1BUDA 3LK8A 4Q1LA 4PKRA 4I35A 1S4BP 3F1AA 1D7XA 1BSWA 1C7KA 1USNA 4G0DA 1P9HA 3LA9A 2XQHA 2MZIA 3KRYA 1XFWA 3LIKA 3LQ0A 3NX7A 1R55A 4ON1A 3ZXHA 4L63A 2JT5A 2OW9A 3EDHA 1AKLA 2OW2A 2A8HA 4A7BA 2DW0A 3LAAA 2V4BA 1CIZA 5JMYA 2EROA 3LMCA 1G9KA 4IN9A 1QIBA 2D1OA 1CXVA 5CVWA 3AYUA 5D1UA 1XUCA 1CGLA 3KECA 3EDIA 2YB9A 3DSLA 1BQQM 3HDAP 5CXLA 1GXDA 2MLSA 1ZXCA 3HY9A 1GKDA 5L79A 3F16A 3EDGA 4H3XA 5BOYA 1KAPP 1OM7A 1XFVA 1XFXA 1ZS0A 3LIRA 1D5JA 3LGPA 5L7FA 1QIAA 1OS2A 1G12A 4FXQA 1I76A 4PKTA 5CZMA 5B5OA 3DNGA 1KUHA 3F19A 2O3EA 1OM6A 2ERPA 3MA2A 4L6TA 1I1IP 2AYKA 3E8RA 1QJJA 1A85A 3ZUKA 4AUOA 3TT4A 4H82A 1UTZA 4XM8A 1HV5A 1Y0VA 4J4MA 1AYKA 1JANA 1OS9A 2OW0A 1SRPA 3HDBA 1A86A 1UMSA 3G42A 2YIGA 1XFYA 1JK3A 3G5CA 1KUFA 1KBCA 1PWWA 1XUDA 4JQGA 1SMPA 4R3VA 2JT6A 1IABA 4ZR5A 5D7WA 4DPEA 3RTSA 4JP4A 2OZRA 1BUVM 1CAQA 3DTKA 1ZXVA 2OVZA 3AIGA 1ROSA 1SATA 2ZJ6A 1D8FA 3ULTA 1Q3AA 2MZHA 3KEJA 1HTDA 3SHIA 3CKIA 4GR0A 3V96B 3B92A 1MMBA 4JIJA 1WNIA 4WKIA 2ERQA 3DPEA 2FV5A 4FU4A 3WV1A 1JIZA 2OY4A 3P1VA 4QKZA 5H8XA 2K2GA 2WO9A 2MZEA 1Y93A 2W12A 3Q2HA 5I12A 3B2ZA 1EUBA 3LJGA 1OM8A 1ATLA 1GO7P
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K7N A;  1B8Y A;  3ELM A;  1K7Q A;  3WV2 A;  2XS3 A;  2SRT A;  5D1T A;  1PWU A;  4H84 A;  2OI0 A;  2W13 A;  3A70 A;  4PKS A;  2X3B A;  3HYG A;  4JPA A;  4WZV A;  3P24 A;  2OXW A;  1ZP5 A;  3K7L A;  4ILW D;  3HB2 P;  3OHO A;  2Z8Z A;  4H2E A;  2CLT A;  1SLM A;  2X3A A;  4GR3 A;  1HFC A;  5I43 A;  1JJ9 A;  1K7I A;  5D2B A;  4DV8 A;  3F18 A;  3UVC A;  4CTH A;  4WK7 A;  1QIC A;  1G4K A;  3KWV C;  5I0L A;  1QJI A;  2Z8X A;  1PWP A;  1OMJ A;  2DDF A;  1BIW A;  3LQB A;  2HU6 A;  1K7G A;  1RM8 A;  1YOU A;  3KMC A;  4AXQ A;  2FV9 A;  4DF9 A;  2I47 A;  4AIG A;  3KHI A;  3LE9 A;  1UTT A;  2DDY A;  1G49 A;  456C A;  1B3D A;  2JNP A;  1R54 A;  1KUK A;  3LEA A;  2E2D A;  1GE5 A;  4IJO A;  3O64 A;  2KRJ A;  966C A;  2ML2 A;  1GKC A;  1R1J A;  4WKE A;  1DTH A;  5I3M A;  2X7M A;  1Z3J A;  2YO1 A;  1H71 P;  2DW2 A;  3O2X A;  4H49 A;  1IAG A;  2N8R A;  1GE7 A;  3N2U A;  1AF0 A;  4EFS A;  1PWV A;  2PJT A;  4HX3 A;  2OW1 A;  1KUI A;  3EHX A;  2J83 A;  4GUY A;  3OHL A;  5LAB A;  2YO0 A;  3DWB A;  1EB6 A;  3DPF A;  4DD8 A;  1GE6 A;  1BM6 A;  4G9L A;  1UMT A;  3EDZ A;  1I73 A;  1FBL A;  1Y8J A;  1MMP A;  5I4O A;  4GF1 A;  3LUN A;  3HBV P;  2W14 A;  1JIW P;  4PKU A;  2RJP A;  2AIG P;  1O0T A;  3B8Z A;  2USN A;  1IAE A;  4XM7 A;  3ZVS A;  1EAK A;  1YP1 A;  1R1I A;  2TCL A;  3LJT A;  1OO9 A;  1ZTQ A;  2JSD A;  3Q2G A;  3TS4 A;  2J0T A;  2L0R A;  1IAC A;  4JA1 A;  5D1S A;  1HY7 A;  3L0T A;  4XM6 A;  2WO8 A;  3U1R A;  1HOV A;  1C3I A;  4H1Q A;  3L0V A;  3HY7 A;  2CKI A;  4WF6 A;  1XFU A;  1BKC E;  1SU3 A;  3I7I A;  2ZJ7 A;  1IAA A;  1YQY A;  3I7G A;  2OXU A;  5BPA A;  2D1N A;  2O36 A;  1YCM A;  5I2Z A;  2ZVD A;  1XUR A;  3LUM A;  1HFS A;  1G05 A;  2JIH A;  3BA0 A;  1SLN A;  4HMA A;  1RMZ A;  830C A;  1BQO A;  4I03 A;  2RJQ A;  1ZVX A;  3EWJ A;  2WOA A;  4GQL A;  4A3W A;  1AST A;  1CGF A;  2OVX A;  1MMQ A;  1BKC I;  2MLR A;  3KEK A;  3GBO A;  3EHY A;  1PWQ A;  5CUH A;  1CGE A;  4XCT A;  4XBH A;  2X3C A;  2POJ A;  3VI1 A;  1CK7 A;  3LIL A;  2Y6C A;  5BOT A;  4H76 A;  3NTN A;  1BZS A;  3WV3 A;  2QPJ A;  3KME A;  1MNC A;  1JAP A;  3VTG A;  1J7N A;  1C8T A;  3A6Z A;  4PKV A;  4GR8 A;  2Z2D A;  3TSK A;  3RTT A;  1XFZ A;  4H30 A;  4FVL A;  4PKW A;  1CQR A;  2QUB A;  3USN A;  2W15 A;  1D8M A;  1QUA A;  1BKC A;  1ND1 A;  1DMT A;  2K9C A;  3WP8 A;  1UEA A;  2E3X A;  5CXA A;  1IAD A;  1FLS A;  1KUG A;  3TVC A;  3HBU P;  1FM1 A;  1L6J A;  2XS4 A;  1O0Q A;  2Y6D A;  1JAQ A;  4L19 A;  3LKA A;  4PKQ A;  4AYK A;  3LJZ A;  4GWM A;  1R1H A;  3S6L A;  5B5P A;  2DW1 A;  3N2V A;  2OY2 A;  2W0D A;  2QUA A;  4GWN A;  1MMR A;  4FXY P;  1JAO A;  2AGM A;  1GO8 P;  2OXZ A;  3F15 A;  1JKY A;  3AYK A;  5D3C A;  1JH1 A;  4IUW A;  3DL1 A;  3F17 A;  1BUD A;  3LK8 A;  4Q1L A;  4PKR A;  4I35 A;  1S4B P;  3F1A A;  1D7X A;  1BSW A;  1C7K A;  1USN A;  4G0D A;  1P9H A;  3LA9 A;  2XQH A;  2MZI A;  3KRY A;  1XFW A;  3LIK A;  3LQ0 A;  3NX7 A;  1R55 A;  4ON1 A;  3ZXH A;  4L63 A;  2JT5 A;  2OW9 A;  3EDH A;  1AKL A;  2OW2 A;  2A8H A;  4A7B A;  2DW0 A;  3LAA A;  2V4B A;  1CIZ A;  5JMY A;  2ERO A;  3LMC A;  1G9K A;  4IN9 A;  1QIB A;  2D1O A;  1CXV A;  5CVW A;  3AYU A;  5D1U A;  1XUC A;  1CGL A;  3KEC A;  3EDI A;  2YB9 A;  3DSL A;  1BQQ M;  3HDA P;  5CXL A;  1GXD A;  2MLS A;  1ZXC A;  3HY9 A;  1GKD A;  5L79 A;  3F16 A;  3EDG A;  4H3X A;  5BOY A;  1KAP P;  1OM7 A;  1XFV A;  1XFX A;  1ZS0 A;  3LIR A;  1D5J A;  3LGP A;  5L7F A;  1QIA A;  1OS2 A;  1G12 A;  4FXQ A;  1I76 A;  4PKT A;  5CZM A;  5B5O A;  3DNG A;  1KUH A;  3F19 A;  2O3E A;  1OM6 A;  2ERP A;  3MA2 A;  4L6T A;  1I1I P;  2AYK A;  3E8R A;  1QJJ A;  1A85 A;  3ZUK A;  4AUO A;  3TT4 A;  4H82 A;  1UTZ A;  4XM8 A;  1HV5 A;  1Y0V A;  4J4M A;  1AYK A;  1JAN A;  1OS9 A;  2OW0 A;  1SRP A;  3HDB A;  1A86 A;  1UMS A;  3G42 A;  2YIG A;  1XFY A;  1JK3 A;  3G5C A;  1KUF A;  1KBC A;  1PWW A;  1XUD A;  4JQG A;  1SMP A;  4R3V A;  2JT6 A;  1IAB A;  4ZR5 A;  5D7W A;  4DPE A;  3RTS A;  4JP4 A;  2OZR A;  1BUV M;  1CAQ A;  1ZXV A;  2OVZ A;  3AIG A;  1ROS A;  1SAT A;  2ZJ6 A;  1D8F A;  3ULT A;  1Q3A A;  2MZH A;  3KEJ A;  1HTD A;  3SHI A;  3CKI A;  4GR0 A;  3V96 B;  3B92 A;  1MMB A;  4JIJ A;  1WNI A;  4WKI A;  2ERQ A;  3DPE A;  2FV5 A;  4FU4 A;  3WV1 A;  1JIZ A;  2OY4 A;  3P1V A;  4QKZ A;  5H8X A;  2K2G A;  2WO9 A;  2MZE A;  1Y93 A;  2W12 A;  3Q2H A;  5I12 A;  3B2Z A;  1EUB A;  3LJG A;  1OM8 A;  1ATL A;  1GO7 P; 
#chains in the Genus database with same CATH topology
 3K7N A;  1B8Y A;  3ELM A;  1K7Q A;  3WV2 A;  2XS3 A;  2SRT A;  5D1T A;  3DTE A;  1PWU A;  4H84 A;  2OI0 A;  2W13 A;  3A70 A;  4PKS A;  2X3B A;  3HYG A;  4JPA A;  4WZV A;  3P24 A;  2OXW A;  1ZP5 A;  3K7L A;  4ILW D;  3HB2 P;  1OZ9 A;  3OHO A;  2Z8Z A;  4H2E A;  2CLT A;  1SLM A;  2X3A A;  4GR3 A;  1HFC A;  5I43 A;  1JJ9 A;  1K7I A;  3DTI A;  5D2B A;  4DV8 A;  3F18 A;  3UVC A;  4CTH A;  4WK7 A;  1QIC A;  1G4K A;  3KWV C;  5I0L A;  1QJI A;  2Z8X A;  1PWP A;  1OMJ A;  2DDF A;  1BIW A;  3LQB A;  2HU6 A;  1K7G A;  1RM8 A;  1YOU A;  3KMC A;  4AXQ A;  2FV9 A;  4DF9 A;  2I47 A;  4AIG A;  3KHI A;  3LE9 A;  1UTT A;  2DDY A;  1G49 A;  456C A;  1B3D A;  2JNP A;  1R54 A;  1KUK A;  3LEA A;  2E2D A;  1GE5 A;  4IJO A;  3O64 A;  2KRJ A;  966C A;  2ML2 A;  1GKC A;  1R1J A;  4WKE A;  1DTH A;  5I3M A;  2X7M A;  1Z3J A;  2YO1 A;  1H71 P;  2DW2 A;  3O2X A;  4H49 A;  1IAG A;  2N8R A;  1GE7 A;  3N2U A;  1AF0 A;  4EFS A;  1PWV A;  2PJT A;  4HX3 A;  2OW1 A;  1KUI A;  3EHX A;  2J83 A;  4GUY A;  3OHL A;  5LAB A;  2YO0 A;  3DWB A;  1EB6 A;  3DPF A;  4DD8 A;  1GE6 A;  1BM6 A;  4G9L A;  1UMT A;  3EDZ A;  1I73 A;  1FBL A;  1Y8J A;  1MMP A;  5I4O A;  4GF1 A;  3LUN A;  3HBV P;  2W14 A;  1JIW P;  4PKU A;  2RJP A;  2AIG P;  1O0T A;  3B8Z A;  2USN A;  1IAE A;  4XM7 A;  3ZVS A;  1EAK A;  1YP1 A;  1R1I A;  2TCL A;  3LJT A;  1OO9 A;  1ZTQ A;  2JSD A;  3Q2G A;  3TS4 A;  2J0T A;  2L0R A;  1IAC A;  4JA1 A;  5D1S A;  1HY7 A;  3L0T A;  4XM6 A;  2WO8 A;  3U1R A;  1HOV A;  1C3I A;  4H1Q A;  3L0V A;  3HY7 A;  2CKI A;  4WF6 A;  1XFU A;  1BKC E;  1SU3 A;  3I7I A;  2ZJ7 A;  1IAA A;  1YQY A;  3I7G A;  2OXU A;  5BPA A;  2D1N A;  2O36 A;  1YCM A;  5I2Z A;  2ZVD A;  1XUR A;  3LUM A;  1HFS A;  1G05 A;  2JIH A;  3BA0 A;  1SLN A;  4HMA A;  1RMZ A;  830C A;  1BQO A;  4I03 A;  2RJQ A;  1ZVX A;  3EWJ A;  2WOA A;  4GQL A;  4A3W A;  1AST A;  1CGF A;  2OVX A;  1MMQ A;  1BKC I;  2MLR A;  3KEK A;  3GBO A;  3EHY A;  1PWQ A;  5CUH A;  1CGE A;  4XCT A;  4XBH A;  2X3C A;  4L7A A;  2POJ A;  2YUF A;  3VI1 A;  1CK7 A;  3LIL A;  2Y6C A;  5BOT A;  4H76 A;  3NTN A;  1BZS A;  3WV3 A;  2QPJ A;  1XM5 A;  1MNC A;  1JAP A;  3KME A;  3VTG A;  1J7N A;  1C8T A;  3A6Z A;  4PKV A;  4GR8 A;  2Z2D A;  3TSK A;  3RTT A;  1XFZ A;  4H30 A;  4FVL A;  4PKW A;  1CQR A;  2QUB A;  3USN A;  2W15 A;  1D8M A;  1QUA A;  1BKC A;  1ND1 A;  1DMT A;  2K9C A;  3WP8 A;  1UEA A;  2E3X A;  5CXA A;  1IAD A;  1FLS A;  1KUG A;  3TVC A;  3HBU P;  1FM1 A;  4DT5 A;  1L6J A;  2XS4 A;  1O0Q A;  2Y6D A;  1JAQ A;  4L19 A;  3LKA A;  4PKQ A;  4AYK A;  3LJZ A;  4GWM A;  1R1H A;  3S6L A;  5B5P A;  2DW1 A;  3N2V A;  2OY2 A;  2W0D A;  2QUA A;  4GWN A;  1MMR A;  4FXY P;  1JAO A;  2AGM A;  1GO8 P;  2OXZ A;  3F15 A;  1JKY A;  3AYK A;  5D3C A;  1JH1 A;  4IUW A;  3DL1 A;  3F17 A;  1BUD A;  3LK8 A;  4Q1L A;  4PKR A;  4I35 A;  1S4B P;  3F1A A;  1D7X A;  1BSW A;  1C7K A;  1USN A;  4G0D A;  1P9H A;  3LA9 A;  2XQH A;  2MZI A;  3KRY A;  1XFW A;  3LIK A;  3LQ0 A;  3NX7 A;  1R55 A;  4ON1 A;  3ZXH A;  4L63 A;  2JT5 A;  2OW9 A;  3EDH A;  1AKL A;  2OW2 A;  2A8H A;  4A7B A;  2DW0 A;  3LAA A;  2V4B A;  1CIZ A;  5JMY A;  2ERO A;  3LMC A;  1G9K A;  4IN9 A;  1QIB A;  2D1O A;  1CXV A;  5CVW A;  3AYU A;  1XAX A;  5D1U A;  1XUC A;  1CGL A;  3KEC A;  3EDI A;  2YB9 A;  3DSL A;  1BQQ M;  3HDA P;  5CXL A;  1GXD A;  2MLS A;  1ZXC A;  3HY9 A;  1GKD A;  5L79 A;  3F16 A;  3EDG A;  4H3X A;  5BOY A;  1KAP P;  1OM7 A;  1XFV A;  1XFX A;  1ZS0 A;  3LIR A;  1D5J A;  3LGP A;  5L7F A;  1QIA A;  1OS2 A;  1G12 A;  4FXQ A;  1I76 A;  4PKT A;  5CZM A;  5B5O A;  3DNG A;  1KUH A;  3F19 A;  2O3E A;  1OM6 A;  2ERP A;  3MA2 A;  4L6T A;  1TVI A;  1I1I P;  2AYK A;  3E8R A;  1QJJ A;  1A85 A;  3ZUK A;  4AUO A;  3TT4 A;  4H82 A;  1UTZ A;  4XM8 A;  1HV5 A;  1Y0V A;  4J4M A;  1AYK A;  1JAN A;  1OS9 A;  2OW0 A;  1SRP A;  3HDB A;  1A86 A;  1UMS A;  3G42 A;  2YIG A;  1XFY A;  1JK3 A;  3G5C A;  1KUF A;  1KBC A;  1PWW A;  1XUD A;  4JQG A;  1SMP A;  4R3V A;  2JT6 A;  1IAB A;  4ZR5 A;  5D7W A;  4DPE A;  3RTS A;  4JP4 A;  2OZR A;  1BUV M;  1CAQ A;  3DTK A;  1ZXV A;  2OVZ A;  3AIG A;  1ROS A;  1SAT A;  2ZJ6 A;  1D8F A;  3ULT A;  1Q3A A;  2MZH A;  3KEJ A;  1HTD A;  3SHI A;  3CKI A;  4GR0 A;  3V96 B;  3B92 A;  1MMB A;  4JIJ A;  1WNI A;  4WKI A;  2ERQ A;  3DPE A;  2FV5 A;  4FU4 A;  3WV1 A;  1JIZ A;  2OY4 A;  3P1V A;  4QKZ A;  5H8X A;  2K2G A;  2WO9 A;  2MZE A;  1Y93 A;  2W12 A;  3Q2H A;  5I12 A;  3B2Z A;  1EUB A;  3LJG A;  1OM8 A;  1ATL A;  1GO7 P; 
#chains in the Genus database with same CATH homology
 3K7N A;  1B8Y A;  3ELM A;  1K7Q A;  3WV2 A;  2XS3 A;  2SRT A;  5D1T A;  3DTE A;  1PWU A;  4H84 A;  2OI0 A;  2W13 A;  3A70 A;  4PKS A;  2X3B A;  3HYG A;  4JPA A;  4WZV A;  3P24 A;  2OXW A;  1ZP5 A;  3K7L A;  4ILW D;  3HB2 P;  3OHO A;  2Z8Z A;  4H2E A;  2CLT A;  1SLM A;  2X3A A;  4GR3 A;  1HFC A;  5I43 A;  1JJ9 A;  1K7I A;  3DTI A;  5D2B A;  4DV8 A;  3F18 A;  3UVC A;  4CTH A;  4WK7 A;  1QIC A;  1G4K A;  3KWV C;  5I0L A;  1QJI A;  2Z8X A;  1PWP A;  1OMJ A;  2DDF A;  1BIW A;  3LQB A;  2HU6 A;  1K7G A;  1RM8 A;  1YOU A;  3KMC A;  4AXQ A;  2FV9 A;  4DF9 A;  2I47 A;  4AIG A;  3KHI A;  3LE9 A;  1UTT A;  2DDY A;  1G49 A;  456C A;  1B3D A;  2JNP A;  1R54 A;  1KUK A;  3LEA A;  2E2D A;  1GE5 A;  4IJO A;  3O64 A;  2KRJ A;  966C A;  2ML2 A;  1GKC A;  1R1J A;  4WKE A;  1DTH A;  5I3M A;  2X7M A;  1Z3J A;  2YO1 A;  1H71 P;  2DW2 A;  3O2X A;  4H49 A;  1IAG A;  2N8R A;  1GE7 A;  3N2U A;  1AF0 A;  4EFS A;  1PWV A;  2PJT A;  4HX3 A;  2OW1 A;  1KUI A;  3EHX A;  2J83 A;  4GUY A;  3OHL A;  5LAB A;  2YO0 A;  3DWB A;  1EB6 A;  3DPF A;  4DD8 A;  1GE6 A;  1BM6 A;  4G9L A;  1UMT A;  3EDZ A;  1I73 A;  1FBL A;  1Y8J A;  1MMP A;  5I4O A;  4GF1 A;  3LUN A;  3HBV P;  2W14 A;  1JIW P;  4PKU A;  2RJP A;  2AIG P;  1O0T A;  3B8Z A;  2USN A;  1IAE A;  4XM7 A;  3ZVS A;  1EAK A;  1YP1 A;  1R1I A;  2TCL A;  3LJT A;  1OO9 A;  1ZTQ A;  2JSD A;  3Q2G A;  3TS4 A;  2J0T A;  2L0R A;  1IAC A;  4JA1 A;  5D1S A;  1HY7 A;  3L0T A;  4XM6 A;  2WO8 A;  3U1R A;  1HOV A;  1C3I A;  4H1Q A;  3L0V A;  3HY7 A;  2CKI A;  4WF6 A;  1XFU A;  1BKC E;  1SU3 A;  3I7I A;  2ZJ7 A;  1IAA A;  1YQY A;  3I7G A;  2OXU A;  5BPA A;  2D1N A;  2O36 A;  1YCM A;  5I2Z A;  2ZVD A;  1XUR A;  3LUM A;  1HFS A;  1G05 A;  2JIH A;  3BA0 A;  1SLN A;  4HMA A;  1RMZ A;  830C A;  1BQO A;  4I03 A;  2RJQ A;  1ZVX A;  3EWJ A;  2WOA A;  4GQL A;  4A3W A;  1AST A;  1CGF A;  2OVX A;  1MMQ A;  1BKC I;  2MLR A;  3KEK A;  3GBO A;  3EHY A;  1PWQ A;  5CUH A;  1CGE A;  4XCT A;  4XBH A;  2X3C A;  4L7A A;  2POJ A;  2YUF A;  3VI1 A;  1CK7 A;  3LIL A;  2Y6C A;  5BOT A;  4H76 A;  3NTN A;  1BZS A;  3WV3 A;  2QPJ A;  3KME A;  1MNC A;  1JAP A;  3VTG A;  1J7N A;  1C8T A;  3A6Z A;  4PKV A;  4GR8 A;  2Z2D A;  3TSK A;  3RTT A;  1XFZ A;  4H30 A;  4FVL A;  4PKW A;  1CQR A;  2QUB A;  3USN A;  2W15 A;  1D8M A;  1QUA A;  1BKC A;  1ND1 A;  1DMT A;  2K9C A;  3WP8 A;  1UEA A;  2E3X A;  5CXA A;  1IAD A;  1FLS A;  1KUG A;  3TVC A;  3HBU P;  1FM1 A;  1L6J A;  2XS4 A;  1O0Q A;  2Y6D A;  1JAQ A;  4L19 A;  3LKA A;  4PKQ A;  4AYK A;  3LJZ A;  4GWM A;  1R1H A;  3S6L A;  5B5P A;  2DW1 A;  3N2V A;  2OY2 A;  2W0D A;  2QUA A;  4GWN A;  1MMR A;  4FXY P;  1JAO A;  2AGM A;  1GO8 P;  2OXZ A;  3F15 A;  1JKY A;  3AYK A;  5D3C A;  1JH1 A;  4IUW A;  3DL1 A;  3F17 A;  1BUD A;  3LK8 A;  4Q1L A;  4PKR A;  4I35 A;  1S4B P;  3F1A A;  1D7X A;  1BSW A;  1C7K A;  1USN A;  4G0D A;  1P9H A;  3LA9 A;  2XQH A;  2MZI A;  3KRY A;  1XFW A;  3LIK A;  3LQ0 A;  3NX7 A;  1R55 A;  4ON1 A;  3ZXH A;  4L63 A;  2JT5 A;  2OW9 A;  3EDH A;  1AKL A;  2OW2 A;  2A8H A;  4A7B A;  2DW0 A;  3LAA A;  2V4B A;  1CIZ A;  5JMY A;  2ERO A;  3LMC A;  1G9K A;  4IN9 A;  1QIB A;  2D1O A;  1CXV A;  5CVW A;  3AYU A;  5D1U A;  1XUC A;  1CGL A;  3KEC A;  3EDI A;  2YB9 A;  3DSL A;  1BQQ M;  3HDA P;  5CXL A;  1GXD A;  2MLS A;  1ZXC A;  3HY9 A;  1GKD A;  5L79 A;  3F16 A;  3EDG A;  4H3X A;  5BOY A;  1KAP P;  1OM7 A;  1XFV A;  1XFX A;  1ZS0 A;  3LIR A;  1D5J A;  3LGP A;  5L7F A;  1QIA A;  1OS2 A;  1G12 A;  4FXQ A;  1I76 A;  4PKT A;  5CZM A;  5B5O A;  3DNG A;  1KUH A;  3F19 A;  2O3E A;  1OM6 A;  2ERP A;  3MA2 A;  4L6T A;  1I1I P;  2AYK A;  3E8R A;  1QJJ A;  1A85 A;  3ZUK A;  4AUO A;  3TT4 A;  4H82 A;  1UTZ A;  4XM8 A;  1HV5 A;  1Y0V A;  4J4M A;  1AYK A;  1JAN A;  1OS9 A;  2OW0 A;  1SRP A;  3HDB A;  1A86 A;  1UMS A;  3G42 A;  2YIG A;  1XFY A;  1JK3 A;  3G5C A;  1KUF A;  1KBC A;  1PWW A;  1XUD A;  4JQG A;  1SMP A;  4R3V A;  2JT6 A;  1IAB A;  4ZR5 A;  5D7W A;  4DPE A;  3RTS A;  4JP4 A;  2OZR A;  1BUV M;  1CAQ A;  3DTK A;  1ZXV A;  2OVZ A;  3AIG A;  1ROS A;  1SAT A;  2ZJ6 A;  1D8F A;  3ULT A;  1Q3A A;  2MZH A;  3KEJ A;  1HTD A;  3SHI A;  3CKI A;  4GR0 A;  3V96 B;  3B92 A;  1MMB A;  4JIJ A;  1WNI A;  4WKI A;  2ERQ A;  3DPE A;  2FV5 A;  4FU4 A;  3WV1 A;  1JIZ A;  2OY4 A;  3P1V A;  4QKZ A;  5H8X A;  2K2G A;  2WO9 A;  2MZE A;  1Y93 A;  2W12 A;  3Q2H A;  5I12 A;  3B2Z A;  1EUB A;  3LJG A;  1OM8 A;  1ATL A;  1GO7 P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...