3HB2P

Prtc methionine mutants: m226i
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIISYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
molecule keywords Secreted protease C
total genus 161
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hb2P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hb2P02
4Q1LA 5D1TA 1MNCA 2FV9A 3N2VA 1PWVA 3EDHA 3U1RA 2WO9A 5JMYA 3EDIA 2ERPA 1PWPA 3LUMA 5I3MA 3O2XA 1PWQA 1JAQA 2SRTA 2X3BA 3DSLA 2X3AA 3G5CA 4L19A 1YCMA 1BQQM 3KMCA 3ZVSA 2AGMA 3MA2A 1ND1A 3F18A 1GXDA 3O64A 4G9LA 1ZS0A 3P24A 1R1JA 3KEKA 4WZVA 2MLRA 1CQRA 1XFWA 3OHLA 1IADA 1MMRA 3UVCA 4DV8A 3TT4A 1K7QA 3ZUKA 4XM6A 1Y93A 3P1VA 1IABA 3WV1A 2W0DA 1SU3A 1IAAA 1CGFA 2Z8ZA 1S4BP 3Q2GA 5D3CA 4H84A 4L6TA 3LE9A 4FXYP 4WF6A 1XFUA 1YP1A 1ZXVA 1KUKA 2XS3A 1JK3A 1GE6A 4HMAA 3LQBA 1HFSA 3RTSA 4PKRA 4H30A 4GUYA 2POJA 1BIWA 4JQGA 4ZR5A 1BM6A 1FM1A 2OXZA 3ZXHA 4GF1A 2AYKA 2OY2A 1ZTQA 5L7FA 5CVWA 2WO8A 2MZIA 3E8RA 2X3CA 3USNA 1GE7A 4H49A 2FV5A 1CAQA 1QUAA 2X7MA 2JT6A 1CGEA 1UEAA 5L79A 4H2EA 1BKCI 2ML2A 2Z2DA 4WK7A 1C8TA 2ZJ7A 3LGPA 1DMTA 4H82A 2V4BA 2JSDA 1Q3AA 2HU6A 5D1SA 1ASTA 4PKWA 1XFXA 3TS4A 1ATLA 1SRPA 4GWMA 1B8YA 3EWJA 2YO0A 2OW0A 5D2BA 2OW9A 3EHXA 1O0TA 5I2ZA 1XUDA 1ZXCA 4H3XA 3I7GA 1FLSA 2KRJA 1QJJA 3LIKA 5D7WA 1JIZA 1QIBA 1BSWA 3NTNA 1ZP5A 2A8HA 3SHIA 3LQ0A 3NX7A 1EUBA 3EHYA 4GR0A 1IAGA 3LJGA 2MZHA 5BOTA 2JT5A 4FU4A 2O3EA 3OHOA 3WP8A 3GBOA 2D1NA 3AYKA 1YQYA 1QICA 3AIGA 4PKUA 1RMZA 4IJOA 2RJQA 1ZVXA 1R55A 2DW0A 4AUOA 1CXVA 4J4MA 1UMTA 3VTGA 3HBVP 4XBHA 3F16A 5CXAA 4XCTA 3DL1A 4A7BA 2USNA 1JJ9A 1XUCA 2J83A 4DD8A 4PKQA 1MMQA 1D7XA 4H76A 1OO9A 3HBUP 1OS2A 3KECA 1O0QA 3F1AA 1BUDA 3V96B 966CA 3WV3A 5I0LA 3LJTA 1JANA 456CA 3TVCA 2YO1A 1UTTA 4CTHA 1EAKA 1C7KA 1XURA 4L63A 4GR3A 3ULTA 5I4OA 1G9KA 2Z8XA 3B92A 3L0VA 2K9CA 3LK8A 2W13A 3HY7A 2N8RA 2O36A 3G42A 3A6ZA 4EFSA 1GKDA 5BPAA 1D8FA 4FXQA 3HB2P 1WNIA 1OM8A 2QUBA 1Y0VA 1L6JA 1A86A 1SATA 5LABA 1RM8A 3AYUA 3LUNA 2OI0A 4HX3A 3F19A 2W14A 2E3XA 2QUAA 3WV2A 1I76A 2OXUA 1XFVA 2W15A 1HOVA 4QKZA 1HY7A 1KAPP 2TCLA 2Y6CA 1UTZA 1QIAA 4ILWD 2J0TA 1HFCA 1R1HA 1BKCE 1K7GA 1AYKA 1C3IA 2XS4A 2I47A 1GKCA 3BA0A 3ELMA 5D1UA 3KHIA 3EDGA 3LILA 4GR8A 3KEJA 2D1OA 1JAPA 1HV5A 4DF9A 3F17A 5I43A 2YIGA 4JPAA 1G4KA 1YOUA 2ERQA 3LJZA 1D8MA 1R54A 1HTDA 4GWNA 1IAEA 1CGLA 5CXLA 4FVLA 1SLMA 4PKSA 1OS9A 4DPEA 1CK7A 2OW1A 2DW2A 2MZEA 1GO7P 4XM7A 1UMSA 2OZRA 1KUIA 1P9HA 1ROSA 1IACA 2RJPA 2JIHA 2DDYA 2QPJA 4H1QA 3DPEA 2MLSA 3HYGA 1R1IA 2DW1A 3DPFA 1BQOA 1G49A 3LIRA 3HY9A 2PJTA 830CA 4R3VA 2JNPA 2YB9A 4IUWA 2DDFA 3LA9A 1MMBA 2CKIA 1G05A 4WKIA 2OW2A 3I7IA 4ON1A 5BOYA 1BZSA 3Q2HA 2E2DA 1JIWP 1BUVM 3CKIA 4PKTA 1KBCA 3EDZA 1OM7A 1JH1A 1SMPA 1USNA 1DTHA 3F15A 5B5OA 3LEAA 2CLTA 3LMCA 2OXWA 2OVXA 4GQLA 1BKCA 1G12A 2EROA 1I1IP 2L0RA 1JAOA 1OM6A 4AYKA 3KRYA 5B5PA 3RTTA 1D5JA 3KMEA 4AXQA 3KWVC 1H71P 4AIGA 1A85A 5CZMA 4I35A 1QJIA 1CIZA 2Y6DA 4XM8A 1PWWA 1AKLA 5I12A 4JIJA 4G0DA 2XQHA 2WOAA 1MMPA 3TSKA 3B8ZA 1KUFA 2K2GA 2OVZA 4JP4A 4JA1A 3S6LA 1XFYA 4PKVA 1GE5A 1PWUA 3VI1A 1KUHA 3K7LA 1FBLA 2ZJ6A 1XFZA 3K7NA 3B2ZA 1KUGA 2W12A 3LKAA 1GO8P 3LAAA 2AIGP 4A3WA 1JKYA 1K7IA 3A70A 5CUHA 2OY4A 1Z3JA 2ZVDA 3N2UA 4IN9A 5H8XA 1J7NA 1OMJA 3HDAP 1B3DA 1Y8JA 1EB6A 3DNGA 1I73A 1AF0A 4I03A 1SLNA 3HDBA 4WKEA 3DWBA 3L0TA
chains in the Genus database with same CATH superfamily
4Q1LA 5D1TA 1MNCA 2FV9A 3N2VA 1PWVA 3EDHA 3U1RA 2WO9A 5JMYA 3EDIA 2ERPA 1PWPA 3LUMA 5I3MA 3O2XA 1PWQA 1JAQA 2SRTA 2X3BA 3DSLA 2X3AA 3G5CA 4L19A 1YCMA 1BQQM 3KMCA 3ZVSA 2AGMA 3MA2A 1ND1A 3F18A 1GXDA 3O64A 4G9LA 1ZS0A 3P24A 1R1JA 3KEKA 4WZVA 2MLRA 1CQRA 1XFWA 3OHLA 1IADA 1MMRA 3UVCA 4DV8A 3TT4A 1K7QA 3ZUKA 4XM6A 1Y93A 3P1VA 1IABA 3WV1A 2W0DA 1SU3A 1IAAA 1CGFA 2Z8ZA 1S4BP 3Q2GA 5D3CA 4H84A 4L6TA 3LE9A 4FXYP 4WF6A 1XFUA 1YP1A 1ZXVA 1KUKA 2XS3A 1JK3A 1GE6A 4HMAA 3LQBA 1HFSA 3RTSA 4L7AA 4PKRA 4H30A 4GUYA 2POJA 1BIWA 4JQGA 4ZR5A 1BM6A 1FM1A 2OXZA 3ZXHA 4GF1A 2AYKA 2OY2A 1ZTQA 5L7FA 5CVWA 2WO8A 2MZIA 3E8RA 2X3CA 3USNA 1GE7A 4H49A 2FV5A 1CAQA 1QUAA 2X7MA 2JT6A 1CGEA 1UEAA 5L79A 4H2EA 1BKCI 2ML2A 2Z2DA 4WK7A 1C8TA 2ZJ7A 3LGPA 1DMTA 4H82A 2V4BA 2JSDA 1Q3AA 2HU6A 5D1SA 1ASTA 4PKWA 1XFXA 3TS4A 1ATLA 1SRPA 4GWMA 1B8YA 3EWJA 2YO0A 2OW0A 5D2BA 2OW9A 3EHXA 1O0TA 5I2ZA 1XUDA 1ZXCA 4H3XA 3I7GA 1FLSA 2KRJA 1QJJA 3LIKA 5D7WA 1JIZA 1QIBA 1BSWA 3NTNA 1ZP5A 2A8HA 3SHIA 3LQ0A 3NX7A 1EUBA 3EHYA 4GR0A 1IAGA 3LJGA 2MZHA 5BOTA 2JT5A 4DT5A 4FU4A 2O3EA 3OHOA 3WP8A 3GBOA 2D1NA 3AYKA 1YQYA 1QICA 3AIGA 4PKUA 1RMZA 4IJOA 2RJQA 1ZVXA 1R55A 2DW0A 4AUOA 1CXVA 4J4MA 1UMTA 3VTGA 3HBVP 4XBHA 3F16A 5CXAA 4XCTA 3DL1A 4A7BA 2USNA 1JJ9A 1XUCA 2J83A 4DD8A 4PKQA 1MMQA 1D7XA 4H76A 1OO9A 3HBUP 1OS2A 3KECA 1O0QA 3F1AA 1BUDA 3V96B 966CA 3WV3A 5I0LA 3LJTA 1JANA 456CA 3TVCA 2YO1A 1UTTA 4CTHA 1EAKA 1C7KA 1XURA 4L63A 4GR3A 1OZ9A 3ULTA 5I4OA 1G9KA 2Z8XA 3B92A 3L0VA 2K9CA 3LK8A 2W13A 3HY7A 2N8RA 2O36A 3G42A 3A6ZA 4EFSA 1GKDA 5BPAA 1D8FA 4FXQA 3HB2P 1WNIA 1OM8A 2QUBA 1Y0VA 1L6JA 1A86A 1SATA 5LABA 1RM8A 3AYUA 3LUNA 2OI0A 4HX3A 3F19A 2W14A 2E3XA 2YUFA 2QUAA 3WV2A 1I76A 2OXUA 1XFVA 2W15A 1HOVA 4QKZA 1HY7A 1KAPP 2TCLA 2Y6CA 1UTZA 1QIAA 4ILWD 2J0TA 1HFCA 1R1HA 1BKCE 1K7GA 1AYKA 1C3IA 2XS4A 2I47A 1GKCA 3BA0A 3ELMA 5D1UA 3KHIA 3EDGA 3LILA 4GR8A 3KEJA 2D1OA 1JAPA 1HV5A 4DF9A 3F17A 5I43A 2YIGA 4JPAA 1G4KA 1YOUA 2ERQA 3LJZA 1D8MA 1R54A 1HTDA 4GWNA 1IAEA 1CGLA 5CXLA 4FVLA 1SLMA 4PKSA 1OS9A 4DPEA 1CK7A 2OW1A 2DW2A 2MZEA 1GO7P 4XM7A 1UMSA 2OZRA 1KUIA 1P9HA 1ROSA 1IACA 2RJPA 2JIHA 2DDYA 2QPJA 4H1QA 3DPEA 2MLSA 3HYGA 1R1IA 2DW1A 3DPFA 1BQOA 1G49A 3LIRA 3HY9A 2PJTA 830CA 4R3VA 2JNPA 2YB9A 1XAXA 4IUWA 2DDFA 3LA9A 1MMBA 2CKIA 1G05A 4WKIA 2OW2A 3I7IA 4ON1A 5BOYA 1BZSA 3Q2HA 2E2DA 1JIWP 1BUVM 3CKIA 4PKTA 3DTEA 1KBCA 3EDZA 1OM7A 1JH1A 1SMPA 1USNA 1DTHA 3F15A 5B5OA 3LEAA 1XM5A 2CLTA 3LMCA 3DTIA 2OXWA 1TVIA 2OVXA 4GQLA 1BKCA 1G12A 2EROA 1I1IP 2L0RA 1JAOA 1OM6A 4AYKA 3KRYA 5B5PA 3RTTA 1D5JA 3KMEA 4AXQA 3KWVC 1H71P 4AIGA 1A85A 5CZMA 4I35A 1QJIA 3DTKA 1CIZA 2Y6DA 4XM8A 1PWWA 1AKLA 5I12A 4JIJA 4G0DA 2XQHA 2WOAA 1MMPA 3TSKA 3B8ZA 1KUFA 2K2GA 2OVZA 4JP4A 4JA1A 3S6LA 1XFYA 4PKVA 1GE5A 1PWUA 3VI1A 1KUHA 3K7LA 1FBLA 2ZJ6A 1XFZA 3K7NA 3B2ZA 1KUGA 2W12A 3LKAA 1GO8P 3LAAA 2AIGP 4A3WA 1JKYA 1K7IA 3A70A 5CUHA 2OY4A 1Z3JA 2ZVDA 3N2UA 4IN9A 5H8XA 1J7NA 1OMJA 3HDAP 1B3DA 1Y8JA 1EB6A 3DNGA 1I73A 1AF0A 4I03A 1SLNA 3HDBA 4WKEA 3DWBA 3L0TA
chains in the Genus database with same CATH topology
4Q1LA 5D1TA 1MNCA 2FV9A 3N2VA 1PWVA 3EDHA 3U1RA 2WO9A 5JMYA 3EDIA 2ERPA 1PWPA 3LUMA 5I3MA 3O2XA 1PWQA 1JAQA 2SRTA 2X3BA 3DSLA 2X3AA 3G5CA 4L19A 1YCMA 1BQQM 3KMCA 3ZVSA 2AGMA 3MA2A 1ND1A 3F18A 1GXDA 3O64A 4G9LA 1ZS0A 3P24A 1R1JA 3KEKA 4WZVA 2MLRA 1CQRA 1XFWA 3OHLA 1IADA 1MMRA 3UVCA 4DV8A 3TT4A 1K7QA 3ZUKA 4XM6A 1Y93A 3P1VA 1IABA 3WV1A 2W0DA 1SU3A 1IAAA 1CGFA 2Z8ZA 1S4BP 3Q2GA 5D3CA 4H84A 4L6TA 3LE9A 4FXYP 4WF6A 1XFUA 1YP1A 1ZXVA 1KUKA 2XS3A 1JK3A 1GE6A 4HMAA 3LQBA 1HFSA 3RTSA 4L7AA 4PKRA 4H30A 4GUYA 2POJA 1BIWA 4JQGA 4ZR5A 1BM6A 1FM1A 2OXZA 3ZXHA 4GF1A 2AYKA 2OY2A 1ZTQA 5L7FA 5CVWA 2WO8A 2MZIA 3E8RA 2X3CA 3USNA 1GE7A 4H49A 2FV5A 1CAQA 1QUAA 2X7MA 2JT6A 1CGEA 1UEAA 5L79A 4H2EA 1BKCI 2ML2A 2Z2DA 4WK7A 1C8TA 2ZJ7A 3LGPA 1DMTA 4H82A 2V4BA 2JSDA 1Q3AA 2HU6A 5D1SA 1ASTA 4PKWA 1XFXA 3TS4A 1ATLA 1SRPA 4GWMA 1B8YA 3EWJA 2YO0A 2OW0A 5D2BA 2OW9A 3EHXA 1O0TA 5I2ZA 1XUDA 1ZXCA 4H3XA 3I7GA 1FLSA 2KRJA 1QJJA 3LIKA 5D7WA 1JIZA 1QIBA 1BSWA 3NTNA 1ZP5A 2A8HA 3SHIA 3LQ0A 3NX7A 1EUBA 3EHYA 4GR0A 1IAGA 3LJGA 2MZHA 5BOTA 2JT5A 4FU4A 2O3EA 3OHOA 3WP8A 3GBOA 2D1NA 3AYKA 1YQYA 1QICA 3AIGA 4PKUA 1RMZA 4IJOA 2RJQA 1ZVXA 1R55A 2DW0A 4AUOA 1CXVA 4J4MA 1UMTA 3VTGA 3HBVP 4XBHA 3F16A 5CXAA 4XCTA 3DL1A 4A7BA 2USNA 1JJ9A 1XUCA 2J83A 4DD8A 4PKQA 1MMQA 1D7XA 4H76A 1OO9A 3HBUP 1OS2A 3KECA 1O0QA 3F1AA 1BUDA 3V96B 966CA 3WV3A 5I0LA 3LJTA 1JANA 456CA 3TVCA 2YO1A 1UTTA 4CTHA 1EAKA 1C7KA 1XURA 4L63A 4GR3A 3ULTA 5I4OA 1G9KA 2Z8XA 3B92A 3L0VA 2K9CA 3LK8A 2W13A 3HY7A 2N8RA 2O36A 3G42A 3A6ZA 4EFSA 1GKDA 5BPAA 1D8FA 4FXQA 3HB2P 1WNIA 1OM8A 2QUBA 1Y0VA 1L6JA 1A86A 1SATA 5LABA 1RM8A 3AYUA 3LUNA 2OI0A 4HX3A 3F19A 2W14A 2E3XA 2YUFA 2QUAA 3WV2A 1I76A 2OXUA 1XFVA 2W15A 1HOVA 4QKZA 1HY7A 1KAPP 2TCLA 2Y6CA 1UTZA 1QIAA 4ILWD 2J0TA 1HFCA 1R1HA 1BKCE 1K7GA 1AYKA 1C3IA 2XS4A 2I47A 1GKCA 3BA0A 3ELMA 5D1UA 3KHIA 3EDGA 3LILA 4GR8A 3KEJA 2D1OA 1JAPA 1HV5A 4DF9A 3F17A 5I43A 2YIGA 4JPAA 1G4KA 1YOUA 2ERQA 3LJZA 1D8MA 1R54A 1HTDA 4GWNA 1IAEA 1CGLA 5CXLA 4FVLA 1SLMA 4PKSA 1OS9A 4DPEA 1CK7A 2OW1A 2DW2A 2MZEA 1GO7P 4XM7A 1UMSA 2OZRA 1KUIA 1P9HA 1ROSA 1IACA 2RJPA 2JIHA 2DDYA 2QPJA 4H1QA 3DPEA 2MLSA 3HYGA 1R1IA 2DW1A 3DPFA 1BQOA 1G49A 3LIRA 3HY9A 2PJTA 830CA 4R3VA 2JNPA 2YB9A 4IUWA 2DDFA 3LA9A 1MMBA 2CKIA 1G05A 4WKIA 2OW2A 3I7IA 4ON1A 5BOYA 1BZSA 3Q2HA 2E2DA 1JIWP 1BUVM 3CKIA 4PKTA 3DTEA 1KBCA 3EDZA 1OM7A 1JH1A 1SMPA 1USNA 1DTHA 3F15A 5B5OA 3LEAA 2CLTA 3LMCA 3DTIA 2OXWA 2OVXA 4GQLA 1BKCA 1G12A 2EROA 1I1IP 2L0RA 1JAOA 1OM6A 4AYKA 3KRYA 5B5PA 3RTTA 1D5JA 3KMEA 4AXQA 3KWVC 1H71P 4AIGA 1A85A 5CZMA 4I35A 1QJIA 3DTKA 1CIZA 2Y6DA 4XM8A 1PWWA 1AKLA 5I12A 4JIJA 4G0DA 2XQHA 2WOAA 1MMPA 3TSKA 3B8ZA 1KUFA 2K2GA 2OVZA 4JP4A 4JA1A 3S6LA 1XFYA 4PKVA 1GE5A 1PWUA 3VI1A 1KUHA 3K7LA 1FBLA 2ZJ6A 1XFZA 3K7NA 3B2ZA 1KUGA 2W12A 3LKAA 1GO8P 3LAAA 2AIGP 4A3WA 1JKYA 1K7IA 3A70A 5CUHA 2OY4A 1Z3JA 2ZVDA 3N2UA 4IN9A 5H8XA 1J7NA 1OMJA 3HDAP 1B3DA 1Y8JA 1EB6A 3DNGA 1I73A 1AF0A 4I03A 1SLNA 3HDBA 4WKEA 3DWBA 3L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q1L A;  5D1T A;  1MNC A;  2FV9 A;  3N2V A;  1PWV A;  3EDH A;  3U1R A;  2WO9 A;  5JMY A;  3EDI A;  2ERP A;  1PWP A;  3LUM A;  5I3M A;  3O2X A;  1PWQ A;  1JAQ A;  2SRT A;  2X3B A;  3DSL A;  2X3A A;  3G5C A;  4L19 A;  1YCM A;  1BQQ M;  3KMC A;  3ZVS A;  2AGM A;  3MA2 A;  1ND1 A;  3F18 A;  1GXD A;  3O64 A;  4G9L A;  1ZS0 A;  3P24 A;  1R1J A;  3KEK A;  4WZV A;  2MLR A;  1CQR A;  1XFW A;  3OHL A;  1IAD A;  1MMR A;  3UVC A;  4DV8 A;  3TT4 A;  1K7Q A;  3ZUK A;  4XM6 A;  1Y93 A;  3P1V A;  1IAB A;  3WV1 A;  2W0D A;  1SU3 A;  1IAA A;  1CGF A;  2Z8Z A;  1S4B P;  3Q2G A;  5D3C A;  4H84 A;  4L6T A;  3LE9 A;  4FXY P;  4WF6 A;  1XFU A;  1YP1 A;  1ZXV A;  1KUK A;  2XS3 A;  1JK3 A;  1GE6 A;  4HMA A;  3LQB A;  1HFS A;  3RTS A;  4PKR A;  4H30 A;  4GUY A;  2POJ A;  1BIW A;  4JQG A;  4ZR5 A;  1BM6 A;  1FM1 A;  2OXZ A;  3ZXH A;  4GF1 A;  2AYK A;  2OY2 A;  1ZTQ A;  5L7F A;  5CVW A;  2WO8 A;  2MZI A;  3E8R A;  2X3C A;  3USN A;  1GE7 A;  4H49 A;  2FV5 A;  1CAQ A;  1QUA A;  2X7M A;  2JT6 A;  1CGE A;  1UEA A;  5L79 A;  4H2E A;  1BKC I;  2ML2 A;  2Z2D A;  4WK7 A;  1C8T A;  2ZJ7 A;  3LGP A;  1DMT A;  4H82 A;  2V4B A;  2JSD A;  1Q3A A;  2HU6 A;  5D1S A;  1AST A;  4PKW A;  1XFX A;  3TS4 A;  1ATL A;  1SRP A;  4GWM A;  1B8Y A;  3EWJ A;  2YO0 A;  2OW0 A;  5D2B A;  2OW9 A;  3EHX A;  1O0T A;  5I2Z A;  1XUD A;  1ZXC A;  4H3X A;  3I7G A;  1FLS A;  2KRJ A;  1QJJ A;  3LIK A;  5D7W A;  1JIZ A;  1QIB A;  1BSW A;  3NTN A;  1ZP5 A;  2A8H A;  3SHI A;  3LQ0 A;  3NX7 A;  1EUB A;  3EHY A;  4GR0 A;  1IAG A;  3LJG A;  2MZH A;  5BOT A;  2JT5 A;  4FU4 A;  2O3E A;  3OHO A;  3WP8 A;  3GBO A;  2D1N A;  3AYK A;  1YQY A;  1QIC A;  3AIG A;  4PKU A;  1RMZ A;  4IJO A;  2RJQ A;  1ZVX A;  1R55 A;  2DW0 A;  4AUO A;  1CXV A;  4J4M A;  1UMT A;  3VTG A;  3HBV P;  4XBH A;  3F16 A;  5CXA A;  4XCT A;  3DL1 A;  4A7B A;  2USN A;  1JJ9 A;  1XUC A;  2J83 A;  4DD8 A;  4PKQ A;  1MMQ A;  1D7X A;  4H76 A;  1OO9 A;  3HBU P;  1OS2 A;  3KEC A;  1O0Q A;  3F1A A;  1BUD A;  3V96 B;  966C A;  3WV3 A;  5I0L A;  3LJT A;  1JAN A;  456C A;  3TVC A;  2YO1 A;  1UTT A;  4CTH A;  1EAK A;  1C7K A;  1XUR A;  4L63 A;  4GR3 A;  3ULT A;  5I4O A;  1G9K A;  2Z8X A;  3B92 A;  3L0V A;  2K9C A;  3LK8 A;  2W13 A;  3HY7 A;  2N8R A;  2O36 A;  3G42 A;  3A6Z A;  4EFS A;  1GKD A;  5BPA A;  1D8F A;  4FXQ A;  3HB2 P;  1WNI A;  1OM8 A;  2QUB A;  1Y0V A;  1L6J A;  1A86 A;  1SAT A;  5LAB A;  1RM8 A;  3AYU A;  3LUN A;  2OI0 A;  4HX3 A;  3F19 A;  2W14 A;  2E3X A;  2QUA A;  3WV2 A;  1I76 A;  2OXU A;  1XFV A;  2W15 A;  1HOV A;  4QKZ A;  1HY7 A;  1KAP P;  2TCL A;  2Y6C A;  1UTZ A;  1QIA A;  4ILW D;  2J0T A;  1HFC A;  1R1H A;  1BKC E;  1K7G A;  1AYK A;  1C3I A;  2XS4 A;  2I47 A;  1GKC A;  3BA0 A;  3ELM A;  5D1U A;  3KHI A;  3EDG A;  3LIL A;  4GR8 A;  3KEJ A;  2D1O A;  1JAP A;  1HV5 A;  4DF9 A;  3F17 A;  5I43 A;  2YIG A;  4JPA A;  1G4K A;  1YOU A;  2ERQ A;  3LJZ A;  1D8M A;  1R54 A;  1HTD A;  4GWN A;  1IAE A;  1CGL A;  5CXL A;  4FVL A;  1SLM A;  4PKS A;  1OS9 A;  4DPE A;  1CK7 A;  2OW1 A;  2DW2 A;  2MZE A;  1GO7 P;  4XM7 A;  1UMS A;  2OZR A;  1KUI A;  1P9H A;  1ROS A;  1IAC A;  2RJP A;  2JIH A;  2DDY A;  2QPJ A;  4H1Q A;  3DPE A;  2MLS A;  3HYG A;  1R1I A;  2DW1 A;  3DPF A;  1BQO A;  1G49 A;  3LIR A;  3HY9 A;  2PJT A;  830C A;  4R3V A;  2JNP A;  2YB9 A;  4IUW A;  2DDF A;  3LA9 A;  1MMB A;  2CKI A;  1G05 A;  4WKI A;  2OW2 A;  3I7I A;  4ON1 A;  5BOY A;  1BZS A;  3Q2H A;  2E2D A;  1JIW P;  1BUV M;  3CKI A;  4PKT A;  1KBC A;  3EDZ A;  1OM7 A;  1JH1 A;  1SMP A;  1USN A;  1DTH A;  3F15 A;  5B5O A;  3LEA A;  2CLT A;  3LMC A;  2OXW A;  2OVX A;  4GQL A;  1BKC A;  1G12 A;  2ERO A;  1I1I P;  2L0R A;  1JAO A;  1OM6 A;  4AYK A;  3KRY A;  5B5P A;  3RTT A;  1D5J A;  3KME A;  4AXQ A;  3KWV C;  1H71 P;  4AIG A;  1A85 A;  5CZM A;  4I35 A;  1QJI A;  1CIZ A;  2Y6D A;  4XM8 A;  1PWW A;  1AKL A;  5I12 A;  4JIJ A;  4G0D A;  2XQH A;  2WOA A;  1MMP A;  3TSK A;  3B8Z A;  1KUF A;  2K2G A;  2OVZ A;  4JP4 A;  4JA1 A;  3S6L A;  1XFY A;  4PKV A;  1GE5 A;  1PWU A;  3VI1 A;  1KUH A;  3K7L A;  1FBL A;  2ZJ6 A;  1XFZ A;  3K7N A;  3B2Z A;  1KUG A;  2W12 A;  3LKA A;  1GO8 P;  3LAA A;  2AIG P;  4A3W A;  1JKY A;  1K7I A;  3A70 A;  5CUH A;  2OY4 A;  1Z3J A;  2ZVD A;  3N2U A;  4IN9 A;  5H8X A;  1J7N A;  1OMJ A;  3HDA P;  1B3D A;  1Y8J A;  1EB6 A;  3DNG A;  1I73 A;  1AF0 A;  4I03 A;  1SLN A;  3HDB A;  4WKE A;  3DWB A;  3L0T A; 
#chains in the Genus database with same CATH topology
 4Q1L A;  5D1T A;  1MNC A;  2FV9 A;  3N2V A;  1PWV A;  3EDH A;  3U1R A;  2WO9 A;  5JMY A;  3EDI A;  2ERP A;  1PWP A;  3LUM A;  5I3M A;  3O2X A;  1PWQ A;  1JAQ A;  2SRT A;  2X3B A;  3DSL A;  2X3A A;  3G5C A;  4L19 A;  1YCM A;  1BQQ M;  3KMC A;  3ZVS A;  2AGM A;  3MA2 A;  1ND1 A;  3F18 A;  1GXD A;  3O64 A;  4G9L A;  1ZS0 A;  3P24 A;  1R1J A;  3KEK A;  4WZV A;  2MLR A;  1CQR A;  1XFW A;  3OHL A;  1IAD A;  1MMR A;  3UVC A;  4DV8 A;  3TT4 A;  1K7Q A;  3ZUK A;  4XM6 A;  1Y93 A;  3P1V A;  1IAB A;  3WV1 A;  2W0D A;  1SU3 A;  1IAA A;  1CGF A;  2Z8Z A;  1S4B P;  3Q2G A;  5D3C A;  4H84 A;  4L6T A;  3LE9 A;  4FXY P;  4WF6 A;  1XFU A;  1YP1 A;  1ZXV A;  1KUK A;  2XS3 A;  1JK3 A;  1GE6 A;  4HMA A;  3LQB A;  1HFS A;  3RTS A;  4L7A A;  4PKR A;  4H30 A;  4GUY A;  2POJ A;  1BIW A;  4JQG A;  4ZR5 A;  1BM6 A;  1FM1 A;  2OXZ A;  3ZXH A;  4GF1 A;  2AYK A;  2OY2 A;  1ZTQ A;  5L7F A;  5CVW A;  2WO8 A;  2MZI A;  3E8R A;  2X3C A;  3USN A;  1GE7 A;  4H49 A;  2FV5 A;  1CAQ A;  1QUA A;  2X7M A;  2JT6 A;  1CGE A;  1UEA A;  5L79 A;  4H2E A;  1BKC I;  2ML2 A;  2Z2D A;  4WK7 A;  1C8T A;  2ZJ7 A;  3LGP A;  1DMT A;  4H82 A;  2V4B A;  2JSD A;  1Q3A A;  2HU6 A;  5D1S A;  1AST A;  4PKW A;  1XFX A;  3TS4 A;  1ATL A;  1SRP A;  4GWM A;  1B8Y A;  3EWJ A;  2YO0 A;  2OW0 A;  5D2B A;  2OW9 A;  3EHX A;  1O0T A;  5I2Z A;  1XUD A;  1ZXC A;  4H3X A;  3I7G A;  1FLS A;  2KRJ A;  1QJJ A;  3LIK A;  5D7W A;  1JIZ A;  1QIB A;  1BSW A;  3NTN A;  1ZP5 A;  2A8H A;  3SHI A;  3LQ0 A;  3NX7 A;  1EUB A;  3EHY A;  4GR0 A;  1IAG A;  3LJG A;  2MZH A;  5BOT A;  2JT5 A;  4DT5 A;  4FU4 A;  2O3E A;  3OHO A;  3WP8 A;  3GBO A;  2D1N A;  3AYK A;  1YQY A;  1QIC A;  3AIG A;  4PKU A;  1RMZ A;  4IJO A;  2RJQ A;  1ZVX A;  1R55 A;  2DW0 A;  4AUO A;  1CXV A;  4J4M A;  1UMT A;  3VTG A;  3HBV P;  4XBH A;  3F16 A;  5CXA A;  4XCT A;  3DL1 A;  4A7B A;  2USN A;  1JJ9 A;  1XUC A;  2J83 A;  4DD8 A;  4PKQ A;  1MMQ A;  1D7X A;  4H76 A;  1OO9 A;  3HBU P;  1OS2 A;  3KEC A;  1O0Q A;  3F1A A;  1BUD A;  3V96 B;  966C A;  3WV3 A;  5I0L A;  3LJT A;  1JAN A;  456C A;  3TVC A;  2YO1 A;  1UTT A;  4CTH A;  1EAK A;  1C7K A;  1XUR A;  4L63 A;  4GR3 A;  1OZ9 A;  3ULT A;  5I4O A;  1G9K A;  2Z8X A;  3B92 A;  3L0V A;  2K9C A;  3LK8 A;  2W13 A;  3HY7 A;  2N8R A;  2O36 A;  3G42 A;  3A6Z A;  4EFS A;  1GKD A;  5BPA A;  1D8F A;  4FXQ A;  3HB2 P;  1WNI A;  1OM8 A;  2QUB A;  1Y0V A;  1L6J A;  1A86 A;  1SAT A;  5LAB A;  1RM8 A;  3AYU A;  3LUN A;  2OI0 A;  4HX3 A;  3F19 A;  2W14 A;  2E3X A;  2YUF A;  2QUA A;  3WV2 A;  1I76 A;  2OXU A;  1XFV A;  2W15 A;  1HOV A;  4QKZ A;  1HY7 A;  1KAP P;  2TCL A;  2Y6C A;  1UTZ A;  1QIA A;  4ILW D;  2J0T A;  1HFC A;  1R1H A;  1BKC E;  1K7G A;  1AYK A;  1C3I A;  2XS4 A;  2I47 A;  1GKC A;  3BA0 A;  3ELM A;  5D1U A;  3KHI A;  3EDG A;  3LIL A;  4GR8 A;  3KEJ A;  2D1O A;  1JAP A;  1HV5 A;  4DF9 A;  3F17 A;  5I43 A;  2YIG A;  4JPA A;  1G4K A;  1YOU A;  2ERQ A;  3LJZ A;  1D8M A;  1R54 A;  1HTD A;  4GWN A;  1IAE A;  1CGL A;  5CXL A;  4FVL A;  1SLM A;  4PKS A;  1OS9 A;  4DPE A;  1CK7 A;  2OW1 A;  2DW2 A;  2MZE A;  1GO7 P;  4XM7 A;  1UMS A;  2OZR A;  1KUI A;  1P9H A;  1ROS A;  1IAC A;  2RJP A;  2JIH A;  2DDY A;  2QPJ A;  4H1Q A;  3DPE A;  2MLS A;  3HYG A;  1R1I A;  2DW1 A;  3DPF A;  1BQO A;  1G49 A;  3LIR A;  3HY9 A;  2PJT A;  830C A;  4R3V A;  2JNP A;  2YB9 A;  1XAX A;  4IUW A;  2DDF A;  3LA9 A;  1MMB A;  2CKI A;  1G05 A;  4WKI A;  2OW2 A;  3I7I A;  4ON1 A;  5BOY A;  1BZS A;  3Q2H A;  2E2D A;  1JIW P;  1BUV M;  3CKI A;  4PKT A;  3DTE A;  1KBC A;  3EDZ A;  1OM7 A;  1JH1 A;  1SMP A;  1USN A;  1DTH A;  3F15 A;  5B5O A;  3LEA A;  1XM5 A;  2CLT A;  3LMC A;  3DTI A;  2OXW A;  1TVI A;  2OVX A;  4GQL A;  1BKC A;  1G12 A;  2ERO A;  1I1I P;  2L0R A;  1JAO A;  1OM6 A;  4AYK A;  3KRY A;  5B5P A;  3RTT A;  1D5J A;  3KME A;  4AXQ A;  3KWV C;  1H71 P;  4AIG A;  1A85 A;  5CZM A;  4I35 A;  1QJI A;  3DTK A;  1CIZ A;  2Y6D A;  4XM8 A;  1PWW A;  1AKL A;  5I12 A;  4JIJ A;  4G0D A;  2XQH A;  2WOA A;  1MMP A;  3TSK A;  3B8Z A;  1KUF A;  2K2G A;  2OVZ A;  4JP4 A;  4JA1 A;  3S6L A;  1XFY A;  4PKV A;  1GE5 A;  1PWU A;  3VI1 A;  1KUH A;  3K7L A;  1FBL A;  2ZJ6 A;  1XFZ A;  3K7N A;  3B2Z A;  1KUG A;  2W12 A;  3LKA A;  1GO8 P;  3LAA A;  2AIG P;  4A3W A;  1JKY A;  1K7I A;  3A70 A;  5CUH A;  2OY4 A;  1Z3J A;  2ZVD A;  3N2U A;  4IN9 A;  5H8X A;  1J7N A;  1OMJ A;  3HDA P;  1B3D A;  1Y8J A;  1EB6 A;  3DNG A;  1I73 A;  1AF0 A;  4I03 A;  1SLN A;  3HDB A;  4WKE A;  3DWB A;  3L0T A; 
#chains in the Genus database with same CATH homology
 4Q1L A;  5D1T A;  1MNC A;  2FV9 A;  3N2V A;  1PWV A;  3EDH A;  3U1R A;  2WO9 A;  5JMY A;  3EDI A;  2ERP A;  1PWP A;  3LUM A;  5I3M A;  3O2X A;  1PWQ A;  1JAQ A;  2SRT A;  2X3B A;  3DSL A;  2X3A A;  3G5C A;  4L19 A;  1YCM A;  1BQQ M;  3KMC A;  3ZVS A;  2AGM A;  3MA2 A;  1ND1 A;  3F18 A;  1GXD A;  3O64 A;  4G9L A;  1ZS0 A;  3P24 A;  1R1J A;  3KEK A;  4WZV A;  2MLR A;  1CQR A;  1XFW A;  3OHL A;  1IAD A;  1MMR A;  3UVC A;  4DV8 A;  3TT4 A;  1K7Q A;  3ZUK A;  4XM6 A;  1Y93 A;  3P1V A;  1IAB A;  3WV1 A;  2W0D A;  1SU3 A;  1IAA A;  1CGF A;  2Z8Z A;  1S4B P;  3Q2G A;  5D3C A;  4H84 A;  4L6T A;  3LE9 A;  4FXY P;  4WF6 A;  1XFU A;  1YP1 A;  1ZXV A;  1KUK A;  2XS3 A;  1JK3 A;  1GE6 A;  4HMA A;  3LQB A;  1HFS A;  3RTS A;  4L7A A;  4PKR A;  4H30 A;  4GUY A;  2POJ A;  1BIW A;  4JQG A;  4ZR5 A;  1BM6 A;  1FM1 A;  2OXZ A;  3ZXH A;  4GF1 A;  2AYK A;  2OY2 A;  1ZTQ A;  5L7F A;  5CVW A;  2WO8 A;  2MZI A;  3E8R A;  2X3C A;  3USN A;  1GE7 A;  4H49 A;  2FV5 A;  1CAQ A;  1QUA A;  2X7M A;  2JT6 A;  1CGE A;  1UEA A;  5L79 A;  4H2E A;  1BKC I;  2ML2 A;  2Z2D A;  4WK7 A;  1C8T A;  2ZJ7 A;  3LGP A;  1DMT A;  4H82 A;  2V4B A;  2JSD A;  1Q3A A;  2HU6 A;  5D1S A;  1AST A;  4PKW A;  1XFX A;  3TS4 A;  1ATL A;  1SRP A;  4GWM A;  1B8Y A;  3EWJ A;  2YO0 A;  2OW0 A;  5D2B A;  2OW9 A;  3EHX A;  1O0T A;  5I2Z A;  1XUD A;  1ZXC A;  4H3X A;  3I7G A;  1FLS A;  2KRJ A;  1QJJ A;  3LIK A;  5D7W A;  1JIZ A;  1QIB A;  1BSW A;  3NTN A;  1ZP5 A;  2A8H A;  3SHI A;  3LQ0 A;  3NX7 A;  1EUB A;  3EHY A;  4GR0 A;  1IAG A;  3LJG A;  2MZH A;  5BOT A;  2JT5 A;  4FU4 A;  2O3E A;  3OHO A;  3WP8 A;  3GBO A;  2D1N A;  3AYK A;  1YQY A;  1QIC A;  3AIG A;  4PKU A;  1RMZ A;  4IJO A;  2RJQ A;  1ZVX A;  1R55 A;  2DW0 A;  4AUO A;  1CXV A;  4J4M A;  1UMT A;  3VTG A;  3HBV P;  4XBH A;  3F16 A;  5CXA A;  4XCT A;  3DL1 A;  4A7B A;  2USN A;  1JJ9 A;  1XUC A;  2J83 A;  4DD8 A;  4PKQ A;  1MMQ A;  1D7X A;  4H76 A;  1OO9 A;  3HBU P;  1OS2 A;  3KEC A;  1O0Q A;  3F1A A;  1BUD A;  3V96 B;  966C A;  3WV3 A;  5I0L A;  3LJT A;  1JAN A;  456C A;  3TVC A;  2YO1 A;  1UTT A;  4CTH A;  1EAK A;  1C7K A;  1XUR A;  4L63 A;  4GR3 A;  3ULT A;  5I4O A;  1G9K A;  2Z8X A;  3B92 A;  3L0V A;  2K9C A;  3LK8 A;  2W13 A;  3HY7 A;  2N8R A;  2O36 A;  3G42 A;  3A6Z A;  4EFS A;  1GKD A;  5BPA A;  1D8F A;  4FXQ A;  3HB2 P;  1WNI A;  1OM8 A;  2QUB A;  1Y0V A;  1L6J A;  1A86 A;  1SAT A;  5LAB A;  1RM8 A;  3AYU A;  3LUN A;  2OI0 A;  4HX3 A;  3F19 A;  2W14 A;  2E3X A;  2YUF A;  2QUA A;  3WV2 A;  1I76 A;  2OXU A;  1XFV A;  2W15 A;  1HOV A;  4QKZ A;  1HY7 A;  1KAP P;  2TCL A;  2Y6C A;  1UTZ A;  1QIA A;  4ILW D;  2J0T A;  1HFC A;  1R1H A;  1BKC E;  1K7G A;  1AYK A;  1C3I A;  2XS4 A;  2I47 A;  1GKC A;  3BA0 A;  3ELM A;  5D1U A;  3KHI A;  3EDG A;  3LIL A;  4GR8 A;  3KEJ A;  2D1O A;  1JAP A;  1HV5 A;  4DF9 A;  3F17 A;  5I43 A;  2YIG A;  4JPA A;  1G4K A;  1YOU A;  2ERQ A;  3LJZ A;  1D8M A;  1R54 A;  1HTD A;  4GWN A;  1IAE A;  1CGL A;  5CXL A;  4FVL A;  1SLM A;  4PKS A;  1OS9 A;  4DPE A;  1CK7 A;  2OW1 A;  2DW2 A;  2MZE A;  1GO7 P;  4XM7 A;  1UMS A;  2OZR A;  1KUI A;  1P9H A;  1ROS A;  1IAC A;  2RJP A;  2JIH A;  2DDY A;  2QPJ A;  4H1Q A;  3DPE A;  2MLS A;  3HYG A;  1R1I A;  2DW1 A;  3DPF A;  1BQO A;  1G49 A;  3LIR A;  3HY9 A;  2PJT A;  830C A;  4R3V A;  2JNP A;  2YB9 A;  4IUW A;  2DDF A;  3LA9 A;  1MMB A;  2CKI A;  1G05 A;  4WKI A;  2OW2 A;  3I7I A;  4ON1 A;  5BOY A;  1BZS A;  3Q2H A;  2E2D A;  1JIW P;  1BUV M;  3CKI A;  4PKT A;  3DTE A;  1KBC A;  3EDZ A;  1OM7 A;  1JH1 A;  1SMP A;  1USN A;  1DTH A;  3F15 A;  5B5O A;  3LEA A;  2CLT A;  3LMC A;  3DTI A;  2OXW A;  2OVX A;  4GQL A;  1BKC A;  1G12 A;  2ERO A;  1I1I P;  2L0R A;  1JAO A;  1OM6 A;  4AYK A;  3KRY A;  5B5P A;  3RTT A;  1D5J A;  3KME A;  4AXQ A;  3KWV C;  1H71 P;  4AIG A;  1A85 A;  5CZM A;  4I35 A;  1QJI A;  3DTK A;  1CIZ A;  2Y6D A;  4XM8 A;  1PWW A;  1AKL A;  5I12 A;  4JIJ A;  4G0D A;  2XQH A;  2WOA A;  1MMP A;  3TSK A;  3B8Z A;  1KUF A;  2K2G A;  2OVZ A;  4JP4 A;  4JA1 A;  3S6L A;  1XFY A;  4PKV A;  1GE5 A;  1PWU A;  3VI1 A;  1KUH A;  3K7L A;  1FBL A;  2ZJ6 A;  1XFZ A;  3K7N A;  3B2Z A;  1KUG A;  2W12 A;  3LKA A;  1GO8 P;  3LAA A;  2AIG P;  4A3W A;  1JKY A;  1K7I A;  3A70 A;  5CUH A;  2OY4 A;  1Z3J A;  2ZVD A;  3N2U A;  4IN9 A;  5H8X A;  1J7N A;  1OMJ A;  3HDA P;  1B3D A;  1Y8J A;  1EB6 A;  3DNG A;  1I73 A;  1AF0 A;  4I03 A;  1SLN A;  3HDB A;  4WKE A;  3DWB A;  3L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...