3HB2P

Prtc methionine mutants: m226i
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
462
structure length
462
Chain Sequence
b'ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIISYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 161
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hb2P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hb2P02
3F15A 1USNA 1G49A 2N8RA 2CKIA 3I7IA 3G5CA 1D8MA 4PKRA 1KBCA 2OVXA 1BM6A 1EB6A 3DSLA 3LGPA 1CGEA 1AF0A 3WV1A 1OMJA 1Y93A 1ASTA 3ZVSA 1ZP5A 3G42A 1SU3A 3LE9A 4WZVA 5I0LA 3AYUA 5BOYA 1BSWA 3BA0A 3LIRA 4JQGA 1EUBA 1YCMA 1MMBA 2X3AA 1BQQM 2E3XA 5CVWA 1R1IA 2MLRA 4IN9A 2DW1A 4G9LA 4JPAA 1ZS0A 1D5JA 1XFZA 2YO0A 3F1AA 2L0RA 1O0TA 1G4KA 3HY9A 3VI1A 2W0DA 1P9HA 4WKIA 1JH1A 2QPJA 4PKWA 2MZIA 5B5OA 3KRYA 1ND1A 1HOVA 1XUCA 1QICA 1KUGA 3LUNA 3LEAA 1IABA 3HDAP 1A86A 4FXQA 2MLSA 1IAEA 3N2UA 1HY7A 3F18A 2JSDA 4A7BA 4WF6A 1UTTA 2FV5A 3Q2HA 3HY7A 2D1OA 3EHYA 4XBHA 3KECA 5I43A 1OM8A 3NTNA 4DF9A 1GE5A 1SMPA 5BOTA 2WOAA 1GO7P 3LILA 4WK7A 3TSKA 3O2XA 3EDHA 1R1HA 1I73A 2W12A 3O64A 5I12A 1ZTQA 3S6LA 1JAQA 1DMTA 1HV5A 4H1QA 1BUVM 966CA 2OVZA 4PKQA 830CA 1G05A 3K7LA 1OS2A 3KHIA 1BQOA 2ZJ6A 3HDBA 4FU4A 5D7WA 3EHXA 3LAAA 2ERQA 3AIGA 3KEJA 4H3XA 1RMZA 1D8FA 2TCLA 1CQRA 1H71P 2WO8A 1XFYA 2PJTA 3E8RA 4DPEA 2X3BA 3L0VA 1EAKA 2CLTA 3LJZA 3EWJA 2FV9A 1GXDA 2O36A 4J4MA 5L7FA 3B8ZA 1SRPA 1XFVA 2DW0A 2XS3A 3HB2P 1PWWA 1A85A 2OW9A 4XM7A 1BZSA 2QUBA 3F16A 4FVLA 3SHIA 1AYKA 4AYKA 4HX3A 1KUKA 1L6JA 2ML2A 2RJPA 1ZXVA 1JJ9A 1KUFA 2ZVDA 1G9KA 2X7MA 1IAAA 1JANA 3L0TA 3GBOA 3P1VA 1IACA 4HMAA 4JA1A 1GE6A 2K9CA 2AIGP 3RTSA 2Z8ZA 4H76A 1RM8A 4GWNA 5L79A 1O0QA 4H30A 1BIWA 2DDYA 4L19A 2OI0A 3LIKA 3OHLA 3AYKA 1PWPA 3TT4A 5I2ZA 1HTDA 5JMYA 3KEKA 2OW1A 4DV8A 3ZXHA 2OXZA 4AIGA 5BPAA 2O3EA 1C8TA 3EDZA 3U1RA 2A8HA 1C7KA 1BUDA 3EDIA 2JT6A 1OM6A 4PKUA 3VTGA 1CAQA 2W15A 1CIZA 3KWVC 4JIJA 1B8YA 1WNIA 2MZHA 4PKVA 1R1JA 3F17A 2J0TA 3LKAA 4GR3A 2OW0A 3LK8A 2EROA 3WP8A 1GKCA 1PWVA 1KAPP 5CZMA 4FXYP 1OO9A 2POJA 4ON1A 3LQBA 1CXVA 2ZJ7A 4GQLA 1SLNA 1Y0VA 2OXWA 4IJOA 456CA 1PWQA 4L6TA 4JP4A 1JK3A 1HFCA 3LJGA 1YOUA 3HBUP 2AYKA 2RJQA 1Y8JA 4PKSA 1K7IA 1MMQA 2I47A 2XQHA 1Q3AA 3OHOA 2WO9A 1CGLA 4ILWD 1GE7A 3B92A 1Z3JA 3HBVP 5I3MA 2JNPA 1SLMA 2OXUA 3TVCA 4PKTA 2MZEA 4Q1LA 3LMCA 4L63A 1C3IA 1R54A 3LQ0A 2JT5A 4GR8A 3RTTA 2USNA 3USNA 3EDGA 1QIAA 1JIWP 1QJIA 3LA9A 4AXQA 3ELMA 2V4BA 1BKCI 1PWUA 1XFXA 4H49A 5LABA 2ERPA 1AKLA 1XURA 1I1IP 3A70A 4IUWA 4EFSA 2XS4A 4QKZA 1BKCE 3WV2A 1HFSA 1J7NA 1FBLA 4H84A 5B5PA 4AUOA 2OZRA 1FLSA 3DL1A 4GUYA 1IADA 5D1TA 3ZUKA 1YP1A 1SATA 1UMTA 1XFWA 2OY4A 1K7GA 1XUDA 4H82A 2Z8XA 1MNCA 3KMEA 1JAOA 5CXLA 1D7XA 1UMSA 1B3DA 3DPFA 1QJJA 5D3CA 2YO1A 2HU6A 3N2VA 5D2BA 1MMRA 4GR0A 1QIBA 3I7GA 3LJTA 3MA2A 3TS4A 4I03A 1ROSA 1MMPA 2X3CA 2AGMA 1UTZA 4GWMA 2J83A 2YIGA 3DNGA 3NX7A 2K2GA 4R3VA 3F19A 2Y6DA 1JIZA 1ATLA 4DD8A 1K7QA 2OY2A 4XM6A 1OS9A 3KMCA 4G0DA 4XM8A 2YB9A 1UEAA 3Q2GA 3HYGA 1BKCA 4A3WA 1OM7A 1ZVXA 3ULTA 4ZR5A 2DW2A 2JIHA 5D1UA 4WKEA 3A6ZA 1DTHA 2OW2A 2QUAA 1JAPA 5H8XA 1GO8P 3K7NA 5CUHA 1R55A 1XFUA 2Y6CA 2DDFA 3CKIA 3P24A 4H2EA 5D1SA 1CK7A 4CTHA 1QUAA 2D1NA 2Z2DA 1S4BP 1FM1A 4XCTA 5I4OA 3V96B 3DPEA 3UVCA 3WV3A 2W13A 1G12A 1YQYA 2SRTA 1JKYA 1I76A 1CGFA 1GKDA 3LUMA 3B2ZA 1ZXCA 2E2DA 4GF1A 1KUHA 3DWBA 5CXAA 1IAGA 2W14A 2KRJA 4I35A 1KUIA
chains in the Genus database with same CATH superfamily
3F15A 1USNA 1G49A 2N8RA 2CKIA 3I7IA 3G5CA 1D8MA 4PKRA 1KBCA 2OVXA 1BM6A 1EB6A 3DSLA 3LGPA 1CGEA 1AF0A 3DTKA 3WV1A 1OMJA 1Y93A 1ASTA 3ZVSA 1ZP5A 3G42A 1SU3A 3LE9A 4WZVA 5I0LA 3AYUA 5BOYA 1BSWA 3BA0A 3LIRA 4JQGA 1EUBA 1YCMA 1MMBA 2X3AA 1BQQM 2E3XA 5CVWA 1R1IA 2MLRA 4IN9A 2DW1A 4G9LA 4JPAA 1ZS0A 1D5JA 1XFZA 2YO0A 3F1AA 2L0RA 1O0TA 1G4KA 3HY9A 3VI1A 2W0DA 1P9HA 4WKIA 1JH1A 2QPJA 4PKWA 2MZIA 5B5OA 3KRYA 1ND1A 1HOVA 1XUCA 1QICA 1KUGA 3LUNA 3LEAA 1IABA 3HDAP 1A86A 4FXQA 2MLSA 1IAEA 3N2UA 1HY7A 3F18A 2JSDA 4A7BA 4WF6A 1UTTA 2FV5A 3Q2HA 3HY7A 2D1OA 3EHYA 4XBHA 3KECA 5I43A 1OM8A 3NTNA 4DF9A 1GE5A 1SMPA 5BOTA 2WOAA 1GO7P 3LILA 4WK7A 3TSKA 3O2XA 3EDHA 1R1HA 1I73A 2W12A 3O64A 5I12A 1ZTQA 3S6LA 1JAQA 1DMTA 1HV5A 4H1QA 1BUVM 966CA 2OVZA 4PKQA 830CA 1G05A 3K7LA 1OS2A 3KHIA 1BQOA 2ZJ6A 3HDBA 4FU4A 5D7WA 3EHXA 3LAAA 2ERQA 3AIGA 3KEJA 4H3XA 1RMZA 1D8FA 2TCLA 1CQRA 1H71P 2WO8A 1XFYA 2PJTA 3E8RA 4DPEA 2X3BA 3L0VA 1EAKA 2CLTA 3LJZA 3EWJA 2FV9A 1GXDA 1OZ9A 2O36A 4J4MA 5L7FA 3B8ZA 1SRPA 1XFVA 2DW0A 2XS3A 3HB2P 1PWWA 1A85A 2OW9A 4XM7A 1BZSA 2QUBA 3F16A 4FVLA 3SHIA 1AYKA 4AYKA 4HX3A 1KUKA 1L6JA 2ML2A 2RJPA 1ZXVA 1JJ9A 1KUFA 2ZVDA 1G9KA 2X7MA 2YUFA 1IAAA 1JANA 3L0TA 3GBOA 3P1VA 1IACA 4HMAA 4JA1A 1GE6A 2K9CA 2AIGP 3RTSA 2Z8ZA 4H76A 1RM8A 4GWNA 5L79A 1O0QA 4H30A 1BIWA 2DDYA 4L19A 2OI0A 3LIKA 3OHLA 3AYKA 1PWPA 3TT4A 5I2ZA 1HTDA 5JMYA 3KEKA 2OW1A 4DV8A 3ZXHA 2OXZA 4AIGA 5BPAA 2O3EA 1C8TA 3EDZA 3U1RA 2A8HA 1C7KA 1BUDA 3EDIA 2JT6A 1OM6A 4PKUA 3VTGA 1CAQA 2W15A 1CIZA 3KWVC 4JIJA 1B8YA 1WNIA 2MZHA 4PKVA 1R1JA 3F17A 2J0TA 3LKAA 4GR3A 2OW0A 3LK8A 2EROA 3WP8A 1GKCA 1PWVA 1KAPP 5CZMA 4FXYP 1OO9A 2POJA 4ON1A 3LQBA 1CXVA 2ZJ7A 4GQLA 1SLNA 1TVIA 1Y0VA 2OXWA 4IJOA 456CA 1PWQA 4L6TA 4JP4A 1JK3A 1HFCA 3LJGA 1YOUA 3HBUP 2AYKA 2RJQA 1Y8JA 4DT5A 4PKSA 1K7IA 1MMQA 2I47A 2XQHA 1Q3AA 3OHOA 2WO9A 1CGLA 4ILWD 3DTEA 1GE7A 3B92A 1Z3JA 3HBVP 5I3MA 2JNPA 1SLMA 2OXUA 3TVCA 4PKTA 2MZEA 4Q1LA 3LMCA 4L63A 1C3IA 1R54A 3LQ0A 2JT5A 4GR8A 3RTTA 2USNA 3USNA 3EDGA 1QIAA 1JIWP 1QJIA 3LA9A 4AXQA 3ELMA 2V4BA 1BKCI 1PWUA 1XFXA 4H49A 4L7AA 5LABA 2ERPA 1AKLA 1XURA 1I1IP 3A70A 4IUWA 4EFSA 2XS4A 4QKZA 1BKCE 3WV2A 1HFSA 1J7NA 1FBLA 4H84A 5B5PA 4AUOA 2OZRA 1FLSA 3DL1A 4GUYA 1IADA 5D1TA 3ZUKA 3DTIA 1YP1A 1SATA 1UMTA 1XFWA 2OY4A 1K7GA 1XUDA 4H82A 2Z8XA 1MNCA 3KMEA 1JAOA 5CXLA 1D7XA 1UMSA 1B3DA 3DPFA 1QJJA 5D3CA 2YO1A 2HU6A 3N2VA 5D2BA 1MMRA 4GR0A 1XAXA 1QIBA 3I7GA 3LJTA 3MA2A 3TS4A 4I03A 1ROSA 1MMPA 2X3CA 2AGMA 1UTZA 4GWMA 2J83A 2YIGA 3DNGA 3NX7A 2K2GA 4R3VA 3F19A 2Y6DA 1JIZA 1ATLA 4DD8A 1K7QA 2OY2A 4XM6A 1OS9A 3KMCA 4G0DA 4XM8A 2YB9A 1UEAA 3Q2GA 3HYGA 1BKCA 1XM5A 4A3WA 1OM7A 1ZVXA 3ULTA 4ZR5A 2DW2A 2JIHA 5D1UA 4WKEA 3A6ZA 1DTHA 2OW2A 2QUAA 1JAPA 5H8XA 1GO8P 3K7NA 5CUHA 1R55A 1XFUA 2Y6CA 2DDFA 3CKIA 3P24A 4H2EA 5D1SA 1CK7A 4CTHA 1QUAA 2D1NA 2Z2DA 1S4BP 1FM1A 4XCTA 5I4OA 3V96B 3DPEA 3UVCA 3WV3A 2W13A 1G12A 1YQYA 2SRTA 1JKYA 1I76A 1CGFA 1GKDA 3LUMA 3B2ZA 1ZXCA 2E2DA 4GF1A 1KUHA 3DWBA 5CXAA 1IAGA 2W14A 2KRJA 4I35A 1KUIA
chains in the Genus database with same CATH topology
3F15A 1USNA 1G49A 2N8RA 2CKIA 3I7IA 3G5CA 1D8MA 4PKRA 1KBCA 2OVXA 1BM6A 1EB6A 3DSLA 3LGPA 1CGEA 1AF0A 3DTKA 3WV1A 1OMJA 1Y93A 1ASTA 3ZVSA 1ZP5A 3G42A 1SU3A 3LE9A 4WZVA 5I0LA 3AYUA 5BOYA 1BSWA 3BA0A 3LIRA 4JQGA 1EUBA 1YCMA 1MMBA 2X3AA 1BQQM 2E3XA 5CVWA 1R1IA 2MLRA 4IN9A 2DW1A 4G9LA 4JPAA 1ZS0A 1D5JA 1XFZA 2YO0A 3F1AA 2L0RA 1O0TA 1G4KA 3HY9A 3VI1A 2W0DA 1P9HA 4WKIA 1JH1A 2QPJA 4PKWA 2MZIA 5B5OA 3KRYA 1ND1A 1HOVA 1XUCA 1QICA 1KUGA 3LUNA 3LEAA 1IABA 3HDAP 1A86A 4FXQA 2MLSA 1IAEA 3N2UA 1HY7A 3F18A 2JSDA 4A7BA 4WF6A 1UTTA 2FV5A 3Q2HA 3HY7A 2D1OA 3EHYA 4XBHA 3KECA 5I43A 1OM8A 3NTNA 4DF9A 1GE5A 1SMPA 5BOTA 2WOAA 1GO7P 3LILA 4WK7A 3TSKA 3O2XA 3EDHA 1R1HA 1I73A 2W12A 3O64A 5I12A 1ZTQA 3S6LA 1JAQA 1DMTA 1HV5A 4H1QA 1BUVM 966CA 2OVZA 4PKQA 830CA 1G05A 3K7LA 1OS2A 3KHIA 1BQOA 2ZJ6A 3HDBA 4FU4A 5D7WA 3EHXA 3LAAA 2ERQA 3AIGA 3KEJA 4H3XA 1RMZA 1D8FA 2TCLA 1CQRA 1H71P 2WO8A 1XFYA 2PJTA 3E8RA 4DPEA 2X3BA 3L0VA 1EAKA 2CLTA 3LJZA 3EWJA 2FV9A 1GXDA 2O36A 4J4MA 5L7FA 3B8ZA 1SRPA 1XFVA 2DW0A 2XS3A 3HB2P 1PWWA 1A85A 2OW9A 4XM7A 1BZSA 2QUBA 3F16A 4FVLA 3SHIA 1AYKA 4AYKA 4HX3A 1KUKA 1L6JA 2ML2A 2RJPA 1ZXVA 1JJ9A 1KUFA 2ZVDA 1G9KA 2X7MA 2YUFA 1IAAA 1JANA 3L0TA 3GBOA 3P1VA 1IACA 4HMAA 4JA1A 1GE6A 2K9CA 2AIGP 3RTSA 2Z8ZA 4H76A 1RM8A 4GWNA 5L79A 1O0QA 4H30A 1BIWA 2DDYA 4L19A 2OI0A 3LIKA 3OHLA 3AYKA 1PWPA 3TT4A 5I2ZA 1HTDA 5JMYA 3KEKA 2OW1A 4DV8A 3ZXHA 2OXZA 4AIGA 5BPAA 2O3EA 1C8TA 3EDZA 3U1RA 2A8HA 1C7KA 1BUDA 3EDIA 2JT6A 1OM6A 4PKUA 3VTGA 1CAQA 2W15A 1CIZA 3KWVC 4JIJA 1B8YA 1WNIA 2MZHA 4PKVA 1R1JA 3F17A 2J0TA 3LKAA 4GR3A 2OW0A 3LK8A 2EROA 3WP8A 1GKCA 1PWVA 1KAPP 5CZMA 4FXYP 1OO9A 2POJA 4ON1A 3LQBA 1CXVA 2ZJ7A 4GQLA 1SLNA 1Y0VA 2OXWA 4IJOA 456CA 1PWQA 4L6TA 4JP4A 1JK3A 1HFCA 3LJGA 1YOUA 3HBUP 2AYKA 2RJQA 1Y8JA 4PKSA 1K7IA 1MMQA 2I47A 2XQHA 1Q3AA 3OHOA 2WO9A 1CGLA 4ILWD 3DTEA 1GE7A 3B92A 1Z3JA 3HBVP 5I3MA 2JNPA 1SLMA 2OXUA 3TVCA 4PKTA 2MZEA 4Q1LA 3LMCA 4L63A 1C3IA 1R54A 3LQ0A 2JT5A 4GR8A 3RTTA 2USNA 3USNA 3EDGA 1QIAA 1JIWP 1QJIA 3LA9A 4AXQA 3ELMA 2V4BA 1BKCI 1PWUA 1XFXA 4H49A 4L7AA 5LABA 2ERPA 1AKLA 1XURA 1I1IP 3A70A 4IUWA 4EFSA 2XS4A 4QKZA 1BKCE 3WV2A 1HFSA 1J7NA 1FBLA 4H84A 5B5PA 4AUOA 2OZRA 1FLSA 3DL1A 4GUYA 1IADA 5D1TA 3ZUKA 3DTIA 1YP1A 1SATA 1UMTA 1XFWA 2OY4A 1K7GA 1XUDA 4H82A 2Z8XA 1MNCA 3KMEA 1JAOA 5CXLA 1D7XA 1UMSA 1B3DA 3DPFA 1QJJA 5D3CA 2YO1A 2HU6A 3N2VA 5D2BA 1MMRA 4GR0A 1QIBA 3I7GA 3LJTA 3MA2A 3TS4A 4I03A 1ROSA 1MMPA 2X3CA 2AGMA 1UTZA 4GWMA 2J83A 2YIGA 3DNGA 3NX7A 2K2GA 4R3VA 3F19A 2Y6DA 1JIZA 1ATLA 4DD8A 1K7QA 2OY2A 4XM6A 1OS9A 3KMCA 4G0DA 4XM8A 2YB9A 1UEAA 3Q2GA 3HYGA 1BKCA 4A3WA 1OM7A 1ZVXA 3ULTA 4ZR5A 2DW2A 2JIHA 5D1UA 4WKEA 3A6ZA 1DTHA 2OW2A 2QUAA 1JAPA 5H8XA 1GO8P 3K7NA 5CUHA 1R55A 1XFUA 2Y6CA 2DDFA 3CKIA 3P24A 4H2EA 5D1SA 1CK7A 4CTHA 1QUAA 2D1NA 2Z2DA 1S4BP 1FM1A 4XCTA 5I4OA 3V96B 3DPEA 3UVCA 3WV3A 2W13A 1G12A 1YQYA 2SRTA 1JKYA 1I76A 1CGFA 1GKDA 3LUMA 3B2ZA 1ZXCA 2E2DA 4GF1A 1KUHA 3DWBA 5CXAA 1IAGA 2W14A 2KRJA 4I35A 1KUIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F15 A;  1USN A;  1G49 A;  2N8R A;  2CKI A;  3I7I A;  3G5C A;  1D8M A;  4PKR A;  1KBC A;  2OVX A;  1BM6 A;  1EB6 A;  3DSL A;  3LGP A;  1CGE A;  1AF0 A;  3WV1 A;  1OMJ A;  1Y93 A;  1AST A;  3ZVS A;  1ZP5 A;  3G42 A;  1SU3 A;  3LE9 A;  4WZV A;  5I0L A;  3AYU A;  5BOY A;  1BSW A;  3BA0 A;  3LIR A;  4JQG A;  1EUB A;  1YCM A;  1MMB A;  2X3A A;  1BQQ M;  2E3X A;  5CVW A;  1R1I A;  2MLR A;  4IN9 A;  2DW1 A;  4G9L A;  4JPA A;  1ZS0 A;  1D5J A;  1XFZ A;  2YO0 A;  3F1A A;  2L0R A;  1O0T A;  1G4K A;  3HY9 A;  3VI1 A;  2W0D A;  1P9H A;  4WKI A;  1JH1 A;  2QPJ A;  4PKW A;  2MZI A;  5B5O A;  3KRY A;  1ND1 A;  1HOV A;  1XUC A;  1QIC A;  1KUG A;  3LUN A;  3LEA A;  1IAB A;  3HDA P;  1A86 A;  4FXQ A;  2MLS A;  1IAE A;  3N2U A;  1HY7 A;  3F18 A;  2JSD A;  4A7B A;  4WF6 A;  1UTT A;  2FV5 A;  3Q2H A;  3HY7 A;  2D1O A;  3EHY A;  4XBH A;  3KEC A;  5I43 A;  1OM8 A;  3NTN A;  4DF9 A;  1GE5 A;  1SMP A;  5BOT A;  2WOA A;  1GO7 P;  3LIL A;  4WK7 A;  3TSK A;  3O2X A;  3EDH A;  1R1H A;  1I73 A;  2W12 A;  3O64 A;  5I12 A;  1ZTQ A;  3S6L A;  1JAQ A;  1DMT A;  1HV5 A;  4H1Q A;  1BUV M;  966C A;  2OVZ A;  4PKQ A;  830C A;  1G05 A;  3K7L A;  1OS2 A;  3KHI A;  1BQO A;  2ZJ6 A;  3HDB A;  4FU4 A;  5D7W A;  3EHX A;  3LAA A;  2ERQ A;  3AIG A;  3KEJ A;  4H3X A;  1RMZ A;  1D8F A;  2TCL A;  1CQR A;  1H71 P;  2WO8 A;  1XFY A;  2PJT A;  3E8R A;  4DPE A;  2X3B A;  3L0V A;  1EAK A;  2CLT A;  3LJZ A;  3EWJ A;  2FV9 A;  1GXD A;  2O36 A;  4J4M A;  5L7F A;  3B8Z A;  1SRP A;  1XFV A;  2DW0 A;  2XS3 A;  3HB2 P;  1PWW A;  1A85 A;  2OW9 A;  4XM7 A;  1BZS A;  2QUB A;  3F16 A;  4FVL A;  3SHI A;  1AYK A;  4AYK A;  4HX3 A;  1KUK A;  1L6J A;  2ML2 A;  2RJP A;  1ZXV A;  1JJ9 A;  1KUF A;  2ZVD A;  1G9K A;  2X7M A;  1IAA A;  1JAN A;  3L0T A;  3GBO A;  3P1V A;  1IAC A;  4HMA A;  4JA1 A;  1GE6 A;  2K9C A;  2AIG P;  3RTS A;  2Z8Z A;  4H76 A;  1RM8 A;  4GWN A;  5L79 A;  1O0Q A;  4H30 A;  1BIW A;  2DDY A;  4L19 A;  2OI0 A;  3LIK A;  3OHL A;  3AYK A;  1PWP A;  3TT4 A;  5I2Z A;  1HTD A;  5JMY A;  3KEK A;  2OW1 A;  4DV8 A;  3ZXH A;  2OXZ A;  4AIG A;  5BPA A;  2O3E A;  1C8T A;  3EDZ A;  3U1R A;  2A8H A;  1C7K A;  1BUD A;  3EDI A;  2JT6 A;  1OM6 A;  4PKU A;  3VTG A;  1CAQ A;  2W15 A;  1CIZ A;  3KWV C;  4JIJ A;  1B8Y A;  1WNI A;  2MZH A;  4PKV A;  1R1J A;  3F17 A;  2J0T A;  3LKA A;  4GR3 A;  2OW0 A;  3LK8 A;  2ERO A;  3WP8 A;  1GKC A;  1PWV A;  1KAP P;  5CZM A;  4FXY P;  1OO9 A;  2POJ A;  4ON1 A;  3LQB A;  1CXV A;  2ZJ7 A;  4GQL A;  1SLN A;  1Y0V A;  2OXW A;  4IJO A;  456C A;  1PWQ A;  4L6T A;  4JP4 A;  1JK3 A;  1HFC A;  3LJG A;  1YOU A;  3HBU P;  2AYK A;  2RJQ A;  1Y8J A;  4PKS A;  1K7I A;  1MMQ A;  2I47 A;  2XQH A;  1Q3A A;  3OHO A;  2WO9 A;  1CGL A;  4ILW D;  1GE7 A;  3B92 A;  1Z3J A;  3HBV P;  5I3M A;  2JNP A;  1SLM A;  2OXU A;  3TVC A;  4PKT A;  2MZE A;  4Q1L A;  3LMC A;  4L63 A;  1C3I A;  1R54 A;  3LQ0 A;  2JT5 A;  4GR8 A;  3RTT A;  2USN A;  3USN A;  3EDG A;  1QIA A;  1JIW P;  1QJI A;  3LA9 A;  4AXQ A;  3ELM A;  2V4B A;  1BKC I;  1PWU A;  1XFX A;  4H49 A;  5LAB A;  2ERP A;  1AKL A;  1XUR A;  1I1I P;  3A70 A;  4IUW A;  4EFS A;  2XS4 A;  4QKZ A;  1BKC E;  3WV2 A;  1HFS A;  1J7N A;  1FBL A;  4H84 A;  5B5P A;  4AUO A;  2OZR A;  1FLS A;  3DL1 A;  4GUY A;  1IAD A;  5D1T A;  3ZUK A;  1YP1 A;  1SAT A;  1UMT A;  1XFW A;  2OY4 A;  1K7G A;  1XUD A;  4H82 A;  2Z8X A;  1MNC A;  3KME A;  1JAO A;  5CXL A;  1D7X A;  1UMS A;  1B3D A;  3DPF A;  1QJJ A;  5D3C A;  2YO1 A;  2HU6 A;  3N2V A;  5D2B A;  1MMR A;  4GR0 A;  1QIB A;  3I7G A;  3LJT A;  3MA2 A;  3TS4 A;  4I03 A;  1ROS A;  1MMP A;  2X3C A;  2AGM A;  1UTZ A;  4GWM A;  2J83 A;  2YIG A;  3DNG A;  3NX7 A;  2K2G A;  4R3V A;  3F19 A;  2Y6D A;  1JIZ A;  1ATL A;  4DD8 A;  1K7Q A;  2OY2 A;  4XM6 A;  1OS9 A;  3KMC A;  4G0D A;  4XM8 A;  2YB9 A;  1UEA A;  3Q2G A;  3HYG A;  1BKC A;  4A3W A;  1OM7 A;  1ZVX A;  3ULT A;  4ZR5 A;  2DW2 A;  2JIH A;  5D1U A;  4WKE A;  3A6Z A;  1DTH A;  2OW2 A;  2QUA A;  1JAP A;  5H8X A;  1GO8 P;  3K7N A;  5CUH A;  1R55 A;  1XFU A;  2Y6C A;  2DDF A;  3CKI A;  3P24 A;  4H2E A;  5D1S A;  1CK7 A;  4CTH A;  1QUA A;  2D1N A;  2Z2D A;  1S4B P;  1FM1 A;  4XCT A;  5I4O A;  3V96 B;  3DPE A;  3UVC A;  3WV3 A;  2W13 A;  1G12 A;  1YQY A;  2SRT A;  1JKY A;  1I76 A;  1CGF A;  1GKD A;  3LUM A;  3B2Z A;  1ZXC A;  2E2D A;  4GF1 A;  1KUH A;  3DWB A;  5CXA A;  1IAG A;  2W14 A;  2KRJ A;  4I35 A;  1KUI A; 
#chains in the Genus database with same CATH topology
 3F15 A;  1USN A;  1G49 A;  2N8R A;  2CKI A;  3I7I A;  3G5C A;  1D8M A;  4PKR A;  1KBC A;  2OVX A;  1BM6 A;  1EB6 A;  3DSL A;  3LGP A;  1CGE A;  1AF0 A;  3DTK A;  3WV1 A;  1OMJ A;  1Y93 A;  1AST A;  3ZVS A;  1ZP5 A;  3G42 A;  1SU3 A;  3LE9 A;  4WZV A;  5I0L A;  3AYU A;  5BOY A;  1BSW A;  3BA0 A;  3LIR A;  4JQG A;  1EUB A;  1YCM A;  1MMB A;  2X3A A;  1BQQ M;  2E3X A;  5CVW A;  1R1I A;  2MLR A;  4IN9 A;  2DW1 A;  4G9L A;  4JPA A;  1ZS0 A;  1D5J A;  1XFZ A;  2YO0 A;  3F1A A;  2L0R A;  1O0T A;  1G4K A;  3HY9 A;  3VI1 A;  2W0D A;  1P9H A;  4WKI A;  1JH1 A;  2QPJ A;  4PKW A;  2MZI A;  5B5O A;  3KRY A;  1ND1 A;  1HOV A;  1XUC A;  1QIC A;  1KUG A;  3LUN A;  3LEA A;  1IAB A;  3HDA P;  1A86 A;  4FXQ A;  2MLS A;  1IAE A;  3N2U A;  1HY7 A;  3F18 A;  2JSD A;  4A7B A;  4WF6 A;  1UTT A;  2FV5 A;  3Q2H A;  3HY7 A;  2D1O A;  3EHY A;  4XBH A;  3KEC A;  5I43 A;  1OM8 A;  3NTN A;  4DF9 A;  1GE5 A;  1SMP A;  5BOT A;  2WOA A;  1GO7 P;  3LIL A;  4WK7 A;  3TSK A;  3O2X A;  3EDH A;  1R1H A;  1I73 A;  2W12 A;  3O64 A;  5I12 A;  1ZTQ A;  3S6L A;  1JAQ A;  1DMT A;  1HV5 A;  4H1Q A;  1BUV M;  966C A;  2OVZ A;  4PKQ A;  830C A;  1G05 A;  3K7L A;  1OS2 A;  3KHI A;  1BQO A;  2ZJ6 A;  3HDB A;  4FU4 A;  5D7W A;  3EHX A;  3LAA A;  2ERQ A;  3AIG A;  3KEJ A;  4H3X A;  1RMZ A;  1D8F A;  2TCL A;  1CQR A;  1H71 P;  2WO8 A;  1XFY A;  2PJT A;  3E8R A;  4DPE A;  2X3B A;  3L0V A;  1EAK A;  2CLT A;  3LJZ A;  3EWJ A;  2FV9 A;  1GXD A;  1OZ9 A;  2O36 A;  4J4M A;  5L7F A;  3B8Z A;  1SRP A;  1XFV A;  2DW0 A;  2XS3 A;  3HB2 P;  1PWW A;  1A85 A;  2OW9 A;  4XM7 A;  1BZS A;  2QUB A;  3F16 A;  4FVL A;  3SHI A;  1AYK A;  4AYK A;  4HX3 A;  1KUK A;  1L6J A;  2ML2 A;  2RJP A;  1ZXV A;  1JJ9 A;  1KUF A;  2ZVD A;  1G9K A;  2X7M A;  2YUF A;  1IAA A;  1JAN A;  3L0T A;  3GBO A;  3P1V A;  1IAC A;  4HMA A;  4JA1 A;  1GE6 A;  2K9C A;  2AIG P;  3RTS A;  2Z8Z A;  4H76 A;  1RM8 A;  4GWN A;  5L79 A;  1O0Q A;  4H30 A;  1BIW A;  2DDY A;  4L19 A;  2OI0 A;  3LIK A;  3OHL A;  3AYK A;  1PWP A;  3TT4 A;  5I2Z A;  1HTD A;  5JMY A;  3KEK A;  2OW1 A;  4DV8 A;  3ZXH A;  2OXZ A;  4AIG A;  5BPA A;  2O3E A;  1C8T A;  3EDZ A;  3U1R A;  2A8H A;  1C7K A;  1BUD A;  3EDI A;  2JT6 A;  1OM6 A;  4PKU A;  3VTG A;  1CAQ A;  2W15 A;  1CIZ A;  3KWV C;  4JIJ A;  1B8Y A;  1WNI A;  2MZH A;  4PKV A;  1R1J A;  3F17 A;  2J0T A;  3LKA A;  4GR3 A;  2OW0 A;  3LK8 A;  2ERO A;  3WP8 A;  1GKC A;  1PWV A;  1KAP P;  5CZM A;  4FXY P;  1OO9 A;  2POJ A;  4ON1 A;  3LQB A;  1CXV A;  2ZJ7 A;  4GQL A;  1SLN A;  1TVI A;  1Y0V A;  2OXW A;  4IJO A;  456C A;  1PWQ A;  4L6T A;  4JP4 A;  1JK3 A;  1HFC A;  3LJG A;  1YOU A;  3HBU P;  2AYK A;  2RJQ A;  1Y8J A;  4DT5 A;  4PKS A;  1K7I A;  1MMQ A;  2I47 A;  2XQH A;  1Q3A A;  3OHO A;  2WO9 A;  1CGL A;  4ILW D;  3DTE A;  1GE7 A;  3B92 A;  1Z3J A;  3HBV P;  5I3M A;  2JNP A;  1SLM A;  2OXU A;  3TVC A;  4PKT A;  2MZE A;  4Q1L A;  3LMC A;  4L63 A;  1C3I A;  1R54 A;  3LQ0 A;  2JT5 A;  4GR8 A;  3RTT A;  2USN A;  3USN A;  3EDG A;  1QIA A;  1JIW P;  1QJI A;  3LA9 A;  4AXQ A;  3ELM A;  2V4B A;  1BKC I;  1PWU A;  1XFX A;  4H49 A;  4L7A A;  5LAB A;  2ERP A;  1AKL A;  1XUR A;  1I1I P;  3A70 A;  4IUW A;  4EFS A;  2XS4 A;  4QKZ A;  1BKC E;  3WV2 A;  1HFS A;  1J7N A;  1FBL A;  4H84 A;  5B5P A;  4AUO A;  2OZR A;  1FLS A;  3DL1 A;  4GUY A;  1IAD A;  5D1T A;  3ZUK A;  3DTI A;  1YP1 A;  1SAT A;  1UMT A;  1XFW A;  2OY4 A;  1K7G A;  1XUD A;  4H82 A;  2Z8X A;  1MNC A;  3KME A;  1JAO A;  5CXL A;  1D7X A;  1UMS A;  1B3D A;  3DPF A;  1QJJ A;  5D3C A;  2YO1 A;  2HU6 A;  3N2V A;  5D2B A;  1MMR A;  4GR0 A;  1XAX A;  1QIB A;  3I7G A;  3LJT A;  3MA2 A;  3TS4 A;  4I03 A;  1ROS A;  1MMP A;  2X3C A;  2AGM A;  1UTZ A;  4GWM A;  2J83 A;  2YIG A;  3DNG A;  3NX7 A;  2K2G A;  4R3V A;  3F19 A;  2Y6D A;  1JIZ A;  1ATL A;  4DD8 A;  1K7Q A;  2OY2 A;  4XM6 A;  1OS9 A;  3KMC A;  4G0D A;  4XM8 A;  2YB9 A;  1UEA A;  3Q2G A;  3HYG A;  1BKC A;  1XM5 A;  4A3W A;  1OM7 A;  1ZVX A;  3ULT A;  4ZR5 A;  2DW2 A;  2JIH A;  5D1U A;  4WKE A;  3A6Z A;  1DTH A;  2OW2 A;  2QUA A;  1JAP A;  5H8X A;  1GO8 P;  3K7N A;  5CUH A;  1R55 A;  1XFU A;  2Y6C A;  2DDF A;  3CKI A;  3P24 A;  4H2E A;  5D1S A;  1CK7 A;  4CTH A;  1QUA A;  2D1N A;  2Z2D A;  1S4B P;  1FM1 A;  4XCT A;  5I4O A;  3V96 B;  3DPE A;  3UVC A;  3WV3 A;  2W13 A;  1G12 A;  1YQY A;  2SRT A;  1JKY A;  1I76 A;  1CGF A;  1GKD A;  3LUM A;  3B2Z A;  1ZXC A;  2E2D A;  4GF1 A;  1KUH A;  3DWB A;  5CXA A;  1IAG A;  2W14 A;  2KRJ A;  4I35 A;  1KUI A; 
#chains in the Genus database with same CATH homology
 3F15 A;  1USN A;  1G49 A;  2N8R A;  2CKI A;  3I7I A;  3G5C A;  1D8M A;  4PKR A;  1KBC A;  2OVX A;  1BM6 A;  1EB6 A;  3DSL A;  3LGP A;  1CGE A;  1AF0 A;  3DTK A;  3WV1 A;  1OMJ A;  1Y93 A;  1AST A;  3ZVS A;  1ZP5 A;  3G42 A;  1SU3 A;  3LE9 A;  4WZV A;  5I0L A;  3AYU A;  5BOY A;  1BSW A;  3BA0 A;  3LIR A;  4JQG A;  1EUB A;  1YCM A;  1MMB A;  2X3A A;  1BQQ M;  2E3X A;  5CVW A;  1R1I A;  2MLR A;  4IN9 A;  2DW1 A;  4G9L A;  4JPA A;  1ZS0 A;  1D5J A;  1XFZ A;  2YO0 A;  3F1A A;  2L0R A;  1O0T A;  1G4K A;  3HY9 A;  3VI1 A;  2W0D A;  1P9H A;  4WKI A;  1JH1 A;  2QPJ A;  4PKW A;  2MZI A;  5B5O A;  3KRY A;  1ND1 A;  1HOV A;  1XUC A;  1QIC A;  1KUG A;  3LUN A;  3LEA A;  1IAB A;  3HDA P;  1A86 A;  4FXQ A;  2MLS A;  1IAE A;  3N2U A;  1HY7 A;  3F18 A;  2JSD A;  4A7B A;  4WF6 A;  1UTT A;  2FV5 A;  3Q2H A;  3HY7 A;  2D1O A;  3EHY A;  4XBH A;  3KEC A;  5I43 A;  1OM8 A;  3NTN A;  4DF9 A;  1GE5 A;  1SMP A;  5BOT A;  2WOA A;  1GO7 P;  3LIL A;  4WK7 A;  3TSK A;  3O2X A;  3EDH A;  1R1H A;  1I73 A;  2W12 A;  3O64 A;  5I12 A;  1ZTQ A;  3S6L A;  1JAQ A;  1DMT A;  1HV5 A;  4H1Q A;  1BUV M;  966C A;  2OVZ A;  4PKQ A;  830C A;  1G05 A;  3K7L A;  1OS2 A;  3KHI A;  1BQO A;  2ZJ6 A;  3HDB A;  4FU4 A;  5D7W A;  3EHX A;  3LAA A;  2ERQ A;  3AIG A;  3KEJ A;  4H3X A;  1RMZ A;  1D8F A;  2TCL A;  1CQR A;  1H71 P;  2WO8 A;  1XFY A;  2PJT A;  3E8R A;  4DPE A;  2X3B A;  3L0V A;  1EAK A;  2CLT A;  3LJZ A;  3EWJ A;  2FV9 A;  1GXD A;  2O36 A;  4J4M A;  5L7F A;  3B8Z A;  1SRP A;  1XFV A;  2DW0 A;  2XS3 A;  3HB2 P;  1PWW A;  1A85 A;  2OW9 A;  4XM7 A;  1BZS A;  2QUB A;  3F16 A;  4FVL A;  3SHI A;  1AYK A;  4AYK A;  4HX3 A;  1KUK A;  1L6J A;  2ML2 A;  2RJP A;  1ZXV A;  1JJ9 A;  1KUF A;  2ZVD A;  1G9K A;  2X7M A;  2YUF A;  1IAA A;  1JAN A;  3L0T A;  3GBO A;  3P1V A;  1IAC A;  4HMA A;  4JA1 A;  1GE6 A;  2K9C A;  2AIG P;  3RTS A;  2Z8Z A;  4H76 A;  1RM8 A;  4GWN A;  5L79 A;  1O0Q A;  4H30 A;  1BIW A;  2DDY A;  4L19 A;  2OI0 A;  3LIK A;  3OHL A;  3AYK A;  1PWP A;  3TT4 A;  5I2Z A;  1HTD A;  5JMY A;  3KEK A;  2OW1 A;  4DV8 A;  3ZXH A;  2OXZ A;  4AIG A;  5BPA A;  2O3E A;  1C8T A;  3EDZ A;  3U1R A;  2A8H A;  1C7K A;  1BUD A;  3EDI A;  2JT6 A;  1OM6 A;  4PKU A;  3VTG A;  1CAQ A;  2W15 A;  1CIZ A;  3KWV C;  4JIJ A;  1B8Y A;  1WNI A;  2MZH A;  4PKV A;  1R1J A;  3F17 A;  2J0T A;  3LKA A;  4GR3 A;  2OW0 A;  3LK8 A;  2ERO A;  3WP8 A;  1GKC A;  1PWV A;  1KAP P;  5CZM A;  4FXY P;  1OO9 A;  2POJ A;  4ON1 A;  3LQB A;  1CXV A;  2ZJ7 A;  4GQL A;  1SLN A;  1Y0V A;  2OXW A;  4IJO A;  456C A;  1PWQ A;  4L6T A;  4JP4 A;  1JK3 A;  1HFC A;  3LJG A;  1YOU A;  3HBU P;  2AYK A;  2RJQ A;  1Y8J A;  4PKS A;  1K7I A;  1MMQ A;  2I47 A;  2XQH A;  1Q3A A;  3OHO A;  2WO9 A;  1CGL A;  4ILW D;  3DTE A;  1GE7 A;  3B92 A;  1Z3J A;  3HBV P;  5I3M A;  2JNP A;  1SLM A;  2OXU A;  3TVC A;  4PKT A;  2MZE A;  4Q1L A;  3LMC A;  4L63 A;  1C3I A;  1R54 A;  3LQ0 A;  2JT5 A;  4GR8 A;  3RTT A;  2USN A;  3USN A;  3EDG A;  1QIA A;  1JIW P;  1QJI A;  3LA9 A;  4AXQ A;  3ELM A;  2V4B A;  1BKC I;  1PWU A;  1XFX A;  4H49 A;  4L7A A;  5LAB A;  2ERP A;  1AKL A;  1XUR A;  1I1I P;  3A70 A;  4IUW A;  4EFS A;  2XS4 A;  4QKZ A;  1BKC E;  3WV2 A;  1HFS A;  1J7N A;  1FBL A;  4H84 A;  5B5P A;  4AUO A;  2OZR A;  1FLS A;  3DL1 A;  4GUY A;  1IAD A;  5D1T A;  3ZUK A;  3DTI A;  1YP1 A;  1SAT A;  1UMT A;  1XFW A;  2OY4 A;  1K7G A;  1XUD A;  4H82 A;  2Z8X A;  1MNC A;  3KME A;  1JAO A;  5CXL A;  1D7X A;  1UMS A;  1B3D A;  3DPF A;  1QJJ A;  5D3C A;  2YO1 A;  2HU6 A;  3N2V A;  5D2B A;  1MMR A;  4GR0 A;  1QIB A;  3I7G A;  3LJT A;  3MA2 A;  3TS4 A;  4I03 A;  1ROS A;  1MMP A;  2X3C A;  2AGM A;  1UTZ A;  4GWM A;  2J83 A;  2YIG A;  3DNG A;  3NX7 A;  2K2G A;  4R3V A;  3F19 A;  2Y6D A;  1JIZ A;  1ATL A;  4DD8 A;  1K7Q A;  2OY2 A;  4XM6 A;  1OS9 A;  3KMC A;  4G0D A;  4XM8 A;  2YB9 A;  1UEA A;  3Q2G A;  3HYG A;  1BKC A;  4A3W A;  1OM7 A;  1ZVX A;  3ULT A;  4ZR5 A;  2DW2 A;  2JIH A;  5D1U A;  4WKE A;  3A6Z A;  1DTH A;  2OW2 A;  2QUA A;  1JAP A;  5H8X A;  1GO8 P;  3K7N A;  5CUH A;  1R55 A;  1XFU A;  2Y6C A;  2DDF A;  3CKI A;  3P24 A;  4H2E A;  5D1S A;  1CK7 A;  4CTH A;  1QUA A;  2D1N A;  2Z2D A;  1S4B P;  1FM1 A;  4XCT A;  5I4O A;  3V96 B;  3DPE A;  3UVC A;  3WV3 A;  2W13 A;  1G12 A;  1YQY A;  2SRT A;  1JKY A;  1I76 A;  1CGF A;  1GKD A;  3LUM A;  3B2Z A;  1ZXC A;  2E2D A;  4GF1 A;  1KUH A;  3DWB A;  5CXA A;  1IAG A;  2W14 A;  2KRJ A;  4I35 A;  1KUI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...