3HB2P

Prtc methionine mutants: m226i
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIISYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
molecule tags Hydrolase
total genus 161
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hb2P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hb2P02
1GO7P 3LK8A 3ELMA 1ZS0A 5I4OA 1XUCA 3HDBA 2OXZA 2JT6A 3EHXA 2YIGA 1JAOA 1XFZA 4GWNA 2Z8XA 1HY7A 456CA 2KRJA 3BA0A 4PKTA 5I3MA 3F1AA 4Q1LA 1KUHA 4IUWA 1G9KA 1HV5A 3L0VA 2RJPA 2OY2A 1YCMA 4PKWA 1AYKA 5D3CA 2OW9A 4PKSA 1USNA 4H49A 3USNA 2OXWA 4H76A 1CK7A 3LUMA 1GKCA 3O2XA 5CUHA 1PWPA 2USNA 1GKDA 5CXAA 1BZSA 3DL1A 1XFVA 1JANA 1BM6A 1PWQA 1QIBA 4WF6A 1OMJA 1ZTQA 1OM7A 3HB2P 1HFSA 3G5CA 4FVLA 1JH1A 2D1NA 1KUFA 1O0QA 1UMSA 2QUBA 1D7XA 3ZXHA 1GXDA 4A7BA 1ATLA 3SHIA 1O0TA 2JIHA 4JIJA 1QICA 2XS3A 4ON1A 2J0TA 3VTGA 1UMTA 1KBCA 4H2EA 1L6JA 3TVCA 4DD8A 4WKIA 2CKIA 3P24A 1ZXCA 2JT5A 2RJQA 1JJ9A 1HOVA 3HDAP 2QPJA 3LJZA 3KHIA 3DPFA 2XS4A 2OZRA 3LIKA 1C8TA 1JK3A 1CIZA 3RTTA 3GBOA 5D1TA 1ZP5A 5CZMA 3ZUKA 4H82A 1S4BP 1XUDA 2PJTA 3RTSA 3VI1A 3S6LA 4JA1A 1Z3JA 5H8XA 3ULTA 1ND1A 4GQLA 1IAAA 2POJA 4L19A 4GR0A 2N8RA 1D8FA 2FV5A 3DPEA 4WKEA 1RM8A 4WZVA 1Y93A 1G05A 3KECA 3OHLA 4DV8A 1CAQA 3HY7A 4AYKA 1CGFA 1EUBA 2ZVDA 3ZVSA 2W12A 2SRTA 1MNCA 3HBUP 1EAKA 3WV3A 3WP8A 3AIGA 1CGLA 2DDYA 5D2BA 3WV1A 3N2UA 4XM6A 4A3WA 4G0DA 4FXYP 3AYUA 3P1VA 4IJOA 4J4MA 3AYKA 2Z8ZA 1WNIA 2YO1A 2MZEA 1OM8A 3LJGA 1HTDA 3KEJA 2DW1A 2ERPA 5L79A 1KUGA 5B5PA 1P9HA 1IABA 3L0TA 3LQ0A 2TCLA 2OY4A 3F17A 3EDHA 1DTHA 2CLTA 3B2ZA 2AYKA 5I12A 4H30A 1BSWA 3DNGA 1XFUA 1D8MA 5JMYA 1Y8JA 5CVWA 1MMBA 2DDFA 4PKQA 4XBHA 1BUVM 1RMZA 1XFWA 2OVXA 1OO9A 2YB9A 1SRPA 1K7QA 2DW2A 1HFCA 1IAGA 1Q3AA 4G9LA 1GE6A 4PKUA 3LEAA 4L63A 2XQHA 1BIWA 2E3XA 3EDIA 4CTHA 3F15A 1PWVA 2W0DA 1BKCA 2K2GA 5B5OA 3KMEA 3O64A 5L7FA 2ZJ7A 1G4KA 2Z2DA 2MZHA 3LQBA 5D1SA 2O3EA 3B92A 1UEAA 1MMPA 2AIGP 4JP4A 3A70A 1R55A 4FU4A 1Y0VA 2V4BA 1AF0A 1EB6A 1J7NA 966CA 2ERQA 3F18A 4FXQA 4I03A 1DMTA 1A86A 1G49A 4GR8A 3U1RA 1K7GA 1XFYA 3F16A 1XFXA 3Q2GA 3V96B 2X3CA 1FM1A 1D5JA 1I76A 2D1OA 1JAPA 3K7NA 1QUAA 1YP1A 4IN9A 2X7MA 2K9CA 1JKYA 2QUAA 1QJIA 4L6TA 2EROA 1MMQA 3TSKA 1IACA 1KAPP 1FLSA 1R1HA 4HMAA 2MZIA 3UVCA 3WV2A 3EWJA 1ZVXA 1G12A 5CXLA 3F19A 4DF9A 1B8YA 3I7GA 5I0LA 1B3DA 2JNPA 3LGPA 1JIWP 3LIRA 1K7IA 2YO0A 3LE9A 4PKVA 3LMCA 2WO9A 3NX7A 4AUOA 1IAEA 1CGEA 1BQQM 2MLRA 3DWBA 4H1QA 1C3IA 3NTNA 1QIAA 5I2ZA 1ZXVA 2FV9A 1OS2A 4QKZA 3HYGA 4XM7A 5I43A 1I73A 3LA9A 4H3XA 1PWWA 1SLMA 1XURA 5BOTA 2HU6A 1UTZA 1KUKA 4AXQA 3KEKA 1SATA 1SMPA 2I47A 3LKAA 4PKRA 1AKLA 3N2VA 1CQRA 3Q2HA 1GE5A 4GWMA 4HX3A 3LAAA 1BKCE 5D7WA 2DW0A 3LUNA 1R1IA 5LABA 2W13A 1GO8P 2X3BA 1C7KA 1PWUA 4I35A 1SU3A 5D1UA 2W15A 2Y6CA 2OW0A 1H71P 3TT4A 3CKIA 1A85A 3EHYA 3MA2A 3EDGA 2O36A 1OM6A 1GE7A 2MLSA 1CXVA 1ASTA 1YQYA 3B8ZA 3OHOA 2A8HA 5BPAA 5BOYA 4DPEA 4GR3A 3HY9A 1JAQA 3A6ZA 4EFSA 1I1IP 3I7IA 1IADA 2OI0A 2OW2A 3KWVC 3HBVP 4AIGA 3KMCA 3G42A 3LILA 4JPAA 1KUIA 1R54A 2X3AA 3KRYA 2WO8A 4XM8A 1BKCI 2Y6DA 1SLNA 4WK7A 3E8RA 4H84A 3EDZA 4XCTA 1JIZA 1BUDA 2E2DA 1QJJA 1UTTA 1MMRA 3DSLA 2AGMA 2WOAA 4R3VA 4GUYA 2W14A 2OW1A 1YOUA 2J83A 2JSDA 2ZJ6A 4GF1A 2OVZA 4ZR5A 1ROSA 4ILWD 3TS4A 4JQGA 1OS9A 1R1JA 1FBLA 3K7LA 2L0RA 1BQOA 2OXUA 3LJTA 830CA 2ML2A
chains in the Genus database with same CATH superfamily
1GO7P 3LK8A 3ELMA 1ZS0A 5I4OA 1XUCA 3HDBA 2OXZA 2JT6A 3EHXA 2YIGA 1JAOA 1XFZA 4GWNA 2Z8XA 1HY7A 456CA 2KRJA 3BA0A 4PKTA 5I3MA 3F1AA 4Q1LA 1KUHA 4IUWA 1G9KA 1HV5A 3L0VA 2RJPA 2OY2A 1YCMA 4PKWA 1AYKA 5D3CA 2OW9A 4PKSA 1USNA 4H49A 3USNA 2OXWA 4H76A 1CK7A 3LUMA 1GKCA 3O2XA 5CUHA 1PWPA 2USNA 1GKDA 5CXAA 1BZSA 3DL1A 1XFVA 1JANA 1BM6A 1PWQA 1QIBA 4WF6A 1OMJA 1ZTQA 1OM7A 3HB2P 1HFSA 1XAXA 3G5CA 4FVLA 1JH1A 2D1NA 1KUFA 1O0QA 1UMSA 2QUBA 1D7XA 3ZXHA 1GXDA 4A7BA 1ATLA 3SHIA 1O0TA 2JIHA 4JIJA 1QICA 2XS3A 4ON1A 2J0TA 3VTGA 1UMTA 1KBCA 4H2EA 1L6JA 3TVCA 4DD8A 4WKIA 2CKIA 3P24A 1ZXCA 2JT5A 2RJQA 1JJ9A 1HOVA 3HDAP 2QPJA 3LJZA 3KHIA 3DPFA 2XS4A 2OZRA 3LIKA 1C8TA 1JK3A 1CIZA 3RTTA 3GBOA 5D1TA 1ZP5A 5CZMA 3ZUKA 4H82A 1S4BP 1XUDA 2PJTA 3RTSA 3VI1A 3S6LA 4JA1A 1Z3JA 5H8XA 3ULTA 1ND1A 4GQLA 1IAAA 2POJA 4L19A 4GR0A 2N8RA 1D8FA 2FV5A 3DPEA 4WKEA 1RM8A 4WZVA 1Y93A 1G05A 3KECA 3OHLA 4DV8A 1CAQA 3HY7A 4AYKA 1CGFA 1EUBA 2ZVDA 3ZVSA 2W12A 2SRTA 1MNCA 3HBUP 1EAKA 3WV3A 3WP8A 3AIGA 1CGLA 2DDYA 5D2BA 3WV1A 3N2UA 4XM6A 4A3WA 4G0DA 4FXYP 3AYUA 3P1VA 4IJOA 4J4MA 3AYKA 2Z8ZA 1WNIA 2YO1A 2MZEA 1OM8A 3LJGA 1HTDA 3KEJA 2DW1A 2ERPA 5L79A 1KUGA 5B5PA 1P9HA 1IABA 3L0TA 3LQ0A 1OZ9A 2TCLA 2OY4A 3F17A 3EDHA 1DTHA 2CLTA 3B2ZA 2AYKA 5I12A 4H30A 1BSWA 3DNGA 1XFUA 1D8MA 5JMYA 1Y8JA 5CVWA 1MMBA 2DDFA 4PKQA 4XBHA 1BUVM 1RMZA 1XFWA 2OVXA 1OO9A 2YB9A 1SRPA 1K7QA 2DW2A 1HFCA 1IAGA 1Q3AA 4G9LA 1GE6A 4PKUA 3LEAA 4L63A 2XQHA 1BIWA 2E3XA 3EDIA 4CTHA 3F15A 1PWVA 2W0DA 1BKCA 2K2GA 5B5OA 3KMEA 3O64A 5L7FA 2ZJ7A 1G4KA 2Z2DA 2MZHA 3LQBA 5D1SA 2O3EA 3B92A 1UEAA 1MMPA 2AIGP 4DT5A 4JP4A 2YUFA 3A70A 1R55A 4FU4A 1Y0VA 2V4BA 1AF0A 1EB6A 1J7NA 966CA 2ERQA 3F18A 4FXQA 4I03A 1DMTA 1A86A 1G49A 4GR8A 3U1RA 1K7GA 1XFYA 3F16A 1XFXA 3Q2GA 3V96B 2X3CA 1FM1A 1D5JA 1I76A 2D1OA 1JAPA 3K7NA 1QUAA 4L7AA 1YP1A 4IN9A 2X7MA 2K9CA 1JKYA 2QUAA 1QJIA 4L6TA 2EROA 1MMQA 3TSKA 1IACA 1KAPP 1FLSA 1R1HA 4HMAA 2MZIA 3UVCA 3WV2A 3EWJA 1ZVXA 1G12A 5CXLA 3F19A 4DF9A 1B8YA 3I7GA 5I0LA 1B3DA 2JNPA 3LGPA 1JIWP 3LIRA 1K7IA 2YO0A 3LE9A 4PKVA 3LMCA 2WO9A 3NX7A 4AUOA 1IAEA 1CGEA 1BQQM 2MLRA 3DWBA 4H1QA 1C3IA 3DTEA 3NTNA 1QIAA 5I2ZA 1ZXVA 2FV9A 1OS2A 4QKZA 3HYGA 4XM7A 5I43A 1I73A 3LA9A 4H3XA 1PWWA 1SLMA 1XURA 5BOTA 2HU6A 1UTZA 1KUKA 4AXQA 3KEKA 1SATA 1SMPA 2I47A 3LKAA 4PKRA 1AKLA 3N2VA 1CQRA 3Q2HA 1GE5A 4GWMA 4HX3A 3LAAA 1BKCE 5D7WA 2DW0A 3LUNA 1R1IA 5LABA 2W13A 1GO8P 2X3BA 1C7KA 1PWUA 4I35A 1SU3A 5D1UA 2W15A 2Y6CA 3DTKA 2OW0A 1H71P 3TT4A 3CKIA 1A85A 3EHYA 3MA2A 3EDGA 2O36A 1OM6A 1GE7A 2MLSA 1CXVA 1ASTA 1XM5A 1YQYA 3B8ZA 3OHOA 2A8HA 5BPAA 5BOYA 4DPEA 4GR3A 3HY9A 1JAQA 3A6ZA 4EFSA 1I1IP 3DTIA 3I7IA 1IADA 2OI0A 2OW2A 3KWVC 3HBVP 4AIGA 3KMCA 3G42A 3LILA 4JPAA 1KUIA 1TVIA 1R54A 2X3AA 3KRYA 2WO8A 4XM8A 1BKCI 2Y6DA 1SLNA 4WK7A 3E8RA 4H84A 3EDZA 4XCTA 1JIZA 1BUDA 2E2DA 1QJJA 1UTTA 1MMRA 3DSLA 2AGMA 2WOAA 4R3VA 4GUYA 2W14A 2OW1A 1YOUA 2J83A 2JSDA 2ZJ6A 4GF1A 2OVZA 4ZR5A 1ROSA 4ILWD 3TS4A 4JQGA 1OS9A 1R1JA 1FBLA 3K7LA 2L0RA 1BQOA 2OXUA 3LJTA 830CA 2ML2A
chains in the Genus database with same CATH topology
1GO7P 3LK8A 3ELMA 1ZS0A 5I4OA 1XUCA 3HDBA 2OXZA 2JT6A 3EHXA 2YIGA 1JAOA 1XFZA 4GWNA 2Z8XA 1HY7A 456CA 2KRJA 3BA0A 4PKTA 5I3MA 3F1AA 4Q1LA 1KUHA 4IUWA 1G9KA 1HV5A 3L0VA 2RJPA 2OY2A 1YCMA 4PKWA 1AYKA 5D3CA 2OW9A 4PKSA 1USNA 4H49A 3USNA 2OXWA 4H76A 1CK7A 3LUMA 1GKCA 3O2XA 5CUHA 1PWPA 2USNA 1GKDA 5CXAA 1BZSA 3DL1A 1XFVA 1JANA 1BM6A 1PWQA 1QIBA 4WF6A 1OMJA 1ZTQA 1OM7A 3HB2P 1HFSA 3G5CA 4FVLA 1JH1A 2D1NA 1KUFA 1O0QA 1UMSA 2QUBA 1D7XA 3ZXHA 1GXDA 4A7BA 1ATLA 3SHIA 1O0TA 2JIHA 4JIJA 1QICA 2XS3A 4ON1A 2J0TA 3VTGA 1UMTA 1KBCA 4H2EA 1L6JA 3TVCA 4DD8A 4WKIA 2CKIA 3P24A 1ZXCA 2JT5A 2RJQA 1JJ9A 1HOVA 3HDAP 2QPJA 3LJZA 3KHIA 3DPFA 2XS4A 2OZRA 3LIKA 1C8TA 1JK3A 1CIZA 3RTTA 3GBOA 5D1TA 1ZP5A 5CZMA 3ZUKA 4H82A 1S4BP 1XUDA 2PJTA 3RTSA 3VI1A 3S6LA 4JA1A 1Z3JA 5H8XA 3ULTA 1ND1A 4GQLA 1IAAA 2POJA 4L19A 4GR0A 2N8RA 1D8FA 2FV5A 3DPEA 4WKEA 1RM8A 4WZVA 1Y93A 1G05A 3KECA 3OHLA 4DV8A 1CAQA 3HY7A 4AYKA 1CGFA 1EUBA 2ZVDA 3ZVSA 2W12A 2SRTA 1MNCA 3HBUP 1EAKA 3WV3A 3WP8A 3AIGA 1CGLA 2DDYA 5D2BA 3WV1A 3N2UA 4XM6A 4A3WA 4G0DA 4FXYP 3AYUA 3P1VA 4IJOA 4J4MA 3AYKA 2Z8ZA 1WNIA 2YO1A 2MZEA 1OM8A 3LJGA 1HTDA 3KEJA 2DW1A 2ERPA 5L79A 1KUGA 5B5PA 1P9HA 1IABA 3L0TA 3LQ0A 2TCLA 2OY4A 3F17A 3EDHA 1DTHA 2CLTA 3B2ZA 2AYKA 5I12A 4H30A 1BSWA 3DNGA 1XFUA 1D8MA 5JMYA 1Y8JA 5CVWA 1MMBA 2DDFA 4PKQA 4XBHA 1BUVM 1RMZA 1XFWA 2OVXA 1OO9A 2YB9A 1SRPA 1K7QA 2DW2A 1HFCA 1IAGA 1Q3AA 4G9LA 1GE6A 4PKUA 3LEAA 4L63A 2XQHA 1BIWA 2E3XA 3EDIA 4CTHA 3F15A 1PWVA 2W0DA 1BKCA 2K2GA 5B5OA 3KMEA 3O64A 5L7FA 2ZJ7A 1G4KA 2Z2DA 2MZHA 3LQBA 5D1SA 2O3EA 3B92A 1UEAA 1MMPA 2AIGP 4JP4A 2YUFA 3A70A 1R55A 4FU4A 1Y0VA 2V4BA 1AF0A 1EB6A 1J7NA 966CA 2ERQA 3F18A 4FXQA 4I03A 1DMTA 1A86A 1G49A 4GR8A 3U1RA 1K7GA 1XFYA 3F16A 1XFXA 3Q2GA 3V96B 2X3CA 1FM1A 1D5JA 1I76A 2D1OA 1JAPA 3K7NA 1QUAA 4L7AA 1YP1A 4IN9A 2X7MA 2K9CA 1JKYA 2QUAA 1QJIA 4L6TA 2EROA 1MMQA 3TSKA 1IACA 1KAPP 1FLSA 1R1HA 4HMAA 2MZIA 3UVCA 3WV2A 3EWJA 1ZVXA 1G12A 5CXLA 3F19A 4DF9A 1B8YA 3I7GA 5I0LA 1B3DA 2JNPA 3LGPA 1JIWP 3LIRA 1K7IA 2YO0A 3LE9A 4PKVA 3LMCA 2WO9A 3NX7A 4AUOA 1IAEA 1CGEA 1BQQM 2MLRA 3DWBA 4H1QA 1C3IA 3DTEA 3NTNA 1QIAA 5I2ZA 1ZXVA 2FV9A 1OS2A 4QKZA 3HYGA 4XM7A 5I43A 1I73A 3LA9A 4H3XA 1PWWA 1SLMA 1XURA 5BOTA 2HU6A 1UTZA 1KUKA 4AXQA 3KEKA 1SATA 1SMPA 2I47A 3LKAA 4PKRA 1AKLA 3N2VA 1CQRA 3Q2HA 1GE5A 4GWMA 4HX3A 3LAAA 1BKCE 5D7WA 2DW0A 3LUNA 1R1IA 5LABA 2W13A 1GO8P 2X3BA 1C7KA 1PWUA 4I35A 1SU3A 5D1UA 2W15A 2Y6CA 3DTKA 2OW0A 1H71P 3TT4A 3CKIA 1A85A 3EHYA 3MA2A 3EDGA 2O36A 1OM6A 1GE7A 2MLSA 1CXVA 1ASTA 1YQYA 3B8ZA 3OHOA 2A8HA 5BPAA 5BOYA 4DPEA 4GR3A 3HY9A 1JAQA 3A6ZA 4EFSA 1I1IP 3DTIA 3I7IA 1IADA 2OI0A 2OW2A 3KWVC 3HBVP 4AIGA 3KMCA 3G42A 3LILA 4JPAA 1KUIA 1R54A 2X3AA 3KRYA 2WO8A 4XM8A 1BKCI 2Y6DA 1SLNA 4WK7A 3E8RA 4H84A 3EDZA 4XCTA 1JIZA 1BUDA 2E2DA 1QJJA 1UTTA 1MMRA 3DSLA 2AGMA 2WOAA 4R3VA 4GUYA 2W14A 2OW1A 1YOUA 2J83A 2JSDA 2ZJ6A 4GF1A 2OVZA 4ZR5A 1ROSA 4ILWD 3TS4A 4JQGA 1OS9A 1R1JA 1FBLA 3K7LA 2L0RA 1BQOA 2OXUA 3LJTA 830CA 2ML2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GO7 P;  3LK8 A;  3ELM A;  1ZS0 A;  5I4O A;  1XUC A;  3HDB A;  2OXZ A;  2JT6 A;  3EHX A;  2YIG A;  1JAO A;  1XFZ A;  4GWN A;  2Z8X A;  1HY7 A;  456C A;  2KRJ A;  3BA0 A;  4PKT A;  5I3M A;  3F1A A;  4Q1L A;  1KUH A;  4IUW A;  1G9K A;  1HV5 A;  3L0V A;  2RJP A;  2OY2 A;  1YCM A;  4PKW A;  1AYK A;  5D3C A;  2OW9 A;  4PKS A;  1USN A;  4H49 A;  3USN A;  2OXW A;  4H76 A;  1CK7 A;  3LUM A;  1GKC A;  3O2X A;  5CUH A;  1PWP A;  2USN A;  1GKD A;  5CXA A;  1BZS A;  3DL1 A;  1XFV A;  1JAN A;  1BM6 A;  1PWQ A;  1QIB A;  4WF6 A;  1OMJ A;  1ZTQ A;  1OM7 A;  3HB2 P;  1HFS A;  3G5C A;  4FVL A;  1JH1 A;  2D1N A;  1KUF A;  1O0Q A;  1UMS A;  2QUB A;  1D7X A;  3ZXH A;  1GXD A;  4A7B A;  1ATL A;  3SHI A;  1O0T A;  2JIH A;  4JIJ A;  1QIC A;  2XS3 A;  4ON1 A;  2J0T A;  3VTG A;  1UMT A;  1KBC A;  4H2E A;  1L6J A;  3TVC A;  4DD8 A;  4WKI A;  2CKI A;  3P24 A;  1ZXC A;  2JT5 A;  2RJQ A;  1JJ9 A;  1HOV A;  3HDA P;  2QPJ A;  3LJZ A;  3KHI A;  3DPF A;  2XS4 A;  2OZR A;  3LIK A;  1C8T A;  1JK3 A;  1CIZ A;  3RTT A;  3GBO A;  5D1T A;  1ZP5 A;  5CZM A;  3ZUK A;  4H82 A;  1S4B P;  1XUD A;  2PJT A;  3RTS A;  3VI1 A;  3S6L A;  4JA1 A;  1Z3J A;  5H8X A;  3ULT A;  1ND1 A;  4GQL A;  1IAA A;  2POJ A;  4L19 A;  4GR0 A;  2N8R A;  1D8F A;  2FV5 A;  3DPE A;  4WKE A;  1RM8 A;  4WZV A;  1Y93 A;  1G05 A;  3KEC A;  3OHL A;  4DV8 A;  1CAQ A;  3HY7 A;  4AYK A;  1CGF A;  1EUB A;  2ZVD A;  3ZVS A;  2W12 A;  2SRT A;  1MNC A;  3HBU P;  1EAK A;  3WV3 A;  3WP8 A;  3AIG A;  1CGL A;  2DDY A;  5D2B A;  3WV1 A;  3N2U A;  4XM6 A;  4A3W A;  4G0D A;  4FXY P;  3AYU A;  3P1V A;  4IJO A;  4J4M A;  3AYK A;  2Z8Z A;  1WNI A;  2YO1 A;  2MZE A;  1OM8 A;  3LJG A;  1HTD A;  3KEJ A;  2DW1 A;  2ERP A;  5L79 A;  1KUG A;  5B5P A;  1P9H A;  1IAB A;  3L0T A;  3LQ0 A;  2TCL A;  2OY4 A;  3F17 A;  3EDH A;  1DTH A;  2CLT A;  3B2Z A;  2AYK A;  5I12 A;  4H30 A;  1BSW A;  3DNG A;  1XFU A;  1D8M A;  5JMY A;  1Y8J A;  5CVW A;  1MMB A;  2DDF A;  4PKQ A;  4XBH A;  1BUV M;  1RMZ A;  1XFW A;  2OVX A;  1OO9 A;  2YB9 A;  1SRP A;  1K7Q A;  2DW2 A;  1HFC A;  1IAG A;  1Q3A A;  4G9L A;  1GE6 A;  4PKU A;  3LEA A;  4L63 A;  2XQH A;  1BIW A;  2E3X A;  3EDI A;  4CTH A;  3F15 A;  1PWV A;  2W0D A;  1BKC A;  2K2G A;  5B5O A;  3KME A;  3O64 A;  5L7F A;  2ZJ7 A;  1G4K A;  2Z2D A;  2MZH A;  3LQB A;  5D1S A;  2O3E A;  3B92 A;  1UEA A;  1MMP A;  2AIG P;  4JP4 A;  3A70 A;  1R55 A;  4FU4 A;  1Y0V A;  2V4B A;  1AF0 A;  1EB6 A;  1J7N A;  966C A;  2ERQ A;  3F18 A;  4FXQ A;  4I03 A;  1DMT A;  1A86 A;  1G49 A;  4GR8 A;  3U1R A;  1K7G A;  1XFY A;  3F16 A;  1XFX A;  3Q2G A;  3V96 B;  2X3C A;  1FM1 A;  1D5J A;  1I76 A;  2D1O A;  1JAP A;  3K7N A;  1QUA A;  1YP1 A;  4IN9 A;  2X7M A;  2K9C A;  1JKY A;  2QUA A;  1QJI A;  4L6T A;  2ERO A;  1MMQ A;  3TSK A;  1IAC A;  1KAP P;  1FLS A;  1R1H A;  4HMA A;  2MZI A;  3UVC A;  3WV2 A;  3EWJ A;  1ZVX A;  1G12 A;  5CXL A;  3F19 A;  4DF9 A;  1B8Y A;  3I7G A;  5I0L A;  1B3D A;  2JNP A;  3LGP A;  1JIW P;  3LIR A;  1K7I A;  2YO0 A;  3LE9 A;  4PKV A;  3LMC A;  2WO9 A;  3NX7 A;  4AUO A;  1IAE A;  1CGE A;  1BQQ M;  2MLR A;  3DWB A;  4H1Q A;  1C3I A;  3NTN A;  1QIA A;  5I2Z A;  1ZXV A;  2FV9 A;  1OS2 A;  4QKZ A;  3HYG A;  4XM7 A;  5I43 A;  1I73 A;  3LA9 A;  4H3X A;  1PWW A;  1SLM A;  1XUR A;  5BOT A;  2HU6 A;  1UTZ A;  1KUK A;  4AXQ A;  3KEK A;  1SAT A;  1SMP A;  2I47 A;  3LKA A;  4PKR A;  1AKL A;  3N2V A;  1CQR A;  3Q2H A;  1GE5 A;  4GWM A;  4HX3 A;  3LAA A;  1BKC E;  5D7W A;  2DW0 A;  3LUN A;  1R1I A;  5LAB A;  2W13 A;  1GO8 P;  2X3B A;  1C7K A;  1PWU A;  4I35 A;  1SU3 A;  5D1U A;  2W15 A;  2Y6C A;  2OW0 A;  1H71 P;  3TT4 A;  3CKI A;  1A85 A;  3EHY A;  3MA2 A;  3EDG A;  2O36 A;  1OM6 A;  1GE7 A;  2MLS A;  1CXV A;  1AST A;  1YQY A;  3B8Z A;  3OHO A;  2A8H A;  5BPA A;  5BOY A;  4DPE A;  4GR3 A;  3HY9 A;  1JAQ A;  3A6Z A;  4EFS A;  1I1I P;  3I7I A;  1IAD A;  2OI0 A;  2OW2 A;  3KWV C;  3HBV P;  4AIG A;  3KMC A;  3G42 A;  3LIL A;  4JPA A;  1KUI A;  1R54 A;  2X3A A;  3KRY A;  2WO8 A;  4XM8 A;  1BKC I;  2Y6D A;  1SLN A;  4WK7 A;  3E8R A;  4H84 A;  3EDZ A;  4XCT A;  1JIZ A;  1BUD A;  2E2D A;  1QJJ A;  1UTT A;  1MMR A;  3DSL A;  2AGM A;  2WOA A;  4R3V A;  4GUY A;  2W14 A;  2OW1 A;  1YOU A;  2J83 A;  2JSD A;  2ZJ6 A;  4GF1 A;  2OVZ A;  4ZR5 A;  1ROS A;  4ILW D;  3TS4 A;  4JQG A;  1OS9 A;  1R1J A;  1FBL A;  3K7L A;  2L0R A;  1BQO A;  2OXU A;  3LJT A;  830C A;  2ML2 A; 
#chains in the Genus database with same CATH topology
 1GO7 P;  3LK8 A;  3ELM A;  1ZS0 A;  5I4O A;  1XUC A;  3HDB A;  2OXZ A;  2JT6 A;  3EHX A;  2YIG A;  1JAO A;  1XFZ A;  4GWN A;  2Z8X A;  1HY7 A;  456C A;  2KRJ A;  3BA0 A;  4PKT A;  5I3M A;  3F1A A;  4Q1L A;  1KUH A;  4IUW A;  1G9K A;  1HV5 A;  3L0V A;  2RJP A;  2OY2 A;  1YCM A;  4PKW A;  1AYK A;  5D3C A;  2OW9 A;  4PKS A;  1USN A;  4H49 A;  3USN A;  2OXW A;  4H76 A;  1CK7 A;  3LUM A;  1GKC A;  3O2X A;  5CUH A;  1PWP A;  2USN A;  1GKD A;  5CXA A;  1BZS A;  3DL1 A;  1XFV A;  1JAN A;  1BM6 A;  1PWQ A;  1QIB A;  4WF6 A;  1OMJ A;  1ZTQ A;  1OM7 A;  3HB2 P;  1HFS A;  1XAX A;  3G5C A;  4FVL A;  1JH1 A;  2D1N A;  1KUF A;  1O0Q A;  1UMS A;  2QUB A;  1D7X A;  3ZXH A;  1GXD A;  4A7B A;  1ATL A;  3SHI A;  1O0T A;  2JIH A;  4JIJ A;  1QIC A;  2XS3 A;  4ON1 A;  2J0T A;  3VTG A;  1UMT A;  1KBC A;  4H2E A;  1L6J A;  3TVC A;  4DD8 A;  4WKI A;  2CKI A;  3P24 A;  1ZXC A;  2JT5 A;  2RJQ A;  1JJ9 A;  1HOV A;  3HDA P;  2QPJ A;  3LJZ A;  3KHI A;  3DPF A;  2XS4 A;  2OZR A;  3LIK A;  1C8T A;  1JK3 A;  1CIZ A;  3RTT A;  3GBO A;  5D1T A;  1ZP5 A;  5CZM A;  3ZUK A;  4H82 A;  1S4B P;  1XUD A;  2PJT A;  3RTS A;  3VI1 A;  3S6L A;  4JA1 A;  1Z3J A;  5H8X A;  3ULT A;  1ND1 A;  4GQL A;  1IAA A;  2POJ A;  4L19 A;  4GR0 A;  2N8R A;  1D8F A;  2FV5 A;  3DPE A;  4WKE A;  1RM8 A;  4WZV A;  1Y93 A;  1G05 A;  3KEC A;  3OHL A;  4DV8 A;  1CAQ A;  3HY7 A;  4AYK A;  1CGF A;  1EUB A;  2ZVD A;  3ZVS A;  2W12 A;  2SRT A;  1MNC A;  3HBU P;  1EAK A;  3WV3 A;  3WP8 A;  3AIG A;  1CGL A;  2DDY A;  5D2B A;  3WV1 A;  3N2U A;  4XM6 A;  4A3W A;  4G0D A;  4FXY P;  3AYU A;  3P1V A;  4IJO A;  4J4M A;  3AYK A;  2Z8Z A;  1WNI A;  2YO1 A;  2MZE A;  1OM8 A;  3LJG A;  1HTD A;  3KEJ A;  2DW1 A;  2ERP A;  5L79 A;  1KUG A;  5B5P A;  1P9H A;  1IAB A;  3L0T A;  3LQ0 A;  1OZ9 A;  2TCL A;  2OY4 A;  3F17 A;  3EDH A;  1DTH A;  2CLT A;  3B2Z A;  2AYK A;  5I12 A;  4H30 A;  1BSW A;  3DNG A;  1XFU A;  1D8M A;  5JMY A;  1Y8J A;  5CVW A;  1MMB A;  2DDF A;  4PKQ A;  4XBH A;  1BUV M;  1RMZ A;  1XFW A;  2OVX A;  1OO9 A;  2YB9 A;  1SRP A;  1K7Q A;  2DW2 A;  1HFC A;  1IAG A;  1Q3A A;  4G9L A;  1GE6 A;  4PKU A;  3LEA A;  4L63 A;  2XQH A;  1BIW A;  2E3X A;  3EDI A;  4CTH A;  3F15 A;  1PWV A;  2W0D A;  1BKC A;  2K2G A;  5B5O A;  3KME A;  3O64 A;  5L7F A;  2ZJ7 A;  1G4K A;  2Z2D A;  2MZH A;  3LQB A;  5D1S A;  2O3E A;  3B92 A;  1UEA A;  1MMP A;  2AIG P;  4DT5 A;  4JP4 A;  2YUF A;  3A70 A;  1R55 A;  4FU4 A;  1Y0V A;  2V4B A;  1AF0 A;  1EB6 A;  1J7N A;  966C A;  2ERQ A;  3F18 A;  4FXQ A;  4I03 A;  1DMT A;  1A86 A;  1G49 A;  4GR8 A;  3U1R A;  1K7G A;  1XFY A;  3F16 A;  1XFX A;  3Q2G A;  3V96 B;  2X3C A;  1FM1 A;  1D5J A;  1I76 A;  2D1O A;  1JAP A;  3K7N A;  1QUA A;  4L7A A;  1YP1 A;  4IN9 A;  2X7M A;  2K9C A;  1JKY A;  2QUA A;  1QJI A;  4L6T A;  2ERO A;  1MMQ A;  3TSK A;  1IAC A;  1KAP P;  1FLS A;  1R1H A;  4HMA A;  2MZI A;  3UVC A;  3WV2 A;  3EWJ A;  1ZVX A;  1G12 A;  5CXL A;  3F19 A;  4DF9 A;  1B8Y A;  3I7G A;  5I0L A;  1B3D A;  2JNP A;  3LGP A;  1JIW P;  3LIR A;  1K7I A;  2YO0 A;  3LE9 A;  4PKV A;  3LMC A;  2WO9 A;  3NX7 A;  4AUO A;  1IAE A;  1CGE A;  1BQQ M;  2MLR A;  3DWB A;  4H1Q A;  1C3I A;  3DTE A;  3NTN A;  1QIA A;  5I2Z A;  1ZXV A;  2FV9 A;  1OS2 A;  4QKZ A;  3HYG A;  4XM7 A;  5I43 A;  1I73 A;  3LA9 A;  4H3X A;  1PWW A;  1SLM A;  1XUR A;  5BOT A;  2HU6 A;  1UTZ A;  1KUK A;  4AXQ A;  3KEK A;  1SAT A;  1SMP A;  2I47 A;  3LKA A;  4PKR A;  1AKL A;  3N2V A;  1CQR A;  3Q2H A;  1GE5 A;  4GWM A;  4HX3 A;  3LAA A;  1BKC E;  5D7W A;  2DW0 A;  3LUN A;  1R1I A;  5LAB A;  2W13 A;  1GO8 P;  2X3B A;  1C7K A;  1PWU A;  4I35 A;  1SU3 A;  5D1U A;  2W15 A;  2Y6C A;  3DTK A;  2OW0 A;  1H71 P;  3TT4 A;  3CKI A;  1A85 A;  3EHY A;  3MA2 A;  3EDG A;  2O36 A;  1OM6 A;  1GE7 A;  2MLS A;  1CXV A;  1AST A;  1XM5 A;  1YQY A;  3B8Z A;  3OHO A;  2A8H A;  5BPA A;  5BOY A;  4DPE A;  4GR3 A;  3HY9 A;  1JAQ A;  3A6Z A;  4EFS A;  1I1I P;  3DTI A;  3I7I A;  1IAD A;  2OI0 A;  2OW2 A;  3KWV C;  3HBV P;  4AIG A;  3KMC A;  3G42 A;  3LIL A;  4JPA A;  1KUI A;  1TVI A;  1R54 A;  2X3A A;  3KRY A;  2WO8 A;  4XM8 A;  1BKC I;  2Y6D A;  1SLN A;  4WK7 A;  3E8R A;  4H84 A;  3EDZ A;  4XCT A;  1JIZ A;  1BUD A;  2E2D A;  1QJJ A;  1UTT A;  1MMR A;  3DSL A;  2AGM A;  2WOA A;  4R3V A;  4GUY A;  2W14 A;  2OW1 A;  1YOU A;  2J83 A;  2JSD A;  2ZJ6 A;  4GF1 A;  2OVZ A;  4ZR5 A;  1ROS A;  4ILW D;  3TS4 A;  4JQG A;  1OS9 A;  1R1J A;  1FBL A;  3K7L A;  2L0R A;  1BQO A;  2OXU A;  3LJT A;  830C A;  2ML2 A; 
#chains in the Genus database with same CATH homology
 1GO7 P;  3LK8 A;  3ELM A;  1ZS0 A;  5I4O A;  1XUC A;  3HDB A;  2OXZ A;  2JT6 A;  3EHX A;  2YIG A;  1JAO A;  1XFZ A;  4GWN A;  2Z8X A;  1HY7 A;  456C A;  2KRJ A;  3BA0 A;  4PKT A;  5I3M A;  3F1A A;  4Q1L A;  1KUH A;  4IUW A;  1G9K A;  1HV5 A;  3L0V A;  2RJP A;  2OY2 A;  1YCM A;  4PKW A;  1AYK A;  5D3C A;  2OW9 A;  4PKS A;  1USN A;  4H49 A;  3USN A;  2OXW A;  4H76 A;  1CK7 A;  3LUM A;  1GKC A;  3O2X A;  5CUH A;  1PWP A;  2USN A;  1GKD A;  5CXA A;  1BZS A;  3DL1 A;  1XFV A;  1JAN A;  1BM6 A;  1PWQ A;  1QIB A;  4WF6 A;  1OMJ A;  1ZTQ A;  1OM7 A;  3HB2 P;  1HFS A;  3G5C A;  4FVL A;  1JH1 A;  2D1N A;  1KUF A;  1O0Q A;  1UMS A;  2QUB A;  1D7X A;  3ZXH A;  1GXD A;  4A7B A;  1ATL A;  3SHI A;  1O0T A;  2JIH A;  4JIJ A;  1QIC A;  2XS3 A;  4ON1 A;  2J0T A;  3VTG A;  1UMT A;  1KBC A;  4H2E A;  1L6J A;  3TVC A;  4DD8 A;  4WKI A;  2CKI A;  3P24 A;  1ZXC A;  2JT5 A;  2RJQ A;  1JJ9 A;  1HOV A;  3HDA P;  2QPJ A;  3LJZ A;  3KHI A;  3DPF A;  2XS4 A;  2OZR A;  3LIK A;  1C8T A;  1JK3 A;  1CIZ A;  3RTT A;  3GBO A;  5D1T A;  1ZP5 A;  5CZM A;  3ZUK A;  4H82 A;  1S4B P;  1XUD A;  2PJT A;  3RTS A;  3VI1 A;  3S6L A;  4JA1 A;  1Z3J A;  5H8X A;  3ULT A;  1ND1 A;  4GQL A;  1IAA A;  2POJ A;  4L19 A;  4GR0 A;  2N8R A;  1D8F A;  2FV5 A;  3DPE A;  4WKE A;  1RM8 A;  4WZV A;  1Y93 A;  1G05 A;  3KEC A;  3OHL A;  4DV8 A;  1CAQ A;  3HY7 A;  4AYK A;  1CGF A;  1EUB A;  2ZVD A;  3ZVS A;  2W12 A;  2SRT A;  1MNC A;  3HBU P;  1EAK A;  3WV3 A;  3WP8 A;  3AIG A;  1CGL A;  2DDY A;  5D2B A;  3WV1 A;  3N2U A;  4XM6 A;  4A3W A;  4G0D A;  4FXY P;  3AYU A;  3P1V A;  4IJO A;  4J4M A;  3AYK A;  2Z8Z A;  1WNI A;  2YO1 A;  2MZE A;  1OM8 A;  3LJG A;  1HTD A;  3KEJ A;  2DW1 A;  2ERP A;  5L79 A;  1KUG A;  5B5P A;  1P9H A;  1IAB A;  3L0T A;  3LQ0 A;  2TCL A;  2OY4 A;  3F17 A;  3EDH A;  1DTH A;  2CLT A;  3B2Z A;  2AYK A;  5I12 A;  4H30 A;  1BSW A;  3DNG A;  1XFU A;  1D8M A;  5JMY A;  1Y8J A;  5CVW A;  1MMB A;  2DDF A;  4PKQ A;  4XBH A;  1BUV M;  1RMZ A;  1XFW A;  2OVX A;  1OO9 A;  2YB9 A;  1SRP A;  1K7Q A;  2DW2 A;  1HFC A;  1IAG A;  1Q3A A;  4G9L A;  1GE6 A;  4PKU A;  3LEA A;  4L63 A;  2XQH A;  1BIW A;  2E3X A;  3EDI A;  4CTH A;  3F15 A;  1PWV A;  2W0D A;  1BKC A;  2K2G A;  5B5O A;  3KME A;  3O64 A;  5L7F A;  2ZJ7 A;  1G4K A;  2Z2D A;  2MZH A;  3LQB A;  5D1S A;  2O3E A;  3B92 A;  1UEA A;  1MMP A;  2AIG P;  4JP4 A;  2YUF A;  3A70 A;  1R55 A;  4FU4 A;  1Y0V A;  2V4B A;  1AF0 A;  1EB6 A;  1J7N A;  966C A;  2ERQ A;  3F18 A;  4FXQ A;  4I03 A;  1DMT A;  1A86 A;  1G49 A;  4GR8 A;  3U1R A;  1K7G A;  1XFY A;  3F16 A;  1XFX A;  3Q2G A;  3V96 B;  2X3C A;  1FM1 A;  1D5J A;  1I76 A;  2D1O A;  1JAP A;  3K7N A;  1QUA A;  4L7A A;  1YP1 A;  4IN9 A;  2X7M A;  2K9C A;  1JKY A;  2QUA A;  1QJI A;  4L6T A;  2ERO A;  1MMQ A;  3TSK A;  1IAC A;  1KAP P;  1FLS A;  1R1H A;  4HMA A;  2MZI A;  3UVC A;  3WV2 A;  3EWJ A;  1ZVX A;  1G12 A;  5CXL A;  3F19 A;  4DF9 A;  1B8Y A;  3I7G A;  5I0L A;  1B3D A;  2JNP A;  3LGP A;  1JIW P;  3LIR A;  1K7I A;  2YO0 A;  3LE9 A;  4PKV A;  3LMC A;  2WO9 A;  3NX7 A;  4AUO A;  1IAE A;  1CGE A;  1BQQ M;  2MLR A;  3DWB A;  4H1Q A;  1C3I A;  3DTE A;  3NTN A;  1QIA A;  5I2Z A;  1ZXV A;  2FV9 A;  1OS2 A;  4QKZ A;  3HYG A;  4XM7 A;  5I43 A;  1I73 A;  3LA9 A;  4H3X A;  1PWW A;  1SLM A;  1XUR A;  5BOT A;  2HU6 A;  1UTZ A;  1KUK A;  4AXQ A;  3KEK A;  1SAT A;  1SMP A;  2I47 A;  3LKA A;  4PKR A;  1AKL A;  3N2V A;  1CQR A;  3Q2H A;  1GE5 A;  4GWM A;  4HX3 A;  3LAA A;  1BKC E;  5D7W A;  2DW0 A;  3LUN A;  1R1I A;  5LAB A;  2W13 A;  1GO8 P;  2X3B A;  1C7K A;  1PWU A;  4I35 A;  1SU3 A;  5D1U A;  2W15 A;  2Y6C A;  3DTK A;  2OW0 A;  1H71 P;  3TT4 A;  3CKI A;  1A85 A;  3EHY A;  3MA2 A;  3EDG A;  2O36 A;  1OM6 A;  1GE7 A;  2MLS A;  1CXV A;  1AST A;  1YQY A;  3B8Z A;  3OHO A;  2A8H A;  5BPA A;  5BOY A;  4DPE A;  4GR3 A;  3HY9 A;  1JAQ A;  3A6Z A;  4EFS A;  1I1I P;  3DTI A;  3I7I A;  1IAD A;  2OI0 A;  2OW2 A;  3KWV C;  3HBV P;  4AIG A;  3KMC A;  3G42 A;  3LIL A;  4JPA A;  1KUI A;  1R54 A;  2X3A A;  3KRY A;  2WO8 A;  4XM8 A;  1BKC I;  2Y6D A;  1SLN A;  4WK7 A;  3E8R A;  4H84 A;  3EDZ A;  4XCT A;  1JIZ A;  1BUD A;  2E2D A;  1QJJ A;  1UTT A;  1MMR A;  3DSL A;  2AGM A;  2WOA A;  4R3V A;  4GUY A;  2W14 A;  2OW1 A;  1YOU A;  2J83 A;  2JSD A;  2ZJ6 A;  4GF1 A;  2OVZ A;  4ZR5 A;  1ROS A;  4ILW D;  3TS4 A;  4JQG A;  1OS9 A;  1R1J A;  1FBL A;  3K7L A;  2L0R A;  1BQO A;  2OXU A;  3LJT A;  830C A;  2ML2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...