3HB2P

Prtc methionine mutants: m226i
Total Genus 161
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
161
sequence length
462
structure length
462
Chain Sequence
ANTSSAYNSVYDFLRYHDRGDGLTVNGKTSYSIDQAAAQITRENVSWNGTNVFGKSANLTFKFLQSVSSIPSGDTGFVKFNAEQIEQAKLSLQSWSDVANLTFTEVTGNKSANITFGNYTRDASGNLDYGTQAYAYYPGNYQGAGSSWYNYNQSNIRNPGSEEYGRQTFTHAIGHALGLAHPGEYNAGEGDPSYNDAVYAEDSYQFSIISYWGENETGADYNGHYGGAPMIDDIAAIQRLYGANMTTRTGDSVYGFNSNTDRDFYTATDSSKALIFSVWDAGGTDTFDFSGYSNNQRINLNEGSFSDVGGLKGNVSIAHGVTIENAIGGSGNDILVGNSADNILQGGAGNDVLYGGAGADTLYGGAGRDTFVYGSGQDSTVAAYDWIADFQKGIDKIDLSAFRNEGQLSFVQDQFTGKGQEVMLQWDAANSITNLWLHEAGHSSVDFLVRIVGQAAQSDIIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Secreted protease C
publication title Metzincin's canonical methionine is responsible for the structural integrity of the zinc-binding site
pubmed doi rcsb
source organism Erwinia chrysanthemi
total genus 161
structure length 462
sequence length 462
ec nomenclature ec 3.4.24.40: Serralysin.
pdb deposition date 2009-05-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
P PF00353 HemolysinCabind RTX calcium-binding nonapeptide repeat (4 copies)
P PF00413 Peptidase_M10 Matrixin
P PF08548 Peptidase_M10_C Peptidase M10 serralysin C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3hb2P01
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3hb2P02
4L63A 1PWUA 1UEAA 4GWMA 2A8HA 3LGPA 1SATA 1Z3JA 4JP4A 2MLSA 2WO9A 1R1JA 3EHXA 4PKWA 1QJIA 1ZXVA 2E3XA 2MZEA 3L0TA 5CXAA 1DMTA 1CK7A 2ERQA 2MZIA 966CA 1YOUA 4JPAA 3B2ZA 5BOYA 1ZVXA 3CKIA 1XFWA 1SLMA 4PKRA 1R55A 1G4KA 2OI0A 3EDZA 2E2DA 2OZRA 3LK8A 2W15A 4JA1A 4WZVA 5D1TA 1KUFA 1J7NA 3HBVP 3KEJA 4IJOA 4GF1A 1CGEA 3G5CA 1C3IA 1K7QA 2OVZA 5I12A 1FBLA 1UTTA 4G9LA 1SMPA 2OW0A 1B8YA 2X3AA 1QIBA 1I1IP 5D3CA 5I0LA 1QJJA 1G49A 2I47A 5D1SA 3O64A 1GE5A 1C8TA 3LILA 1JH1A 3EDGA 2AGMA 3S6LA 2YO1A 1Y8JA 3UVCA 2DW1A 3ULTA 1GKDA 1B3DA 1ZTQA 3VTGA 3TSKA 1Y93A 1JK3A 1A85A 3DWBA 3K7NA 1SLNA 2W0DA 4GQLA 1O0TA 1HV5A 3ZXHA 1EB6A 3WV1A 1ATLA 1BUDA 2ZJ7A 2X3BA 2QUAA 1CAQA 3L0VA 2W12A 3KRYA 2MLRA 2J83A 1BKCE 1PWVA 1D8FA 2N8RA 5CUHA 3AYUA 4H2EA 3E8RA 5I43A 456CA 2DDYA 1CGFA 2XS3A 2FV5A 3KHIA 1QICA 1ROSA 1HFSA 5CVWA 5BPAA 3Q2GA 4A7BA 3EDHA 1ND1A 2OW9A 2K2GA 1XFVA 3MA2A 5JMYA 1OS9A 2V4BA 1S4BP 4AIGA 1H71P 1GXDA 1JJ9A 4R3VA 1JKYA 1XFUA 4CTHA 2K9CA 1HOVA 2JT6A 1KBCA 4WK7A 1YP1A 3F17A 1YCMA 2PJTA 2DDFA 1OMJA 1YQYA 1A86A 3EDIA 5CZMA 2Z2DA 1KUGA 2EROA 2OVXA 2CLTA 4DF9A 1Y0VA 3AIGA 1FLSA 3P24A 1GKCA 1R54A 1WNIA 3N2VA 3LUMA 1JIZA 3DSLA 2YB9A 5H8XA 1SRPA 4DV8A 3HB2P 4XCTA 3DPFA 3KMCA 1EAKA 5L79A 1QIAA 2TCLA 3DL1A 2ZJ6A 3A6ZA 5L7FA 2JSDA 2OW2A 3I7IA 3N2UA 4WF6A 4H3XA 3HDAP 3P1VA 1JANA 3RTTA 4Q1LA 3OHLA 1CGLA 2Z8ZA 1PWWA 4H30A 4L6TA 3EWJA 1QUAA 1O0QA 2W14A 4HMAA 1KAPP 2O3EA 4ZR5A 4HX3A 2HU6A 2QUBA 4GUYA 4DPEA 4WKIA 3A70A 1RM8A 2OY4A 3F19A 1MMBA 2D1OA 1GE7A 3HDBA 3LIKA 830CA 1GO8P 1MMQA 1XFXA 3KECA 1EUBA 1C7KA 2JNPA 1IACA 3Q2HA 1Q3AA 3WV3A 4FVLA 5BOTA 2XS4A 3HYGA 1MNCA 1DTHA 4GWNA 1OS2A 3V96B 1PWPA 2J0TA 5I3MA 2AYKA 1AKLA 3KMEA 3USNA 4AYKA 3LJTA 3LEAA 4XM8A 4XM7A 1K7GA 5B5PA 1XUDA 4H1QA 2XQHA 2OXWA 3LAAA 1PWQA 2DW2A 3VI1A 4JQGA 5LABA 1IADA 2O36A 3GBOA 3WP8A 1D8MA 1XFYA 4H76A 4A3WA 4DD8A 2YIGA 1CXVA 2FV9A 3B8ZA 4GR8A 3I7GA 4FXQA 1HFCA 4WKEA 2ML2A 4XBHA 1GE6A 4GR3A 4ON1A 2WO8A 3LE9A 3ZUKA 1XFZA 1RMZA 1AF0A 1D7XA 1CQRA 2L0RA 2Y6DA 1G12A 5B5OA 2KRJA 4I35A 3LUNA 3NX7A 3LJGA 1BKCA 4GR0A 4H84A 1OM6A 1GO7P 1UMTA 1JIWP 2CKIA 4QKZA 1BQQM 3HY7A 1IAAA 2ZVDA 3ELMA 2Z8XA 2DW0A 1ZXCA 4PKUA 3DPEA 3DNGA 1I76A 3B92A 3F15A 1OM8A 1MMPA 4H49A 1IAEA 2WOAA 4FU4A 4I03A 2QPJA 4JIJA 1HTDA 3EHYA 4FXYP 1BQOA 2MZHA 3F16A 3LQBA 5D1UA 3AYKA 1BZSA 3G42A 1UMSA 2W13A 3KWVC 4PKVA 2Y6CA 3TVCA 1ZP5A 3F1AA 3NTNA 1D5JA 4L19A 1FM1A 1XUCA 1BM6A 4PKTA 1BUVM 2X3CA 3U1RA 1UTZA 4H82A 1BIWA 5CXLA 1XURA 2ERPA 1K7IA 3SHIA 3LQ0A 1IABA 3HBUP 3HY9A 3LA9A 4ILWD 4AXQA 3TS4A 1I73A 4PKSA 4AUOA 1BKCI 1USNA 1L6JA 2JT5A 4IN9A 1HY7A 2USNA 3O2XA 2POJA 5I4OA 3LMCA 4IUWA 5D7WA 1SU3A 1MMRA 5D2BA 2OY2A 4EFSA 3KEKA 3ZVSA 4XM6A 2RJPA 1JAOA 1JAPA 1P9HA 5I2ZA 1OO9A 1G05A 4PKQA 4J4MA 1BSWA 3K7LA 1IAGA 2OXUA 3F18A 3LJZA 3RTSA 4G0DA 3TT4A 3WV2A 1OM7A 2AIGP 2D1NA 2OXZA 1KUKA 2SRTA 1CIZA 3BA0A 1KUHA 1JAQA 1G9KA 1R1HA 2YO0A 2JIHA 1KUIA 2OW1A 1ASTA 3OHOA 2RJQA 1ZS0A 3LKAA 1AYKA 3LIRA 1R1IA 2X7MA
chains in the Genus database with same CATH superfamily
4L63A 1PWUA 4DT5A 1UEAA 4GWMA 2A8HA 3DTKA 3LGPA 1SATA 1Z3JA 4JP4A 2MLSA 2WO9A 1R1JA 3EHXA 4PKWA 1QJIA 1ZXVA 2E3XA 2MZEA 3L0TA 5CXAA 1DMTA 1CK7A 2ERQA 2MZIA 966CA 1YOUA 4JPAA 3B2ZA 5BOYA 1ZVXA 3CKIA 1XFWA 1SLMA 4PKRA 1R55A 1G4KA 2OI0A 3EDZA 2E2DA 2OZRA 3LK8A 2W15A 4JA1A 4WZVA 5D1TA 1KUFA 1J7NA 3HBVP 3KEJA 4IJOA 4GF1A 1CGEA 3G5CA 1C3IA 1K7QA 2OVZA 5I12A 1FBLA 1UTTA 4G9LA 1SMPA 2OW0A 1B8YA 2X3AA 1QIBA 1I1IP 5D3CA 5I0LA 1QJJA 1G49A 2I47A 5D1SA 3O64A 1GE5A 1C8TA 3LILA 1JH1A 3EDGA 2AGMA 3S6LA 2YO1A 1Y8JA 3UVCA 2DW1A 3ULTA 1GKDA 1B3DA 1ZTQA 1OZ9A 3VTGA 3TSKA 1Y93A 1JK3A 1A85A 3DWBA 3K7NA 1SLNA 2W0DA 4GQLA 1O0TA 1HV5A 3ZXHA 1EB6A 3WV1A 1ATLA 1BUDA 2ZJ7A 2X3BA 2QUAA 1CAQA 3L0VA 2W12A 3KRYA 2MLRA 2J83A 1BKCE 1PWVA 1D8FA 2N8RA 5CUHA 3AYUA 4H2EA 3E8RA 5I43A 456CA 2DDYA 1CGFA 2XS3A 2FV5A 3KHIA 1QICA 1ROSA 1HFSA 5CVWA 5BPAA 3Q2GA 4A7BA 3EDHA 1ND1A 2OW9A 2K2GA 1XFVA 3MA2A 5JMYA 1OS9A 2V4BA 1S4BP 4AIGA 1H71P 1GXDA 1JJ9A 4R3VA 1JKYA 1XFUA 4CTHA 2K9CA 1HOVA 2JT6A 1KBCA 4WK7A 1YP1A 3F17A 1YCMA 1XM5A 2PJTA 2DDFA 1OMJA 1YQYA 1A86A 3EDIA 5CZMA 2Z2DA 1KUGA 2EROA 2OVXA 2CLTA 4DF9A 1Y0VA 3AIGA 1FLSA 3P24A 1GKCA 1R54A 1WNIA 3N2VA 3LUMA 1JIZA 3DSLA 2YB9A 5H8XA 1SRPA 4DV8A 3HB2P 4XCTA 3DPFA 3KMCA 1EAKA 5L79A 1QIAA 2TCLA 3DL1A 2ZJ6A 3A6ZA 5L7FA 2JSDA 2OW2A 3I7IA 3N2UA 4WF6A 4H3XA 3HDAP 3P1VA 1JANA 3RTTA 4Q1LA 3OHLA 1CGLA 2Z8ZA 1PWWA 4H30A 4L6TA 3EWJA 1QUAA 1O0QA 2W14A 4HMAA 1KAPP 2O3EA 4ZR5A 4HX3A 2HU6A 2QUBA 4GUYA 4DPEA 4WKIA 3A70A 1RM8A 2OY4A 3F19A 1MMBA 2D1OA 1GE7A 3HDBA 3LIKA 830CA 1GO8P 1MMQA 1XFXA 3KECA 1EUBA 1C7KA 2JNPA 1IACA 3Q2HA 1Q3AA 3WV3A 4FVLA 5BOTA 2XS4A 3HYGA 1MNCA 1DTHA 4GWNA 1OS2A 3V96B 1PWPA 2J0TA 5I3MA 2AYKA 1AKLA 3KMEA 1XAXA 3USNA 4AYKA 3LJTA 3LEAA 4XM8A 4XM7A 1K7GA 5B5PA 1XUDA 4H1QA 2XQHA 2OXWA 3LAAA 1PWQA 1TVIA 2DW2A 3VI1A 4JQGA 5LABA 1IADA 2O36A 3GBOA 3WP8A 1D8MA 1XFYA 4H76A 4A3WA 4DD8A 2YIGA 1CXVA 2FV9A 3B8ZA 4GR8A 3I7GA 4FXQA 1HFCA 4WKEA 2ML2A 4XBHA 1GE6A 4GR3A 4ON1A 2WO8A 3LE9A 3ZUKA 1XFZA 1RMZA 1AF0A 1D7XA 1CQRA 2L0RA 2Y6DA 1G12A 5B5OA 2KRJA 4I35A 3LUNA 3NX7A 3LJGA 1BKCA 4GR0A 4H84A 1OM6A 1GO7P 1UMTA 1JIWP 2CKIA 4QKZA 1BQQM 3HY7A 1IAAA 2ZVDA 3ELMA 2Z8XA 2DW0A 1ZXCA 4PKUA 3DPEA 3DNGA 1I76A 3B92A 3F15A 1OM8A 1MMPA 4H49A 1IAEA 2WOAA 4FU4A 4I03A 2QPJA 4JIJA 1HTDA 3EHYA 4FXYP 1BQOA 2MZHA 3F16A 3LQBA 5D1UA 3AYKA 1BZSA 3G42A 1UMSA 4L7AA 2W13A 3KWVC 4PKVA 2Y6CA 3TVCA 1ZP5A 3F1AA 3NTNA 1D5JA 4L19A 1FM1A 1XUCA 1BM6A 4PKTA 1BUVM 2X3CA 3U1RA 1UTZA 4H82A 1BIWA 5CXLA 1XURA 2ERPA 1K7IA 3SHIA 3LQ0A 1IABA 3HBUP 3HY9A 3LA9A 4ILWD 4AXQA 3TS4A 1I73A 4PKSA 4AUOA 1BKCI 1USNA 1L6JA 2JT5A 4IN9A 1HY7A 2USNA 3O2XA 2POJA 5I4OA 3LMCA 4IUWA 5D7WA 1SU3A 1MMRA 5D2BA 2OY2A 4EFSA 3KEKA 3ZVSA 4XM6A 2RJPA 1JAOA 1JAPA 1P9HA 5I2ZA 1OO9A 1G05A 4PKQA 4J4MA 1BSWA 3K7LA 1IAGA 2OXUA 3F18A 3LJZA 3DTEA 3RTSA 4G0DA 3TT4A 3WV2A 2YUFA 1OM7A 2AIGP 2D1NA 2OXZA 3DTIA 1KUKA 2SRTA 1CIZA 3BA0A 1KUHA 1JAQA 1G9KA 1R1HA 2YO0A 2JIHA 1KUIA 2OW1A 1ASTA 3OHOA 2RJQA 1ZS0A 3LKAA 1AYKA 3LIRA 1R1IA 2X7MA
chains in the Genus database with same CATH topology
4L63A 1PWUA 1UEAA 4GWMA 2A8HA 3DTKA 3LGPA 1SATA 1Z3JA 4JP4A 2MLSA 2WO9A 1R1JA 3EHXA 4PKWA 1QJIA 1ZXVA 2E3XA 2MZEA 3L0TA 5CXAA 1DMTA 1CK7A 2ERQA 2MZIA 966CA 1YOUA 4JPAA 3B2ZA 5BOYA 1ZVXA 3CKIA 1XFWA 1SLMA 4PKRA 1R55A 1G4KA 2OI0A 3EDZA 2E2DA 2OZRA 3LK8A 2W15A 4JA1A 4WZVA 5D1TA 1KUFA 1J7NA 3HBVP 3KEJA 4IJOA 4GF1A 1CGEA 3G5CA 1C3IA 1K7QA 2OVZA 5I12A 1FBLA 1UTTA 4G9LA 1SMPA 2OW0A 1B8YA 2X3AA 1QIBA 1I1IP 5D3CA 5I0LA 1QJJA 1G49A 2I47A 5D1SA 3O64A 1GE5A 1C8TA 3LILA 1JH1A 3EDGA 2AGMA 3S6LA 2YO1A 1Y8JA 3UVCA 2DW1A 3ULTA 1GKDA 1B3DA 1ZTQA 3VTGA 3TSKA 1Y93A 1JK3A 1A85A 3DWBA 3K7NA 1SLNA 2W0DA 4GQLA 1O0TA 1HV5A 3ZXHA 1EB6A 3WV1A 1ATLA 1BUDA 2ZJ7A 2X3BA 2QUAA 1CAQA 3L0VA 2W12A 3KRYA 2MLRA 2J83A 1BKCE 1PWVA 1D8FA 2N8RA 5CUHA 3AYUA 4H2EA 3E8RA 5I43A 456CA 2DDYA 1CGFA 2XS3A 2FV5A 3KHIA 1QICA 1ROSA 1HFSA 5CVWA 5BPAA 3Q2GA 4A7BA 3EDHA 1ND1A 2OW9A 2K2GA 1XFVA 3MA2A 5JMYA 1OS9A 2V4BA 1S4BP 4AIGA 1H71P 1GXDA 1JJ9A 4R3VA 1JKYA 1XFUA 4CTHA 2K9CA 1HOVA 2JT6A 1KBCA 4WK7A 1YP1A 3F17A 1YCMA 2PJTA 2DDFA 1OMJA 1YQYA 1A86A 3EDIA 5CZMA 2Z2DA 1KUGA 2EROA 2OVXA 2CLTA 4DF9A 1Y0VA 3AIGA 1FLSA 3P24A 1GKCA 1R54A 1WNIA 3N2VA 3LUMA 1JIZA 3DSLA 2YB9A 5H8XA 1SRPA 4DV8A 3HB2P 4XCTA 3DPFA 3KMCA 1EAKA 5L79A 1QIAA 2TCLA 3DL1A 2ZJ6A 3A6ZA 5L7FA 2JSDA 2OW2A 3I7IA 3N2UA 4WF6A 4H3XA 3HDAP 3P1VA 1JANA 3RTTA 4Q1LA 3OHLA 1CGLA 2Z8ZA 1PWWA 4H30A 4L6TA 3EWJA 1QUAA 1O0QA 2W14A 4HMAA 1KAPP 2O3EA 4ZR5A 4HX3A 2HU6A 2QUBA 4GUYA 4DPEA 4WKIA 3A70A 1RM8A 2OY4A 3F19A 1MMBA 2D1OA 1GE7A 3HDBA 3LIKA 830CA 1GO8P 1MMQA 1XFXA 3KECA 1EUBA 1C7KA 2JNPA 1IACA 3Q2HA 1Q3AA 3WV3A 4FVLA 5BOTA 2XS4A 3HYGA 1MNCA 1DTHA 4GWNA 1OS2A 3V96B 1PWPA 2J0TA 5I3MA 2AYKA 1AKLA 3KMEA 3USNA 4AYKA 3LJTA 3LEAA 4XM8A 4XM7A 1K7GA 5B5PA 1XUDA 4H1QA 2XQHA 2OXWA 3LAAA 1PWQA 2DW2A 3VI1A 4JQGA 5LABA 1IADA 2O36A 3GBOA 3WP8A 1D8MA 1XFYA 4H76A 4A3WA 4DD8A 2YIGA 1CXVA 2FV9A 3B8ZA 4GR8A 3I7GA 4FXQA 1HFCA 4WKEA 2ML2A 4XBHA 1GE6A 4GR3A 4ON1A 2WO8A 3LE9A 3ZUKA 1XFZA 1RMZA 1AF0A 1D7XA 1CQRA 2L0RA 2Y6DA 1G12A 5B5OA 2KRJA 4I35A 3LUNA 3NX7A 3LJGA 1BKCA 4GR0A 4H84A 1OM6A 1GO7P 1UMTA 1JIWP 2CKIA 4QKZA 1BQQM 3HY7A 1IAAA 2ZVDA 3ELMA 2Z8XA 2DW0A 1ZXCA 4PKUA 3DPEA 3DNGA 1I76A 3B92A 3F15A 1OM8A 1MMPA 4H49A 1IAEA 2WOAA 4FU4A 4I03A 2QPJA 4JIJA 1HTDA 3EHYA 4FXYP 1BQOA 2MZHA 3F16A 3LQBA 5D1UA 3AYKA 1BZSA 3G42A 1UMSA 4L7AA 2W13A 3KWVC 4PKVA 2Y6CA 3TVCA 1ZP5A 3F1AA 3NTNA 1D5JA 4L19A 1FM1A 1XUCA 1BM6A 4PKTA 1BUVM 2X3CA 3U1RA 1UTZA 4H82A 1BIWA 5CXLA 1XURA 2ERPA 1K7IA 3SHIA 3LQ0A 1IABA 3HBUP 3HY9A 3LA9A 4ILWD 4AXQA 3TS4A 1I73A 4PKSA 4AUOA 1BKCI 1USNA 1L6JA 2JT5A 4IN9A 1HY7A 2USNA 3O2XA 2POJA 5I4OA 3LMCA 4IUWA 5D7WA 1SU3A 1MMRA 5D2BA 2OY2A 4EFSA 3KEKA 3ZVSA 4XM6A 2RJPA 1JAOA 1JAPA 1P9HA 5I2ZA 1OO9A 1G05A 4PKQA 4J4MA 1BSWA 3K7LA 1IAGA 2OXUA 3F18A 3LJZA 3DTEA 3RTSA 4G0DA 3TT4A 3WV2A 2YUFA 1OM7A 2AIGP 2D1NA 2OXZA 3DTIA 1KUKA 2SRTA 1CIZA 3BA0A 1KUHA 1JAQA 1G9KA 1R1HA 2YO0A 2JIHA 1KUIA 2OW1A 1ASTA 3OHOA 2RJQA 1ZS0A 3LKAA 1AYKA 3LIRA 1R1IA 2X7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L63 A;  1PWU A;  1UEA A;  4GWM A;  2A8H A;  3LGP A;  1SAT A;  1Z3J A;  4JP4 A;  2MLS A;  2WO9 A;  1R1J A;  3EHX A;  4PKW A;  1QJI A;  1ZXV A;  2E3X A;  2MZE A;  3L0T A;  5CXA A;  1DMT A;  1CK7 A;  2ERQ A;  2MZI A;  966C A;  1YOU A;  4JPA A;  3B2Z A;  5BOY A;  1ZVX A;  3CKI A;  1XFW A;  1SLM A;  4PKR A;  1R55 A;  1G4K A;  2OI0 A;  3EDZ A;  2E2D A;  2OZR A;  3LK8 A;  2W15 A;  4JA1 A;  4WZV A;  5D1T A;  1KUF A;  1J7N A;  3HBV P;  3KEJ A;  4IJO A;  4GF1 A;  1CGE A;  3G5C A;  1C3I A;  1K7Q A;  2OVZ A;  5I12 A;  1FBL A;  1UTT A;  4G9L A;  1SMP A;  2OW0 A;  1B8Y A;  2X3A A;  1QIB A;  1I1I P;  5D3C A;  5I0L A;  1QJJ A;  1G49 A;  2I47 A;  5D1S A;  3O64 A;  1GE5 A;  1C8T A;  3LIL A;  1JH1 A;  3EDG A;  2AGM A;  3S6L A;  2YO1 A;  1Y8J A;  3UVC A;  2DW1 A;  3ULT A;  1GKD A;  1B3D A;  1ZTQ A;  3VTG A;  3TSK A;  1Y93 A;  1JK3 A;  1A85 A;  3DWB A;  3K7N A;  1SLN A;  2W0D A;  4GQL A;  1O0T A;  1HV5 A;  3ZXH A;  1EB6 A;  3WV1 A;  1ATL A;  1BUD A;  2ZJ7 A;  2X3B A;  2QUA A;  1CAQ A;  3L0V A;  2W12 A;  3KRY A;  2MLR A;  2J83 A;  1BKC E;  1PWV A;  1D8F A;  2N8R A;  5CUH A;  3AYU A;  4H2E A;  3E8R A;  5I43 A;  456C A;  2DDY A;  1CGF A;  2XS3 A;  2FV5 A;  3KHI A;  1QIC A;  1ROS A;  1HFS A;  5CVW A;  5BPA A;  3Q2G A;  4A7B A;  3EDH A;  1ND1 A;  2OW9 A;  2K2G A;  1XFV A;  3MA2 A;  5JMY A;  1OS9 A;  2V4B A;  1S4B P;  4AIG A;  1H71 P;  1GXD A;  1JJ9 A;  4R3V A;  1JKY A;  1XFU A;  4CTH A;  2K9C A;  1HOV A;  2JT6 A;  1KBC A;  4WK7 A;  1YP1 A;  3F17 A;  1YCM A;  2PJT A;  2DDF A;  1OMJ A;  1YQY A;  1A86 A;  3EDI A;  5CZM A;  2Z2D A;  1KUG A;  2ERO A;  2OVX A;  2CLT A;  4DF9 A;  1Y0V A;  3AIG A;  1FLS A;  3P24 A;  1GKC A;  1R54 A;  1WNI A;  3N2V A;  3LUM A;  1JIZ A;  3DSL A;  2YB9 A;  5H8X A;  1SRP A;  4DV8 A;  3HB2 P;  4XCT A;  3DPF A;  3KMC A;  1EAK A;  5L79 A;  1QIA A;  2TCL A;  3DL1 A;  2ZJ6 A;  3A6Z A;  5L7F A;  2JSD A;  2OW2 A;  3I7I A;  3N2U A;  4WF6 A;  4H3X A;  3HDA P;  3P1V A;  1JAN A;  3RTT A;  4Q1L A;  3OHL A;  1CGL A;  2Z8Z A;  1PWW A;  4H30 A;  4L6T A;  3EWJ A;  1QUA A;  1O0Q A;  2W14 A;  4HMA A;  1KAP P;  2O3E A;  4ZR5 A;  4HX3 A;  2HU6 A;  2QUB A;  4GUY A;  4DPE A;  4WKI A;  3A70 A;  1RM8 A;  2OY4 A;  3F19 A;  1MMB A;  2D1O A;  1GE7 A;  3HDB A;  3LIK A;  830C A;  1GO8 P;  1MMQ A;  1XFX A;  3KEC A;  1EUB A;  1C7K A;  2JNP A;  1IAC A;  3Q2H A;  1Q3A A;  3WV3 A;  4FVL A;  5BOT A;  2XS4 A;  3HYG A;  1MNC A;  1DTH A;  4GWN A;  1OS2 A;  3V96 B;  1PWP A;  2J0T A;  5I3M A;  2AYK A;  1AKL A;  3KME A;  3USN A;  4AYK A;  3LJT A;  3LEA A;  4XM8 A;  4XM7 A;  1K7G A;  5B5P A;  1XUD A;  4H1Q A;  2XQH A;  2OXW A;  3LAA A;  1PWQ A;  2DW2 A;  3VI1 A;  4JQG A;  5LAB A;  1IAD A;  2O36 A;  3GBO A;  3WP8 A;  1D8M A;  1XFY A;  4H76 A;  4A3W A;  4DD8 A;  2YIG A;  1CXV A;  2FV9 A;  3B8Z A;  4GR8 A;  3I7G A;  4FXQ A;  1HFC A;  4WKE A;  2ML2 A;  4XBH A;  1GE6 A;  4GR3 A;  4ON1 A;  2WO8 A;  3LE9 A;  3ZUK A;  1XFZ A;  1RMZ A;  1AF0 A;  1D7X A;  1CQR A;  2L0R A;  2Y6D A;  1G12 A;  5B5O A;  2KRJ A;  4I35 A;  3LUN A;  3NX7 A;  3LJG A;  1BKC A;  4GR0 A;  4H84 A;  1OM6 A;  1GO7 P;  1UMT A;  1JIW P;  2CKI A;  4QKZ A;  1BQQ M;  3HY7 A;  1IAA A;  2ZVD A;  3ELM A;  2Z8X A;  2DW0 A;  1ZXC A;  4PKU A;  3DPE A;  3DNG A;  1I76 A;  3B92 A;  3F15 A;  1OM8 A;  1MMP A;  4H49 A;  1IAE A;  2WOA A;  4FU4 A;  4I03 A;  2QPJ A;  4JIJ A;  1HTD A;  3EHY A;  4FXY P;  1BQO A;  2MZH A;  3F16 A;  3LQB A;  5D1U A;  3AYK A;  1BZS A;  3G42 A;  1UMS A;  2W13 A;  3KWV C;  4PKV A;  2Y6C A;  3TVC A;  1ZP5 A;  3F1A A;  3NTN A;  1D5J A;  4L19 A;  1FM1 A;  1XUC A;  1BM6 A;  4PKT A;  1BUV M;  2X3C A;  3U1R A;  1UTZ A;  4H82 A;  1BIW A;  5CXL A;  1XUR A;  2ERP A;  1K7I A;  3SHI A;  3LQ0 A;  1IAB A;  3HBU P;  3HY9 A;  3LA9 A;  4ILW D;  4AXQ A;  3TS4 A;  1I73 A;  4PKS A;  4AUO A;  1BKC I;  1USN A;  1L6J A;  2JT5 A;  4IN9 A;  1HY7 A;  2USN A;  3O2X A;  2POJ A;  5I4O A;  3LMC A;  4IUW A;  5D7W A;  1SU3 A;  1MMR A;  5D2B A;  2OY2 A;  4EFS A;  3KEK A;  3ZVS A;  4XM6 A;  2RJP A;  1JAO A;  1JAP A;  1P9H A;  5I2Z A;  1OO9 A;  1G05 A;  4PKQ A;  4J4M A;  1BSW A;  3K7L A;  1IAG A;  2OXU A;  3F18 A;  3LJZ A;  3RTS A;  4G0D A;  3TT4 A;  3WV2 A;  1OM7 A;  2AIG P;  2D1N A;  2OXZ A;  1KUK A;  2SRT A;  1CIZ A;  3BA0 A;  1KUH A;  1JAQ A;  1G9K A;  1R1H A;  2YO0 A;  2JIH A;  1KUI A;  2OW1 A;  1AST A;  3OHO A;  2RJQ A;  1ZS0 A;  3LKA A;  1AYK A;  3LIR A;  1R1I A;  2X7M A; 
#chains in the Genus database with same CATH topology
 4L63 A;  1PWU A;  4DT5 A;  1UEA A;  4GWM A;  2A8H A;  3DTK A;  3LGP A;  1SAT A;  1Z3J A;  4JP4 A;  2MLS A;  2WO9 A;  1R1J A;  3EHX A;  4PKW A;  1QJI A;  1ZXV A;  2E3X A;  2MZE A;  3L0T A;  5CXA A;  1DMT A;  1CK7 A;  2ERQ A;  2MZI A;  966C A;  1YOU A;  4JPA A;  3B2Z A;  5BOY A;  1ZVX A;  3CKI A;  1XFW A;  1SLM A;  4PKR A;  1R55 A;  1G4K A;  2OI0 A;  3EDZ A;  2E2D A;  2OZR A;  3LK8 A;  2W15 A;  4JA1 A;  4WZV A;  5D1T A;  1KUF A;  1J7N A;  3HBV P;  3KEJ A;  4IJO A;  4GF1 A;  1CGE A;  3G5C A;  1C3I A;  1K7Q A;  2OVZ A;  5I12 A;  1FBL A;  1UTT A;  4G9L A;  1SMP A;  2OW0 A;  1B8Y A;  2X3A A;  1QIB A;  1I1I P;  5D3C A;  5I0L A;  1QJJ A;  1G49 A;  2I47 A;  5D1S A;  3O64 A;  1GE5 A;  1C8T A;  3LIL A;  1JH1 A;  3EDG A;  2AGM A;  3S6L A;  2YO1 A;  1Y8J A;  3UVC A;  2DW1 A;  3ULT A;  1GKD A;  1B3D A;  1ZTQ A;  1OZ9 A;  3VTG A;  3TSK A;  1Y93 A;  1JK3 A;  1A85 A;  3DWB A;  3K7N A;  1SLN A;  2W0D A;  4GQL A;  1O0T A;  1HV5 A;  3ZXH A;  1EB6 A;  3WV1 A;  1ATL A;  1BUD A;  2ZJ7 A;  2X3B A;  2QUA A;  1CAQ A;  3L0V A;  2W12 A;  3KRY A;  2MLR A;  2J83 A;  1BKC E;  1PWV A;  1D8F A;  2N8R A;  5CUH A;  3AYU A;  4H2E A;  3E8R A;  5I43 A;  456C A;  2DDY A;  1CGF A;  2XS3 A;  2FV5 A;  3KHI A;  1QIC A;  1ROS A;  1HFS A;  5CVW A;  5BPA A;  3Q2G A;  4A7B A;  3EDH A;  1ND1 A;  2OW9 A;  2K2G A;  1XFV A;  3MA2 A;  5JMY A;  1OS9 A;  2V4B A;  1S4B P;  4AIG A;  1H71 P;  1GXD A;  1JJ9 A;  4R3V A;  1JKY A;  1XFU A;  4CTH A;  2K9C A;  1HOV A;  2JT6 A;  1KBC A;  4WK7 A;  1YP1 A;  3F17 A;  1YCM A;  1XM5 A;  2PJT A;  2DDF A;  1OMJ A;  1YQY A;  1A86 A;  3EDI A;  5CZM A;  2Z2D A;  1KUG A;  2ERO A;  2OVX A;  2CLT A;  4DF9 A;  1Y0V A;  3AIG A;  1FLS A;  3P24 A;  1GKC A;  1R54 A;  1WNI A;  3N2V A;  3LUM A;  1JIZ A;  3DSL A;  2YB9 A;  5H8X A;  1SRP A;  4DV8 A;  3HB2 P;  4XCT A;  3DPF A;  3KMC A;  1EAK A;  5L79 A;  1QIA A;  2TCL A;  3DL1 A;  2ZJ6 A;  3A6Z A;  5L7F A;  2JSD A;  2OW2 A;  3I7I A;  3N2U A;  4WF6 A;  4H3X A;  3HDA P;  3P1V A;  1JAN A;  3RTT A;  4Q1L A;  3OHL A;  1CGL A;  2Z8Z A;  1PWW A;  4H30 A;  4L6T A;  3EWJ A;  1QUA A;  1O0Q A;  2W14 A;  4HMA A;  1KAP P;  2O3E A;  4ZR5 A;  4HX3 A;  2HU6 A;  2QUB A;  4GUY A;  4DPE A;  4WKI A;  3A70 A;  1RM8 A;  2OY4 A;  3F19 A;  1MMB A;  2D1O A;  1GE7 A;  3HDB A;  3LIK A;  830C A;  1GO8 P;  1MMQ A;  1XFX A;  3KEC A;  1EUB A;  1C7K A;  2JNP A;  1IAC A;  3Q2H A;  1Q3A A;  3WV3 A;  4FVL A;  5BOT A;  2XS4 A;  3HYG A;  1MNC A;  1DTH A;  4GWN A;  1OS2 A;  3V96 B;  1PWP A;  2J0T A;  5I3M A;  2AYK A;  1AKL A;  3KME A;  1XAX A;  3USN A;  4AYK A;  3LJT A;  3LEA A;  4XM8 A;  4XM7 A;  1K7G A;  5B5P A;  1XUD A;  4H1Q A;  2XQH A;  2OXW A;  3LAA A;  1PWQ A;  1TVI A;  2DW2 A;  3VI1 A;  4JQG A;  5LAB A;  1IAD A;  2O36 A;  3GBO A;  3WP8 A;  1D8M A;  1XFY A;  4H76 A;  4A3W A;  4DD8 A;  2YIG A;  1CXV A;  2FV9 A;  3B8Z A;  4GR8 A;  3I7G A;  4FXQ A;  1HFC A;  4WKE A;  2ML2 A;  4XBH A;  1GE6 A;  4GR3 A;  4ON1 A;  2WO8 A;  3LE9 A;  3ZUK A;  1XFZ A;  1RMZ A;  1AF0 A;  1D7X A;  1CQR A;  2L0R A;  2Y6D A;  1G12 A;  5B5O A;  2KRJ A;  4I35 A;  3LUN A;  3NX7 A;  3LJG A;  1BKC A;  4GR0 A;  4H84 A;  1OM6 A;  1GO7 P;  1UMT A;  1JIW P;  2CKI A;  4QKZ A;  1BQQ M;  3HY7 A;  1IAA A;  2ZVD A;  3ELM A;  2Z8X A;  2DW0 A;  1ZXC A;  4PKU A;  3DPE A;  3DNG A;  1I76 A;  3B92 A;  3F15 A;  1OM8 A;  1MMP A;  4H49 A;  1IAE A;  2WOA A;  4FU4 A;  4I03 A;  2QPJ A;  4JIJ A;  1HTD A;  3EHY A;  4FXY P;  1BQO A;  2MZH A;  3F16 A;  3LQB A;  5D1U A;  3AYK A;  1BZS A;  3G42 A;  1UMS A;  4L7A A;  2W13 A;  3KWV C;  4PKV A;  2Y6C A;  3TVC A;  1ZP5 A;  3F1A A;  3NTN A;  1D5J A;  4L19 A;  1FM1 A;  1XUC A;  1BM6 A;  4PKT A;  1BUV M;  2X3C A;  3U1R A;  1UTZ A;  4H82 A;  1BIW A;  5CXL A;  1XUR A;  2ERP A;  1K7I A;  3SHI A;  3LQ0 A;  1IAB A;  3HBU P;  3HY9 A;  3LA9 A;  4ILW D;  4AXQ A;  3TS4 A;  1I73 A;  4PKS A;  4AUO A;  1BKC I;  1USN A;  1L6J A;  2JT5 A;  4IN9 A;  1HY7 A;  2USN A;  3O2X A;  2POJ A;  5I4O A;  3LMC A;  4IUW A;  5D7W A;  1SU3 A;  1MMR A;  5D2B A;  2OY2 A;  4EFS A;  3KEK A;  3ZVS A;  4XM6 A;  2RJP A;  1JAO A;  1JAP A;  1P9H A;  5I2Z A;  1OO9 A;  1G05 A;  4PKQ A;  4J4M A;  1BSW A;  3K7L A;  1IAG A;  2OXU A;  3F18 A;  3LJZ A;  3DTE A;  3RTS A;  4G0D A;  3TT4 A;  3WV2 A;  2YUF A;  1OM7 A;  2AIG P;  2D1N A;  2OXZ A;  3DTI A;  1KUK A;  2SRT A;  1CIZ A;  3BA0 A;  1KUH A;  1JAQ A;  1G9K A;  1R1H A;  2YO0 A;  2JIH A;  1KUI A;  2OW1 A;  1AST A;  3OHO A;  2RJQ A;  1ZS0 A;  3LKA A;  1AYK A;  3LIR A;  1R1I A;  2X7M A; 
#chains in the Genus database with same CATH homology
 4L63 A;  1PWU A;  1UEA A;  4GWM A;  2A8H A;  3DTK A;  3LGP A;  1SAT A;  1Z3J A;  4JP4 A;  2MLS A;  2WO9 A;  1R1J A;  3EHX A;  4PKW A;  1QJI A;  1ZXV A;  2E3X A;  2MZE A;  3L0T A;  5CXA A;  1DMT A;  1CK7 A;  2ERQ A;  2MZI A;  966C A;  1YOU A;  4JPA A;  3B2Z A;  5BOY A;  1ZVX A;  3CKI A;  1XFW A;  1SLM A;  4PKR A;  1R55 A;  1G4K A;  2OI0 A;  3EDZ A;  2E2D A;  2OZR A;  3LK8 A;  2W15 A;  4JA1 A;  4WZV A;  5D1T A;  1KUF A;  1J7N A;  3HBV P;  3KEJ A;  4IJO A;  4GF1 A;  1CGE A;  3G5C A;  1C3I A;  1K7Q A;  2OVZ A;  5I12 A;  1FBL A;  1UTT A;  4G9L A;  1SMP A;  2OW0 A;  1B8Y A;  2X3A A;  1QIB A;  1I1I P;  5D3C A;  5I0L A;  1QJJ A;  1G49 A;  2I47 A;  5D1S A;  3O64 A;  1GE5 A;  1C8T A;  3LIL A;  1JH1 A;  3EDG A;  2AGM A;  3S6L A;  2YO1 A;  1Y8J A;  3UVC A;  2DW1 A;  3ULT A;  1GKD A;  1B3D A;  1ZTQ A;  3VTG A;  3TSK A;  1Y93 A;  1JK3 A;  1A85 A;  3DWB A;  3K7N A;  1SLN A;  2W0D A;  4GQL A;  1O0T A;  1HV5 A;  3ZXH A;  1EB6 A;  3WV1 A;  1ATL A;  1BUD A;  2ZJ7 A;  2X3B A;  2QUA A;  1CAQ A;  3L0V A;  2W12 A;  3KRY A;  2MLR A;  2J83 A;  1BKC E;  1PWV A;  1D8F A;  2N8R A;  5CUH A;  3AYU A;  4H2E A;  3E8R A;  5I43 A;  456C A;  2DDY A;  1CGF A;  2XS3 A;  2FV5 A;  3KHI A;  1QIC A;  1ROS A;  1HFS A;  5CVW A;  5BPA A;  3Q2G A;  4A7B A;  3EDH A;  1ND1 A;  2OW9 A;  2K2G A;  1XFV A;  3MA2 A;  5JMY A;  1OS9 A;  2V4B A;  1S4B P;  4AIG A;  1H71 P;  1GXD A;  1JJ9 A;  4R3V A;  1JKY A;  1XFU A;  4CTH A;  2K9C A;  1HOV A;  2JT6 A;  1KBC A;  4WK7 A;  1YP1 A;  3F17 A;  1YCM A;  2PJT A;  2DDF A;  1OMJ A;  1YQY A;  1A86 A;  3EDI A;  5CZM A;  2Z2D A;  1KUG A;  2ERO A;  2OVX A;  2CLT A;  4DF9 A;  1Y0V A;  3AIG A;  1FLS A;  3P24 A;  1GKC A;  1R54 A;  1WNI A;  3N2V A;  3LUM A;  1JIZ A;  3DSL A;  2YB9 A;  5H8X A;  1SRP A;  4DV8 A;  3HB2 P;  4XCT A;  3DPF A;  3KMC A;  1EAK A;  5L79 A;  1QIA A;  2TCL A;  3DL1 A;  2ZJ6 A;  3A6Z A;  5L7F A;  2JSD A;  2OW2 A;  3I7I A;  3N2U A;  4WF6 A;  4H3X A;  3HDA P;  3P1V A;  1JAN A;  3RTT A;  4Q1L A;  3OHL A;  1CGL A;  2Z8Z A;  1PWW A;  4H30 A;  4L6T A;  3EWJ A;  1QUA A;  1O0Q A;  2W14 A;  4HMA A;  1KAP P;  2O3E A;  4ZR5 A;  4HX3 A;  2HU6 A;  2QUB A;  4GUY A;  4DPE A;  4WKI A;  3A70 A;  1RM8 A;  2OY4 A;  3F19 A;  1MMB A;  2D1O A;  1GE7 A;  3HDB A;  3LIK A;  830C A;  1GO8 P;  1MMQ A;  1XFX A;  3KEC A;  1EUB A;  1C7K A;  2JNP A;  1IAC A;  3Q2H A;  1Q3A A;  3WV3 A;  4FVL A;  5BOT A;  2XS4 A;  3HYG A;  1MNC A;  1DTH A;  4GWN A;  1OS2 A;  3V96 B;  1PWP A;  2J0T A;  5I3M A;  2AYK A;  1AKL A;  3KME A;  3USN A;  4AYK A;  3LJT A;  3LEA A;  4XM8 A;  4XM7 A;  1K7G A;  5B5P A;  1XUD A;  4H1Q A;  2XQH A;  2OXW A;  3LAA A;  1PWQ A;  2DW2 A;  3VI1 A;  4JQG A;  5LAB A;  1IAD A;  2O36 A;  3GBO A;  3WP8 A;  1D8M A;  1XFY A;  4H76 A;  4A3W A;  4DD8 A;  2YIG A;  1CXV A;  2FV9 A;  3B8Z A;  4GR8 A;  3I7G A;  4FXQ A;  1HFC A;  4WKE A;  2ML2 A;  4XBH A;  1GE6 A;  4GR3 A;  4ON1 A;  2WO8 A;  3LE9 A;  3ZUK A;  1XFZ A;  1RMZ A;  1AF0 A;  1D7X A;  1CQR A;  2L0R A;  2Y6D A;  1G12 A;  5B5O A;  2KRJ A;  4I35 A;  3LUN A;  3NX7 A;  3LJG A;  1BKC A;  4GR0 A;  4H84 A;  1OM6 A;  1GO7 P;  1UMT A;  1JIW P;  2CKI A;  4QKZ A;  1BQQ M;  3HY7 A;  1IAA A;  2ZVD A;  3ELM A;  2Z8X A;  2DW0 A;  1ZXC A;  4PKU A;  3DPE A;  3DNG A;  1I76 A;  3B92 A;  3F15 A;  1OM8 A;  1MMP A;  4H49 A;  1IAE A;  2WOA A;  4FU4 A;  4I03 A;  2QPJ A;  4JIJ A;  1HTD A;  3EHY A;  4FXY P;  1BQO A;  2MZH A;  3F16 A;  3LQB A;  5D1U A;  3AYK A;  1BZS A;  3G42 A;  1UMS A;  4L7A A;  2W13 A;  3KWV C;  4PKV A;  2Y6C A;  3TVC A;  1ZP5 A;  3F1A A;  3NTN A;  1D5J A;  4L19 A;  1FM1 A;  1XUC A;  1BM6 A;  4PKT A;  1BUV M;  2X3C A;  3U1R A;  1UTZ A;  4H82 A;  1BIW A;  5CXL A;  1XUR A;  2ERP A;  1K7I A;  3SHI A;  3LQ0 A;  1IAB A;  3HBU P;  3HY9 A;  3LA9 A;  4ILW D;  4AXQ A;  3TS4 A;  1I73 A;  4PKS A;  4AUO A;  1BKC I;  1USN A;  1L6J A;  2JT5 A;  4IN9 A;  1HY7 A;  2USN A;  3O2X A;  2POJ A;  5I4O A;  3LMC A;  4IUW A;  5D7W A;  1SU3 A;  1MMR A;  5D2B A;  2OY2 A;  4EFS A;  3KEK A;  3ZVS A;  4XM6 A;  2RJP A;  1JAO A;  1JAP A;  1P9H A;  5I2Z A;  1OO9 A;  1G05 A;  4PKQ A;  4J4M A;  1BSW A;  3K7L A;  1IAG A;  2OXU A;  3F18 A;  3LJZ A;  3DTE A;  3RTS A;  4G0D A;  3TT4 A;  3WV2 A;  2YUF A;  1OM7 A;  2AIG P;  2D1N A;  2OXZ A;  3DTI A;  1KUK A;  2SRT A;  1CIZ A;  3BA0 A;  1KUH A;  1JAQ A;  1G9K A;  1R1H A;  2YO0 A;  2JIH A;  1KUI A;  2OW1 A;  1AST A;  3OHO A;  2RJQ A;  1ZS0 A;  3LKA A;  1AYK A;  3LIR A;  1R1I A;  2X7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...