3LAAA

Crystal structure of the trimeric autotransporter adhesin head domain bpaa from burkholderia pseudomallei
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
174
structure length
169
Chain Sequence
STSISSITTNTTNLGNSTAAALGGGATYDPATGAISAPSYTTYNANGTTATNTSVGAAIDNINANGIKYFHANSTDPDSVATGTNSVAIGPNAVANVDYSVAIGSGATTSAAVPVASASFGGFAGSAPIGVFSVGAPGAERQITNVAAGRISAASTDAVNGSQLYATNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Haemagglutinin family protein
publication title Structure of a Burkholderia pseudomallei trimeric autotransporter adhesin head.
pubmed doi rcsb
source organism Burkholderia pseudomallei
molecule tags Transport protein
total genus 38
structure length 169
sequence length 174
ec nomenclature
pdb deposition date 2010-01-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.150.10.10 Mainly Beta 2 Solenoid Alkaline Protease, subunit P, domain 1 Serralysin-like metalloprotease, C-terminal 3laaA00
1KAPP 1OM6A 4I35A 3HBVP 3HB2P 2ML2A 2XQHA 3NTNA 1SRPA 2QUAA 5D7WA 3ULTA 3WP8A 2ZVDA 1K7IA 2YO0A 1O0TA 3LAAA 2YO1A 2ZJ7A 3VI1A 1OMJA 2ZJ6A 1K7GA 3HDAP 3HBUP 1P9HA 1O0QA 1SMPA 3LA9A 5CXLA 1OM7A 1GO8P 1OM8A 1K7QA 1AKLA 3A70A 3A6ZA 1SATA 2Z8XA 2QUBA 1AF0A 1H71P 3U1RA 2AGMA 5CVWA 1G9KA 3S6LA 2Z8ZA 1GO7P 1JIWP
chains in the Genus database with same CATH superfamily
1KAPP 1OM6A 4I35A 3HBVP 3HB2P 2ML2A 2XQHA 3NTNA 1SRPA 2QUAA 5D7WA 3ULTA 3WP8A 2ZVDA 1K7IA 2YO0A 1O0TA 3LAAA 2YO1A 2ZJ7A 3VI1A 1OMJA 2ZJ6A 4DT5A 1K7GA 3HDAP 3HBUP 1P9HA 1O0QA 1SMPA 3LA9A 5CXLA 1OM7A 1GO8P 1OM8A 1K7QA 1AKLA 3A70A 3A6ZA 1SATA 2Z8XA 2QUBA 1AF0A 1H71P 3U1RA 2AGMA 5CVWA 1G9KA 3S6LA 2Z8ZA 1GO7P 1JIWP
chains in the Genus database with same CATH topology
1KAPP 1OM6A 4I35A 3HBVP 3HB2P 2ML2A 2XQHA 3NTNA 1SRPA 2QUAA 5D7WA 3ULTA 3WP8A 2ZVDA 1K7IA 2YO0A 1O0TA 3LAAA 2YO1A 2ZJ7A 3VI1A 1OMJA 2ZJ6A 1K7GA 3HDAP 3HBUP 1P9HA 1O0QA 1SMPA 3LA9A 5CXLA 1OM7A 1GO8P 1OM8A 1K7QA 1AKLA 3A70A 3A6ZA 1SATA 2Z8XA 2QUBA 1AF0A 1H71P 3U1RA 2AGMA 5CVWA 1G9KA 3S6LA 2Z8ZA 1GO7P 1JIWP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAP P;  1OM6 A;  4I35 A;  3HBV P;  3HB2 P;  2ML2 A;  2XQH A;  3NTN A;  1SRP A;  2QUA A;  5D7W A;  3ULT A;  3WP8 A;  2ZVD A;  1K7I A;  2YO0 A;  1O0T A;  3LAA A;  2YO1 A;  2ZJ7 A;  3VI1 A;  1OMJ A;  2ZJ6 A;  1K7G A;  3HDA P;  3HBU P;  1P9H A;  1O0Q A;  1SMP A;  3LA9 A;  5CXL A;  1OM7 A;  1GO8 P;  1OM8 A;  1K7Q A;  1AKL A;  3A70 A;  3A6Z A;  1SAT A;  2Z8X A;  2QUB A;  1AF0 A;  1H71 P;  3U1R A;  2AGM A;  5CVW A;  1G9K A;  3S6L A;  2Z8Z A;  1GO7 P;  1JIW P; 
#chains in the Genus database with same CATH topology
 1KAP P;  1OM6 A;  4I35 A;  3HBV P;  3HB2 P;  2ML2 A;  2XQH A;  3NTN A;  1SRP A;  2QUA A;  5D7W A;  3ULT A;  3WP8 A;  2ZVD A;  1K7I A;  2YO0 A;  1O0T A;  3LAA A;  2YO1 A;  2ZJ7 A;  3VI1 A;  1OMJ A;  2ZJ6 A;  4DT5 A;  1K7G A;  3HDA P;  3HBU P;  1P9H A;  1O0Q A;  1SMP A;  3LA9 A;  5CXL A;  1OM7 A;  1GO8 P;  1OM8 A;  1K7Q A;  1AKL A;  3A70 A;  3A6Z A;  1SAT A;  2Z8X A;  2QUB A;  1AF0 A;  1H71 P;  3U1R A;  2AGM A;  5CVW A;  1G9K A;  3S6L A;  2Z8Z A;  1GO7 P;  1JIW P; 
#chains in the Genus database with same CATH homology
 1KAP P;  1OM6 A;  4I35 A;  3HBV P;  3HB2 P;  2ML2 A;  2XQH A;  3NTN A;  1SRP A;  2QUA A;  5D7W A;  3ULT A;  3WP8 A;  2ZVD A;  1K7I A;  2YO0 A;  1O0T A;  3LAA A;  2YO1 A;  2ZJ7 A;  3VI1 A;  1OMJ A;  2ZJ6 A;  1K7G A;  3HDA P;  3HBU P;  1P9H A;  1O0Q A;  1SMP A;  3LA9 A;  5CXL A;  1OM7 A;  1GO8 P;  1OM8 A;  1K7Q A;  1AKL A;  3A70 A;  3A6Z A;  1SAT A;  2Z8X A;  2QUB A;  1AF0 A;  1H71 P;  3U1R A;  2AGM A;  5CVW A;  1G9K A;  3S6L A;  2Z8Z A;  1GO7 P;  1JIW P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...