The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
60
|
sequence length |
259
|
structure length |
239
|
Chain Sequence |
SMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKPSHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPDQTLEILMSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYWTIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQKIEGFKRLDCQSAMFNDYNFVFTSFAK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Role of the sulfonium center in determining the ligand specificity of human s-adenosylmethionine decarboxylase.
pubmed doi rcsb |
molecule tags |
Lyase
|
source organism |
Homo sapiens
|
molecule keywords |
S-adenosylmethionine decarboxylase proenzyme
|
total genus |
60
|
structure length |
239
|
sequence length |
259
|
ec nomenclature |
ec
4.1.1.50: Adenosylmethionine decarboxylase. |
pdb deposition date | 2009-04-10 |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | 4-Layer Sandwich | S-adenosylmethionine decarboxylase | S-adenosylmethionine decarboxylase |
#chains in the Genus database with same CATH superfamily 1I7M A; 5TVO A; 1TLU A; 1I7C A; 1I7B A; 3DZ6 A; 3EP7 A; 3EP9 A; 1JEN A; 1I79 A; 3DZ5 A; 3H0W A; 3EP3 A; 1VR7 A; 3EPB A; 2III A; 3DZ4 A; 3DZ3 A; 3DZ2 A; 3EPA A; 1MHM A; 3DZ7 A; 1JL0 A; 3EP6 A; 3EP8 A; 3EP5 A; 1I72 A; 1TMI A; 3EP4 A; 1MSV A; 3H0V A; #chains in the Genus database with same CATH topology 1I7M A; 5TVO A; 1TLU A; 1I7C A; 1I7B A; 3DZ6 A; 3EP7 A; 3EP9 A; 1JEN A; 1I79 A; 3DZ5 A; 3H0W A; 3EP3 A; 1VR7 A; 3EPB A; 2III A; 3DZ4 A; 3DZ3 A; 3DZ2 A; 3EPA A; 1MHM A; 3DZ7 A; 1JL0 A; 3EP6 A; 3EP8 A; 3EP5 A; 1I72 A; 1TMI A; 3EP4 A; 1MSV A; 3H0V A; #chains in the Genus database with same CATH homology 1I7M B; 1I7M A; 5TVO A; 1TLU A; 1I7C B; 1I7B B; 1I7C A; 3DZ6 B; 1I7B A; 3EP7 B; 3DZ6 A; 3EP7 A; 3EP9 B; 1I79 B; 3DZ5 B; 3H0W B; 1JEN B; 1JEN A; 3EP9 A; 1I79 A; 3DZ5 A; 3H0W A; 3EPB B; 3EP3 B; 3EP3 A; 1VR7 A; 3EPB A; 2III A; 3DZ3 B; 3DZ4 B; 3DZ2 B; 3EPA B; 1MHM B; 3DZ7 B; 3DZ3 A; 3DZ4 A; 3DZ2 A; 3EPA A; 1MHM A; 1JL0 A; 3DZ7 A; 3EP6 B; 3EP8 B; 3EP5 B; 1I72 B; 3EP6 A; 3EP4 B; 3EP8 A; 3EP5 A; 1I72 A; 1TMI A; 3EP4 A; 3H0V B; 1MSV A; 5TVO B; 3H0V A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...