The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
63
|
sequence length |
261
|
structure length |
256
|
Chain Sequence |
SMTKHIHWDGNLSQEGFEIVKGEGGVIVCPTKVGYIIMTSDKKGLERKFEAKKRNRNKPGVVLCGSMEELRALAQLTPEIDAFYQKHWDEDILLGCILPWKAEAYEKLKAYGDGREELMTDIRGTSCFVIKFGVAGEQIAKEMWEKEGRMVYASSANNRGKVEGIGERIESMVDLVIEADDYVASIQPDKTIETRYEQGVMVSMVDKDGKLIPQQGADSRSVEPCPVVIRKGLDIDKIMMHLSDQFNSWNYRQGEY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
The structure of the hypothetical protein smu.1377c from Streptococcus mutans suggests a role in tRNA modification
pubmed doi rcsb |
molecule tags |
Transcription
|
source organism |
Streptococcus mutans
|
molecule keywords |
Putative uncharacterized protein smu.1377c
|
total genus |
63
|
structure length |
256
|
sequence length |
261
|
ec nomenclature | |
pdb deposition date | 2009-12-29 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01300 | Sua5_yciO_yrdC | Telomere recombination |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | DHBP synthase | DHBP synthase |
#chains in the Genus database with same CATH superfamily 3MIO A; 1PVW A; 1KK9 A; 1K4P A; 1K4I A; 1PVY A; 1G57 A; 1K7J A; 1G58 A; 2MX1 A; 4E1B A; 3LS6 A; 1TKU A; 3MK5 A; 1K4L A; 4P6C A; 2RIU A; 4P77 A; 4P8E A; 3L7V A; 4I14 A; 4P6D A; 2RIS A; 3H07 A; 1SNN A; 3MGZ A; 1JCU A; 4P8J A; 1IEZ A; 1HRU A; 2EQA A; 1K49 A; 1TKS A; 3LRJ A; 4P6P A; 1K4O A; 4FFJ A; 3AJE A; 3LQU A; #chains in the Genus database with same CATH topology 3MIO A; 3VEX A; 1PVW A; 1KK9 A; 3VEW A; 1K4P A; 1K4I A; 1PVY A; 3TTF A; 1G57 A; 1K7J A; 3VEN A; 3VF2 A; 3VES A; 3VF4 A; 3TTC A; 1G58 A; 2MX1 A; 3VTH A; 4E1B A; 3LS6 A; 1TKU A; 3TSQ A; 3VET A; 3MK5 A; 1K4L A; 4P6C A; 2RIU A; 4P77 A; 4P8E A; 3L7V A; 4I14 A; 4P6D A; 2RIS A; 3TTD A; 3H07 A; 1SNN A; 3MGZ A; 3TSU A; 3VEO A; 4P8J A; 1JCU A; 3VTI A; 1HRU A; 1IEZ A; 2EQA A; 3VEZ A; 1K49 A; 1TKS A; 3LRJ A; 4P6P A; 1K4O A; 4FFJ A; 3TSP A; 3AJE A; 3LQU A; 3VER A; #chains in the Genus database with same CATH homology 3MIO A; 3VEX A; 1PVW A; 1KK9 A; 3VEW A; 1K4P A; 1K4I A; 1PVY A; 3TTF A; 1G57 A; 1K7J A; 3VEN A; 3VF2 A; 3VES A; 3VF4 A; 3TTC A; 1G58 A; 2MX1 A; 3VTH A; 4E1B A; 3LS6 A; 1TKU A; 3TSQ A; 3VET A; 3MK5 A; 1K4L A; 4P6C A; 2RIU A; 4P77 A; 4P8E A; 3L7V A; 4I14 A; 4P6D A; 2RIS A; 3TTD A; 3H07 A; 1SNN A; 3MGZ A; 3TSU A; 3VEO A; 4P8J A; 1JCU A; 3VTI A; 1HRU A; 1IEZ A; 2EQA A; 3VEZ A; 1K49 A; 1TKS A; 3LRJ A; 4P6P A; 1K4O A; 4FFJ A; 3TSP A; 3AJE A; 3LQU A; 3VER A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...