3TTFA

Crystal structure of e. coli hypf with amp and carbamoyl phosphate
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 218
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttfA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttfA01
3VEWA 3TTCA 3TSPA 3TTFA 3VERA 3TSUA 3VESA 3VF2A 3VENA 3VF4A 3VEXA 3VTHA 3TTDA 3VEZA 3VTIA 3VETA 3TSQA 3VEOA
chains in the Genus database with same CATH superfamily
1C1CA 2VQFK 1T6DA 3HSCA 4FZXC 1JLBA 4DQRA 4CW7B 2ITGA 2OZSA 4KPYA 3EKSA 4TSXA 1VQMN 2HNDA 4IFVA 4WYBA 1ATNA 3NGYA 4K0KK 3PIPL 4AM6A 1KAZA 1VQKN 5JVHL 3BY5A 4CGHA 3M8SA 3OTOK 4OKJA 2HSTA 3WNFA 2G8HA 4KBOA 3SK3A 2VGMA 4I6MB 3MAQA 2DPNA 1WB9A 1RFQA 2LN3A 4CBWA 3T69A 2HHQA 5M1OA 4F3OA 4DQPA 3QNOA 3QERA 3L2RA 2RN2A 1KD1O 1KSPA 3R6MA 4I2QA 1JCEA 3VQ6A 4CZGA 2CGLA 4XIUA 1HNWK 4HWIA 1TGOA 5LJVA 4CE9A 3I0RA 3RMCA 1FW6A 3NVMA 3HVRA 4DR7K 1EETA 1S72N 3HYFA 1KFDA 3T7ZA 3J7YP 3LDNA 1YVNA 4YY3K 3PX6A 5AQWA 1X3MA 3TAFA 5ELZA 3OYMA 4QAGA 4FLVA 4W5QA 4LH5A 2YX6A 3DLGA 1ITGA 5JICA 2YNGA 4WF9L 2UUBK 2KFNA 2O8FB 2A6AA 1IBLK 1BHLA 5KQDA 4JHDA 1U6ZA 3V9UA 3Q7BA 4DF4A 4FSVA 1PAVA 3RSEB 3KVGA 4BC4A 2ASPA 2GUIA 3EL2A 4A62A 3ZIIA 3IUCA 1NMDA 3PX4A 5AQPA 4IJAA 2BKYX 3E9LA 3SMSA 3SZ2A 3NH0A 3IS9A 3GL1A 3DXKA 3U4LA 2Q2RA 2EK0A 4CZEA 1BUPA 4Z9EA 5C2FA 1QQCA 4AHTA 5FDLA 5CHIA 4EP5A 4BE2A 1X3NA 4DQSA 4Z94A 4JD2A 1P90A 1YAGA 4B1VA 2X6SA 2VYPA 5AZIB 5FLXO 4B9QA 1S1XA 3CM6A 2E2OA 2E2PA 3LM9A 2D0PA 4JAXA 4BRIA 4B3OA 4NYFA 4MO4A 4PA1A 4DWIA 1FJGK 4IEIA 3TPQA 4CF2A 3NHGA 3B8AX 2EH1A 1YJWN 2NZTA 2FBYA 4FJLA 5C42A 4Q5VA 1C1AA 4XH5A 1QQOA 1LWEA 2ASMA 1ZBFA 1S1UA 2HB5A 4BE0A 1C0FA 4IDKA 4FJXA 3MIOA 1VRUA 1XEZA 3THWA 1LW0A 1NGJA 4CHZA 3OBYA 1DT9A 1KAYA 3B6PA 4IZ9A 3ZEUB 4FLUA 2ZE2A 3CMAN 3AV9A 3KD1E 3QDKA 4RW8A 3AVCA 1FK9A 1VSEA 4EZ6A 2A2YA 3UB5A 3HP9A 1TYQB 3SQ4A 3HZ7A 1A5VA 3OJUA 2YHXA 4KHQA 1EWRA 4DTXA 3L6QA 2HHUA 5M1NA 1NK6A 1NGBA 4M3XA 3G10A 4N56A 1HPMA 3SAFA 1T8EA 4LSNA 3G4SN 1RTHA 1UOCA 2I5JA 3TTCA 4ISEA 3L2UA 3QETA 1YTAA 5C0YA 4A2BA 4JI4K 3CCJN 4EO0A 5AQHA 4GMJB 4GY2B 4AHSA 1XHXA 2QWMA 2P51A 3W0LA 1RTIA 5A2QO 2E6MA 4C23A 1TUUA 5J2MA 1XMOK 4FBWA 1HPZA 1IKYA 4IEEA 2OYQA 3U9ZA 4CJEA 1NK4A 3HPHA 3SCXA 4N5SA 4TWAA 5FPDA 4HD0A 5EU7A 3F9KA 4JKAA 1IH7A 3P5JA 1CZBA 2V7ZA 1KVBA 2HHVA 4PWDA 3ZX0A 4CD1A 1L5UA 5AQJA 1CZAN 3IKMA 3DLLL 1NK7A 4P6PA 4NB4A 3MN9A 3KLIA 1HNIA 2YJFA 2O8EB 4P6DA 4YOWA 1D9DA 2UUAK 2D4WA 3OJSA 4CESA 4MO5A 3TAMA 3S3NA 4LF7K 1ZBUA 2IVPA 1RBRA 5AQZA 5C10A 1JLQA 3KWGA 5GAGP 4B9NA 4F2RA 3E66A 2ZWHA 4Y1DA 1XC9A 3A0IX 1ATSA 5J1EA 3UKUA 2EX3A 2P9PA 5B8HA 3I8BA 4Q15A 5BRFA 3ENBA 1VQLN 2F8SA 3C0BA 1JLEA 4YORA 2Q1NA 3ZSZA 1OVQA 1TKZA 1SL1A 2HBLA 4EHTA 1BA0A 2Q36A 1Q81O 3KIOA 1A5WA 5F2RA 1U47A 4E7IA 4FOIA 3WUHA 1BA1A 3B6OA 1NJYA 4AF1A 4F9OA 4CEBA 1HRUA 5FPNA 1JE3A 3IABA 2E1ZA 2W41A 2NRXA 3KLFA 3KLHA 2FXUA 4DB3A 4DLEA 1M90O 3HK2A 3DLKA 4B9VA 4FFJA 3HPGA 3R9PA 1HRHA 3MX2A 2V7YA 3ZSRA 4YOXA 2HHTA 2IFEA 3MK6A 2B4JA 2B6AA 3I33A 3D2FA 3SBGA 3PSIA 4CFDA 1N32K 4OKEA 3L4QA 1TKTA 3MEDA 2Q0UA 1VQ6N 4DTOA 3GDQA 3K5MA 3L2WA 3SJHA 4E0DA 1XWLA 3WQTA 3PIOL 1N6QA 4M3UA 1BL3A 3MK5A 4RW7A 4BR0A 3KLGA 4CJPA 4FL9A 3AVHA 1TKXA 3FGUA 3DXMB 3L0QA 3LP0A 3FFIA 1ZBHA 4DV4K 4I7FA 4OGCA 4NCXA 3LVJC 4LD0A 3VF2A 1VSLA 2NLXA 2KTQA 2O8BA 1BIZA 2XHBA 3NGIA 3NF8A 1NKCA 2P9LA 3PSFA 3E9OA 3M6GA 3MWPA 4DTPA 2HVHA 4DR2K 2UXDK 4BQZA 1JL2A 3VQQA 1Q86O 1LAWA 2O8DA 4K8XA 4DFKA 4U7BA 4CIFA 1NGEA 1SUQA 2P9IB 2Z1IA 4YNQA 2EQAA 3LDPA 5F0XA 3S9HA 4FJ7A 3QLHA 4K42A 3OS1A 2P1JA 3KZBA 3NVKA 3WNHA 3HVTA 1NJ5A 3MECA 2WC9A 2Y1IA 2RPIA 4ISGA 4C8LA 2P9KA 3RMDA 4W5TA 3AO2A 2QKBA 3WNGA 4CEZA 4B1UB 3SI6A 3LZIA 2RE2A 4ZTJA 1FXXA 1ZBLA 4BR9A 2BUPA 4FVUA 2CGJA 1EKEA 3LDOA 3DAWA 4RW6A 3QINA 3UKUB 5BRHA 4BWMA 3SUOA 1L3SA 5FRMA 1RBSA 3BP8A 4J2EA 1H4SA 3CQXA 1S1TA 1VQ7N 4OLFA 4KFBA 1WUAA 4ZHRA 1BQNA 1RBUA 4CK2A 3TWHA 3C7NB 4DTMA 2IAJA 4G1QA 2X78A 1NKEA 1U2VB 3JS6A 4CZMA 4K41A 1VQ5N 3IABB 5DK5A 5JS2A 1GLAG 1C6VA 4QS8A 4OVLA 4DU3A 4B9SA 2X6NA 2XY5A 2NNWA 4FJ9A 3CF5L 4IOXA 1S22A 4DLGA 4AH9A 1NJIO 4P8EA 3ULEB 3BF3A 4Z4EA 2JWLA 4NCGA 1RDCA 3FZKA 3QFUA 3D2FB 3CCEN 5I9EB 4FJIA 3H46O 3PY8A 1YUWA 4HTUA 4KV8A 4JNEA 3SQ0A 4NXNK 2UXBK 2WFBA 1TIGA 1NMNA 4J2DA 2Q3VA 2A40A 4CF8A 4DSKA 4IDHA 4CIEA 4M3WA 4M3ZA 1WSIA 4B1YB 3EN9A 1C1BA 4JI0K 1DCJA 3NBPA 4DQQA 5E26A 1TK5A 1O13A 3GE1A 4EHUA 4RTFD 5J2QA 4CEEA 2O8CA 1HNXK 4YOYA 3CJBA 3VEZA 4O44A 3S41A 4B9LA 1TVRA 4IOAL 2FLOA 1JO0A 3VQ9A 3O9TA 3VEWA 4CJKA 1ZC6A 3C6AA 2O8BB 1OH5A 4DV7K 2P9LB 4H4OA 1LWFA 3DLEA 4JLHA 2OCEA 4DSEA 2DFHA 4X65K 4DV5K 4DV3K 4KH4A 4GW6A 4KREA 3SUPA 3OYLA 1NGIA 3DOLA 4B3TK 3VN5A 3OYGA 1NFJA 4ELVA 4Y1CA 4BQLA 3HO1A 1BCMA 3T1IA 4Z4FA 1B9DA 1LW2A 1HKBA 4NZRM 1RDWX 5JLHA 2X74A 4FJ5A 1SKWA 3THYB 1HYZA 4BDPA 3L2QA 1YJNN 4BRFA 4P77A 4FWNA 3VERA 5KPZA 3LS6A 3VENA 1VQPN 2FSKA 5BREA 3WEEB 4WFBL 2YHAA 1UA1A 3PUFA 3J8AA 1NJWA 3BF1A 3J7AP 2KZZA 2PYJA 3DJCA 1XUPO 4JKDA 3VEOA 4KHUA 3D2EB 3QESA 3VQ5A 3KHYA 1EWQA 1GLLO 3KK2A 3V81A 2KLAA 3THXB 2GELA 1H0YA 3RR7A 4JKBA 4FJMA 3AA5X 4ID5A 4GKJK 3HT3A 3NF9A 4IWVA 1BCOA 4DTSA 1D9FA 3RTVA 4GVMA 3O9UA 1C0GA 1HR0K 1HYSA 4FBQA 1W9HA 4CZJA 2GTCA 1YTUA 3AVLA 1VQNN 2XY8A 3CC7N 1Y9XA 3MXMA 1U49A 4FW2A 1IBKK 3LANA 5LJWA 4BGBA 1SS6A 2YKNA 1DGKN 3TAEA 3A5LC 4FWMA 2P9UA 3AO5A 3KK3A 3O5BA 1KK9A 4C1NI 2PBDA 4KAZA 3CCMN 4DV6K 1VR4A 3CERA 4NO7A 3K5OA 1Q8IA 4CIGA 2E20A 2BE2A 2FBTA 1YJ9N 4H0TB 3O1WA 4MDAA 1V4TA 3V1QA 4DUZK 1RCHA 1G15A 1S1VA 2FSJA 5AQVA 5K14A 3CFOA 2P9SB 3PX0A 4CGGA 4N41A 3HPOA 4BC2A 3FFKB 3FZLA 4M3YA 3WXJA 4MLEA 4CZFA 1VSIA 5LMNK 3BUZB 2GEMA 5HRPA 1DEJA 3NE6A 4CJWA 3ZT3A 2V52B 5CYQA 3QFPA 3SV3A 2IVOA 4Z4HA 4B8AB 3HI0A 1D4XA 1KLMA 4EFHA 4BRLA 5HL7L 5SWMA 3FR0A 1U48A 1K8AO 1VAZA 2NRWA 5KGXA 3PV8A 1GLCG 1TAUA 1KVAA 4IG0A 4BC5A 5HBMA 3V9SA 3DLHA 3QEXA 4KTZA 4GV6A 1PVWA 1SKRA 1DKGD 1HQUA 4X66K 3ULDA 1NJZA 3VQ8A 1J53A 3RVCA 3H6EA 3K5LA 5AQRA 2JGUA 1CXUA 3SJJA 1Q7YO 4GKKK 3JSMA 4NLBA 3LALA 4FCXA 3NDKA 2F4VK 1HC7A 4KRFA 1JCGA 4YDUA 2F96A 3TARA 3CCLN 2NRZA 4I9QA 3VETA 1NWKA 2QWOA 3D7EO 4CJ4A 1RT6A 3P83D 3AAQA 5C2DA 3J81O 4BWJA 3WXIA 3CFPA 5CY4A 3VPZA 1KQSM 3A8YA 4DHYA 4FXDA 4MDBA 4ILHA 4CJLA 3EZ5A 4XH4A 1U04A 3C95A 4CEOA 4AHUA 2DFFA 3SV4A 4WQ4C 4FLXA 3LAMA 1W97L 2HF3A 1J6ZA 4BRDA 1S1WA 2IDOA 3HJFA 1R0AA 3A5MC 4GV3A 1QVFM 4YFUA 4H03B 2HW3A 5AJ3K 4CHOA 3JAMO 2CH6A 2XO7A 1WSFA 3P1GA 4H4MA 4JI7K 3H07A 1VQ8N 1W0HA 3KWIA 2L8YA 1LCUA 2AA4A 4H0PA 3ZX3A 1ZXOA 2FC0A 2P9UB 4YHHK 1BU6O 3N4PA 4FK4A 4IO9L 4IO8A 1Q18A 4IXCA 5DMRA 4PKGA 1JXBA 3I56N 3V9WA 2Z1JA 3C94A 3ZIHA 4BG9A 1RDAA 3O8MA 3IDHA 3MX5A 1SNNA 4WI1A 4Z4GA 4OGEA 3IRXA 2HBMA 1JKHA 1BI4A 4CF0A 4DTUA 4JI5K 2XY6A 1JDQA 3Q7CA 3SUNA 2NUBA 4BY9C 4BR4A 1H4QA 3I55N 3I0SA 3ATUA 5AQGA 3F73A 3ZT0A 3H1VX 2H9UA 3HBTA 4BGAA 2HBJA 1TUYA 4JS5A 4FWRA 2VWKA 3NF6A 4B1WB 3LM2A 3A2FA 2FBVA 4E19A 1BO5O 1VRTA 5LL6Z 3UE5A 4W5OA 1D8YA 4CCHA 2QWQA 4DUYK 1TKDA 4M3TA 1WLJA 1X1PA 3VA3A 2FF3B 3TI0A 3V1OA 4WQ5C 5C24A 3OHRA 3AVBA 3NMUA 2YV0X 4M7XA 5J2PA 1VM0A 2HOEA 2G8KA 1IG8A 3E1YA 3R1XA 4G9ZA 3J80O 2YNFA 1GLDG 5JS1A 1SZ2A 4JKHA 3ZX2A 4EAHD 2Q31A 3IG1A 3AO4A 4JHDB 3TANA 4DFPA 4F3TA 3NF7A 3DYAA 3ZIEA 2YNHA 3AAPA 4AHCA 3LRJA 1QE1A 3P04A 1V4SA 1WSHA 5I42A 1DTQA 1REVA 4MQ3A 2W6KA 2YHWA 1DLOA 4H0OA 4AHRA 3DWLA 4JK8A 5HP1A 3ZIGA 5E84A 2NRHA 2A1SA 1VSDA 3F2KA 4BC3A 1J5EK 5I3UA 1YVUA 4B1XB 3DXKB 2E2NA 4FPBA 1MWKA 4LFCK 1QQMA 3OYBA 2A3ZA 3O9RA 4AILC 5EY4A 4BROA 4DMNA 4JD2B 4WCEL 2D0AA 1OH8A 4KH6A 4KHPK 3LP1A 4FM0A 5GIOA 1XNRK 4O5FA 1Q82O 4DR4K 1U4BA 3EE9A 1E4GT 4KI6A 3H3NO 1XNQK 3K0SA 4B3MK 4WQ4A 1HUXA 3ENOA 4CZKA 1EXQA 4DTNA 3LP2A 2UXCK 1YXQA 1RNHA 2E2QA 1XI1A 3L8BA 1NJ2A 4DQ8A 1ATRA 1SV5A 2PY5A 1HNZK 3ASMA 3CJ1A 1O1WA 3V1RA 1NKBA 4JKFA 1LOTB 3G0ZA 4CERA 4A59A 3SPYA 4DFJA 1YITN 3THWB 1X9WA 4H5WA 2XRIA 4K87A 4AQYK 3ZYYX 4EZ9A 4CFCA 4OPJA 3VQEA 4RCHA 2XY7A 4CJ3A 3OS0A 4HVJA 2HNYA 1K4LA 1S9EA 4R79A 1WBDA 1BI4B 4HCBA 5CZ2A 3O3GA 3T1AA 4C8KA 4QCLA 1KTQA 2Z1HA 3WNEA 3SUQA 4PKIA 3MCPA 1Y64A 3ZT1A 2QWRA 1K4OA 4K43A 4YOUA 3LDLA 4DTJA 1EQYA 2JLEA 3HXMA 3NFAA 4NCBA 2KFZA 4U67L 1NGHA 4CGJA 3G6EN 1Q9YA 1RTDA 1VSFA 4BVPA 1SQKA 1FKOA 3EO3A 4CFBA 3JXUA 4PL7A 2ZM6K 3T19A 4B9TA 1LWCA 3D6RA 4DR1K 4DS5A 3QEIA 1NGFA 4GV9A 3ZETA 1NG9A 2DFEA 2OPPA 4N47A 2F9TA 4BRAA 5BPNA 1H0XA 3O08A 4DR6K 4DQIA 4A5AA 2WTUA 2AP1A 5FPMA 5LY3A 3L7VA 3QICA 4KO0A 4WQ5A 4CJUA 2E8AA 3AO1A 3O9SA 4DV2K 4FM1A 4E7KA 1TL3A 3TU5A 4LF6K 1SL2A 1K73O 3UKRA 3LP3A 3CQYA 4JEPA 3DRRA 4H5TA 3AARA 2DTUA 1LAVA 1KVCA 1S6PA 3SLCA 1JLGA 3O3HA 4HUGA 4J2BA 2Y1BA 1RT4A 1T03A 4CJSA 3CHWA 1QHTA 4LF8K 3MWTA 1QZ6A 4CJRA 3RRGA 5AQNA 1CZ9A 3QBWA 1BQMA 2WUSA 3TSQA 1K6YA 5LMUK 2QM1A 1NOYA 3PO5A 2G8WA 1TK0A 5AQFA 3F9MA 5J2NA 1II7A 1WAFA 3MCAB 1BISA 4E3SA 1VSHA 3CC4N 3SMPA 2P9PB 1GLEG 2JWKA 2H3GX 3OA9A 3P39A 1RTJA 1K8KA 4XH1A 5BPLA 3OW2M 2QWLA 1HJOA 3EYZA 3ZSYA 1KRPA 3LAKA 4E7HA 4JYAK 4M63C 1VQ4N 2ZJRL 3MXJA 4V19S 1IEZA 3TAPA 4Z4IA 3AJEA 2P9NA 1IG9A 4PQUA 1JJ2M 1VSMA 4JK9A 4CJ7A 4LF4K 4C8NA 3HM9A 3U9DA 4EP4A 3KD5E 4BDZA 4AHVA 1BGXT 5EX5A 3L4IA 3SBTA 1T7PA 5TKYA 2CH5A 2A42A 3EEQA 1XHZA 1L3TA 4BRNA 3HOTA 3U8XA 1HKGA 4K88A 3QIPA 2A41A 3RMBA 1VQON 5BN8A 4X64K 3IFRA 5BN9A 4ILGB 3ZT2A 5KQ8A 4DG1A 4XEIA 4NXMK 1RDDA 1QQNA 3ZT4A 1F21A 5HRNA 3CC2N 2F9WA 3MXIA 3CD6N 1WBBA 3U3GA 1NJ1A 5HLFA 2BTFA 2RISA 5AQSA 3TTFA 2E4LA 3T1HK 1J9AA 2VG7A 3KJVA 5AQYA 2ZGYA 4BRKA 4DSJA 4CJTA 4E7JA 3FZHA 4JRQA 1CXQA 4JKGA 3M8RA 3VQAA 4CF1A 2EHGA 4DSIA 2F8TA 1JLFA 3GG4A 3MN5A 2RHKA 4Q0BA 2AJQA 4ID1A 4NZTM 2D1KA 3LDQA 1QHAA 1XQSC 4JRPA 4PL8A 4X62K 3DSDA 4I6MA 4RW4A 1NLVA 4YOTA 4CGFA 3V6DA 5AQMA 3ENHA 3NGZA 2IGIA 3K2PA 5AQIA 2NRRA 1RBTA 3OYKA 2O8DB 2QXFA 3DSCA 3CJ7A 4P6CA 3QB0A 3CG7A 1KCFA 3A5OC 4H5VA 4BR2A 3OYHA 4I9LA 5M1FA 4RWTA 5GAHP 3AVKA 4A2AA 4CVNE 3SPZA 4KI4A 4KH5A 4DTRA 3V9ZA 1YT3A 1T05A 3QMLA 1IKXA 3LQUA 3VQ7A 4PUOA 2P9KB 3O4WA 4FLYA 4UY8O 2HHXA 2LSNA 1NJXA 2O8FA 5C15A 1NGGA 3ZSVA 4FLWA 1JCUA 4NYNA 5SZTA 2KW4A 4MLHA 2J4RA 4YDUC 2ITMA 3VOVA 4BR5A 3P4IA 3RSEA 1WNSA 3SAHA 1VQ9N 1K8KB 4DFMA 1UA0A 3QNNA 4M45A 1KLNA 2GV9A 3ATVA 3VESA 2R7YA 1BG3A 2EWSA 3AA3A 5T7BA 5HOOA 4FJKA 1WN7A 3N4QA 4I2PA 3C6HA 1I39A 3KK7A 3M8QA 4FWPA 4O55A 4OO1J 4ELTA 4KKOA 3CFRA 1P8ZA 5FROA 3FZFA 3LDSA 5HRSA 3MGZA 1RGIA 3R8EA 3VGLA 3VA0A 2DY4A 2Q3SA 2F7TA 5EOYA 1WAJA 4B9UA 4BRCA 2KKZA 3RRHA 4DV0K 1K9MO 3KTQA 3HTVA 3LPTA 1RDUA 4BDYA 3CCUN 1SKSA 1GLJO 2ETJA 2Z7CA 4LY7A 4M7YA 4A5BA 3H45C 2I7PA 3OYNA 4BACA 3BZCA 3K59A 3IMXA 1NK5A 1K49A 1HJRA 4C1NK 1NU0A 1M1KO 4B9MA 1NJ8A 1X9JA 1IBMK 4WFAL 1RT3A 3CIPA 3CJ9A 3CQ8A 2W42A 4CZIA 4FWKA 2UU9K 1GLBG 2A5XA 1JCFA 3IAYA 3DOKA 2A1RA 1ILYA 3FLCO 3MN6A 3ZEUA 1SL0A 5M1KA 4F2SA 4FJGA 3WQUA 4JKGB 3HSTB 2RKIA 2O8CB 3CPWM 2ZGZA 2E6LA 2GWKA 2BH1A 2UUCK 4FJJA 3OYCA 4FBKA 2IS3A 1TYQA 3CYMA 2YCHA 5HRRA 3CI5A 3SQ1A 3I8DA 2NRTA 3CCRN 1G99A 1JLCA 4CF9A 1TV6A 3K5NA 4FO0A 4H5NA 5FRNA 3L3VA 3AA4A 4CJVA 2LXRA 4JS4A 4H5RA 1QVGM 4N76A 5AQXA 2ZJPL 1FKPA 1E4FT 2HVIA 2RF2A 5GIPA 4MFBA 4FWSA 4I14A 3T3FA 1W2BM 4M42A 4NLCA 4DS4A 4CHPA 1KC8O 1YHQN 4M41A 1JLAA 1EP4A 2QEXN 4CEAA 3VEXA 2YKMA 1HNVA 1KXPA 1WOQA 2HF4A 2VCPA 3HM8A 3MN7A 3EZWA 4PHTX 3DLBA 2KQ2A 4JI3K 1UWBA 2YHYA 4FM2A 1GOBA 5F1XA 3VTIA 3L2VA 1A5XA 4KB0A 4FCYA 5BR8K 4O0IA 1RBVA 3AVIA 3F5TA 5KPTA 2O8EA 1VHXA 4DR5K 1L3VA 2IIRA 3VGMA 1Z26A 1RDBA 4JV5K 1RT7A 2OPRA 4OPAA 3D0PA 3QBXA 1Y97A 1IV0A 3A5NC 1NGCA 3LZJA 2O4IA 4OLAA 4H0XB 1E3MA 4K86A 2OPSA 1Q9XA 1VSKA 2OZMA 2QKKA 4RW9A 3KLEA 2OANA 5KRSA 5JMVA 4DU1A 4L8RB 1WSGA 3J7ZO 3VQBA 1S9GA 1C0TA 5KI6A 3O1BA 2E1YA 3CCVN 3H08A 3CPEA 1RT2A 3ZSWA 1J54A 3WXLA 1UDVA 5DM7L 3P31A 1YI2N 4CI6A 4AM7A 3S3OA 1T3VA 2D5RA 5MLCQ 4BRMA 4CBXA 2VG6A 1PVYA 4FLZA 1H4TA 4WFNL 1QZ5A 1N36K 4OPHA 3ID8A 1K4IA 5H1SQ 4DV1K 4LF9K 5KTQA 2WOMA 4F8RA 1CLQA 3AO3A 3MEEA 4CJFA 4ZTFA 1Z05A 1Y2IA 3KKRA 3ZCMA 3TAQA 2BDPA 5BR9A 3TAGA 1GOAA 1N8RO 1NK8A 1NJ6A 5GINA 3P38A 1I3AA 2FSNA 3OVNA 4JI6K 3O9QA 3LWMA 3U3YA 2B5JA 4FK2A 3D45A 1R59O 1IKWA 5IT9O 4HCCA 3UIQA 1RQ8A 2BGGA 4H0YB 4O5BA 3OS2A 1HKCA 4LC9B 3WXKA 3K9JA 4CHQA 4BREA 2HMPA 3ZSXA 3TSPA 4KTWA 4CK3A 4E1MA 4KHYA 3QO9A 4BE1A 5ADXA 1XC3A 2PZSA 3VEYA 2KZMA 2ASOA 2OTLN 4LF5K 3DMJA 1NFHA 2IVNA 3ISNC 2VWBA 3DXMA 3O3FA 4E89A 4FJHA 1NM1A 1TL1A 2YHBA 4PY5A 2VGNA 3OYJA 5BRDA 3NH1A 3T1YK 4YDQA 3HL8A 3M5RA 3TTDA 4CZHA 3AVGA 1EX4A 2HHWA 2YJEA 1ZBSA 1MA9B 2UYTA 1SAZA 5TKWA 5FPEA 2P5OA 2GWJA 1ZBIA 3ZLJA 1HYVA 1K7JA 3H1QA 1HX1A 2O4GA 3H3OB 3O4QA 2FF6A 2P9IA 3VQPA 4LH4A 2G8VA 4DSFA 5BPMA 4R5PA 3NAEA 2G8FA 5JLFA 5D3GA 1TKSA 4L3QA 4FPAA 3CETA 4Y0WA 4WE1A 2ZJQL 1N34K 3SAGA 3KKSA 2D0BA 3K58A 3CMEN 3MMVA 5AQLA 3MDQA 3OY9A 2VQEK 3QIOA 3GBTA 1VK0A 4JI8K 3BEXA 5AQUA 5AQQA 4DU4A 4HVZA 3G71N 2CGKA 3WT0A 1GLFO 4E7LA 2G8IA 3GOIA 2ATQA 3E9PA 4C8MA 2P5GA 4OX9K 1JL1A 4E1NA 4CFAA 2QA4N 4HHTA 3C7NA 2HHSA 1UAXA 5AFUA 4YOVA 1U2VA 4BVOA 3AVMA 5C25A 4E1JA 3ID6A 5M1QA 3SQ2A 4DKWA 1N33K 5HROA 4FJ8A 3QEPA 4JK7A 3AA2A 2W6LA 4O4GA 3C6TA 3O6WA 4LSLA 3K57A 3W3DA 2G8UA 3RWUA 3PO4A 4BR7A 3AY9A 3ALYA 4CJ5A 3ULEA 2Z1GA 3LWLA 5KRTA 1C0MA 1IKVA 3BGRA 4B3RK 4B08A 1TK8A 4CHYA 4B3SK 4FZYA 4W5NA 1OH7A 2I7NA 4K25A 1IJJA 1RT5A 1B9FA 4FW1A 1RILA 5IWAK 4KTQA 1S3XA 4RG8A 3VQDA 1X9SA 1TAQA 4JI2K 4OPKA 1BOTO 4CJQA 4UQGA 4H0VB 5GADP 1RT1A 2YI1A 3RMAA 4O0JA 4DSLA 1QS4A 4K8ZA 4QS7A 4A61A 4CGDA 5GAEP 4P8JA 4W5RA 4KB1A 1G57A 5KPRA 3CJCA 3U6YA 3VTHA 5AZJA 2QI2A 2VG5A 3CCQN 1KAXA 3WBMA 4ELUA 2GX9A 3C65A 3OYDA 4YKEA 3TOEA 3MEGA 3ITHA 2QTDA 1OH6A 4HTLA 5AQTA 1N5YA 4CK1A 4IOCL 4QOZB 3M8PA 1IO2A 5CR4A 3QEVA 1BWFO 1Z25A 4ILJA 2GUPA 3HOSA 3SYZA 3DI6A 3WXMB 1ASUA 4CECA 4FVMA 5AR0A 1EO1A 3CM5A 1HMVA 2BANA 1HQEA 4BRGA 3VQ4A 3U6FA 3TSUA 2WBNA 3THYA 1MWMA 4Z0UA 2OTJN 2IC3A 3NH2A 1WSJA 3VF4A 2HNZA 1NNEA 1J5OA 4IKFA 3WEEA 4HVCA 1DTTA 4CEQA 1L3UA 4O8KA 3C6UA 4FWLA 3LL3A 1WSEA 1W7AA 5KGWA 5EVZA 4CD3A 1KFSA 1LN4A 4ISFA 4FZZA 3D2EA 2Q97A 1OKJA 4J2AA 4PKHA 2VWJA 2IOCA 1YIJN 4Z4CA 1LV5A 3BZKA 3THXA 3S3MA 4JKCA 3DRSA 2ZD1A 4FK0A 3AGRA 1ASVA 4FLTA 2M71A 3VMFB 3OYEA 1QSSA 4FJNA 3CXCM 3HRGA 3DLRA 3G25A 4JKEA 2GBZA 2CRQA 5ADXH 3AVAA 5CE3A 1QSYA 3VEVA 3K9KA 4H8KA 4FWOA 2W40A 1NGDA 3AVNA 2HMIA 3OYFA 4EIAA 1JXEA 2QWPA 4DCHA 3M1FA 4IJNA 3HP6A 4CBUA 2ZF5O 3PLAA 4J8FA 3M3ZA 1HLUA 2QWNA 2PAVA 3SNNA 3ZETB 4M3RA 4OLBA 4OJRA 5EXWA 3KK1A 3VQCA 3ZSOA 4DF8A 3OYAA 4CGIA 1S5JA 3LVKB 1S6QA 1NK9A 5JVGL 1B92A 4B8CA 4CEFA 3QKBA 2P9SA 5M1PA 3O80A 3V9XA 1XMQK 3DRPA 1NH9A 5CZ1A 1K4PA 1ESVA 3FZMA 3LPUA 3L3UA 3UKRB 4HUEA 1NOZA 4IG3A 5AQOA 2PYLA 4QS9A 2OPQA 3EE8A 5AZJB 4BRPA 3DM2A 4BG8A 2E5LK 3RR8A 1Z6RA 1MDUB 3OYIA 3QEWA 4KHWA 5E41A 4NCAA 4FOEA 3V4IA 1QTMA 3O4NA 3THVA 2QK9A 4BRQA 4GNIA 3NCIA 2P9BA 4E1BA 1QSLA 4ICLA 1ASWA 5CYMA 4IFYA 5DM6L 1OVYA 2HHHK 2RIUA 1BDGA 4HUFA 3EY1A 3OBWA 3CCSN 3EKUA 2FBXA 4OKKA 1NK0A 3ZSQA 2D0CA 4CHNA 4KHSA 3AVFA 5AQKA 2OA8A 2MX1A 5C12A 2ZQBA 1TKUA 1T6CA 1NBWA 3TABA 2PFUA 4C8OA 2P9NB 3AVJA 2D0OA 2WONA 2Q0RA 1YF5L 5AFUH 1NGAA 3BDPA 4A57A 4CZLA 4FYDA 4LFBK 1VSJA 2QW9A 1H1VA 1D5AA 1X9MA 1U45A 1S8EA 3VF6A 4BRHA 1MU2A 1T44A 2YNIA 2KHOA 4GVEA 5AZIA 4IFEA 2NRVA 4LFAK 2E88A 2GTDA 3R3LA 3JYTA 1GOCA 4F4KA 3VGKA 1BIUA 3TR8A 2Y1JA 3CJAA 4B1ZA 4KHNA 2V51B 2QXLA 1G58A 3IALA 3FE1A 3AGKA 3HZ6A 4DR3K 4CEDA 1ZYQA 1I94K 4FWQA 3E01A 4O8UA 4IBNA 4JI1K 1C0UA 2HBKA 4JN4A
chains in the Genus database with same CATH topology
1K4LA 3D2FB 3CCEN 1Z05A 1T6DA 4R79A 5I9EB 3HSCA 3H46O 5BR9A 1YUWA 1N8RO 3EKSA 4PKIA 1VQMN 3MCPA 5GINA 1Y64A 4WYBA 4JNEA 1ATNA 3P38A 2FSNA 2QWRA 1K4OA 3PIPL 4K43A 4YOUA 2WFBA 3LDLA 1KAZA 4AM6A 1VQKN 5JVHL 2A40A 1EQYA 3O9QA 4IDHA 1R59O 4U67L 1NGHA 1TKSA 3G6EN 4B1YB 4H0YB 2HSTA 4KBOA 1HKCA 2VGMA 1SQKA 3EN9A 4I6MB 3SK3A 2DPNA 4BVPA 4LC9B 3EO3A 3WXKA 1RFQA 3K9JA 3JXUA 4BREA 2LN3A 4PL7A 4CBWA 5E26A 2HMPA 3T69A 1O13A 3TSPA 3GE1A 3D6RA 4RTFD 4EHUA 4GV9A 1NGFA 5M1OA 3ZETA 5ADXA 4YOYA 3CJBA 3VEZA 2F9TA 4BRAA 3S41A 1KD1O 1XC3A 5BPNA 3O08A 3R6MA 4A5AA 4IOAL 1JCEA 2FLOA 2AP1A 4CZGA 5FPMA 3VEYA 2CGLA 5LY3A 3L7VA 2ASOA 2OTLN 3O9TA 3VEWA 1ZC6A 3QICA 4HWIA 2IVNA 3C6AA 2VWBA 4WQ5A 2E8AA 3DXMA 3O9SA 5LJVA 3TU5A 2P9LB 3NVMA 1K73O 3UKRA 1NM1A 1S72N 3CQYA 3T7ZA 3LDNA 4JEPA 1YVNA 2VGNA 4H5TA 3AARA 5BRDA 5AQWA 3SLCA 1X3MA 5ELZA 3M5RA 3TTDA 4KH4A 4CZHA 3CHWA 2YJEA 2YX6A 5JICA 1NGIA 1ZBSA 1MA9B 2UYTA 1SAZA 4WF9L 5TKWA 5FPEA 3MWTA 1QZ6A 2A6AA 4BQLA 5AQNA 3T1IA 2GWJA 5KQDA 4JHDA 1U6ZA 3Q7BA 1K7JA 3H1QA 3QBWA 1HX1A 4FSVA 1HKBA 2WUSA 3TSQA 3KVGA 4NZRM 2QM1A 3H3OB 3RSEB 1RDWX 2FF6A 2P9IA 2ASPA 4BC4A 5JLHA 5AQFA 3F9MA 5BPMA 1YJNN 3EL2A 4BRFA 5JLFA 4A62A 4P77A 4FWNA 4L3QA 3MCAB 3ZIIA 4FPAA 3VERA 3IUCA 1NMDA 3VENA 5KPZA 3CC4N 3CETA 4Y0WA 5AQPA 4IJAA 1VQPN 2FSKA 3E9LA 3WEEB 3SMSA 3SMPA 5BREA 4WFBL 2ZJQL 2P9PB 3J8AA 1GLEG 3BF1A 2JWKA 2H3GX 3OA9A 3GL1A 3P39A 1K8KA 4XH1A 3DXKA 3U4LA 2QWLA 1HJOA 5BPLA 3DJCA 1XUPO 4JKDA 3CMEN 2Q2RA 3MMVA 3MDQA 4M63C 5AQLA 3VEOA 4CZEA 1BUPA 1VQ4N 3D2EB 5C2FA 2ZJRL 3GBTA 2HBKA 1IEZA 5CHIA 3BEXA 3KHYA 1GLLO 5AQUA 5AQQA 2KLAA 2GELA 3AJEA 4HVZA 2P9NA 3G71N 1X3NA 4Z94A 2CGKA 4JD2A 4CJ7A 4JK9A 3WT0A 1JJ2M 1P90A 1YAGA 1GLFO 4JKBA 4B1VA 2VYPA 5AZIB 3U9DA 3OW2M 4B9QA 3GOIA 2E2OA 4IWVA 2E2PA 5EX5A 3L4IA 3LM9A 3SBTA 2D0PA 3E9PA 4JAXA 4BRIA 3O9UA 1C0GA 5TKYA 2CH5A 4FBQA 2A42A 4MO4A 4CZJA 2QA4N 4IEIA 3TPQA 3B8AX 1YJWN 1VQNN 3C7NA 2NZTA 3CC7N 4XH5A 4BRNA 1QQOA 5AFUA 3HOTA 3U8XA 1HKGA 1U2VA 2ASMA 4BVOA 4BGBA 5LJWA 4YOVA 1SS6A 2A41A 1C0FA 1VQON 1DGKN 4E1JA 5BN8A 3MIOA 3A5LC 3ID6A 4FWMA 2P9UA 5M1QA 3IFRA 5BN9A 4DKWA 4ILGB 1XEZA 5KQ8A 4XEIA 1NGJA 1QQNA 3O5BA 1DT9A 3OBYA 1KAYA 4JK7A 1KK9A 4C1NI 2PBDA 3CCMN 3CC2N 4IZ9A 3CERA 2F9WA 3ZEUB 3O6WA 4NO7A 3CD6N 3CMAN 2RISA 2BTFA 2E20A 5AQSA 3W3DA 3TTFA 1YJ9N 4H0TB 4BR7A 3AY9A 3O1WA 4MDAA 3ULEA 3QDKA 1V4TA 5AQYA 2ZGYA 4BRKA 3LS6A 3FZHA 3UB5A 2FSJA 1TYQB 5AQVA 4JKGA 2P9SB 2I7NA 4K25A 1IJJA 4BC2A 3FFKB 3FZLA 3GG4A 3MN5A 2RHKA 2YHXA 3WXJA 4MLEA 1S3XA 4CZFA 3L6QA 4NZTM 2D1KA 3BUZB 1BOTO 3LDQA 2GEMA 1QHAA 1DEJA 1XQSC 5M1NA 1NGBA 4PL8A 4H0VB 5GADP 2V52B 2YI1A 4I6MA 1HPMA 3SAFA 1NLVA 4YOTA 3G4SN 3QFPA 5AQMA 2IVOA 3ENHA 3HI0A 3TTCA 1D4XA 4ISEA 4EFHA 4QS7A 5AQIA 4A61A 4BRLA 5HL7L 2NRRA 5C0YA 3FR0A 4A2BA 5GAEP 4P8JA 1K8AO 3CCJN 1G57A 1VAZA 2NRWA 4EO0A 5KPRA 3CJCA 5AQHA 4GY2B 1GLCG 3VTHA 2QWMA 5AZJA 3W0LA 2QI2A 4BC5A 3CJ7A 4P6CA 3CCQN 1KAXA 3QB0A 4C23A 1TUUA 2GX9A 4FBWA 3A5OC 4H5VA 3C65A 4BR2A 4IEEA 4YKEA 3U9ZA 5M1FA 4RWTA 5GAHP 2QTDA 4A2AA 4HTLA 5FPDA 5AQTA 4IOCL 4JKAA 4GV6A 4KH5A 2V7ZA 1PVWA 5CR4A 3QMLA 3LQUA 1BWFO 1DKGD 3ZX0A 4ILJA 2GUPA 4CD1A 3HOSA 3WXMB 2P9KB 4JN4A 3O4WA 1CZAN 3IKMA 5AQJA 3DLLL 4UY8O 3RVCA 3H6EA 4P6PA 5AQRA 4NB4A 3MN9A 5AR0A 2YJFA 1Q7YO 5C15A 1NGGA 1EO1A 1JCUA 4NLBA 4P6DA 4YOWA 2D4WA 4MLHA 2J4RA 4YDUC 2ITMA 4MO5A 3VOVA 4FCXA 4BR5A 3P4IA 3RSEA 4BRGA 3SAHA 1VQ9N 2IVPA 3TSUA 1JCGA 4YDUA 1K8KB 5AQZA 2WBNA 5C10A 1MWMA 5GAGP 2NRZA 3KWGA 3CCLN 3VETA 2OTJN 3E66A 1NWKA 3ATVA 2QWOA 3VF4A 3D7EO 2ZWHA 3VESA 1BG3A 2EWSA 3AAQA 3A0IX 1ATSA 3WEEA 5C2DA 3WXIA 3UKUA 5HOOA 3N4QA 2P9PA 5B8HA 3VPZA 3I8BA 1KQSM 3A8YA 3C6HA 4FWLA 4O8KA 4DHYA 3KK7A 3LL3A 4MDBA 4ILHA 4FWPA 4XH4A 5BRFA 4OO1J 3ENBA 1VQLN 5EVZA 4CD3A 4ISFA 3C0BA 3D2EA 2Q97A 1OKJA 4WQ4C 4PKHA 1YIJN 4YORA 1W97L 1P8ZA 1J6ZA 2HF3A 2Q1NA 4BRDA 3FZFA 4JKCA 3MGZA 1RGIA 2HBLA 3A5MC 4EHTA 4GV3A 1BA0A 4H03B 3R8EA 2Q36A 3VGLA 1QVFM 1Q81O 2F7TA 2CH6A 5EOYA 5F2RA 4BRCA 2KKZA 3AGRA 4FOIA 3WUHA 1BA1A 1K9MO 4AF1A 4F9OA 1HRUA 5FPNA 3H07A 1VQ8N 3HTVA 2E1ZA 1RDUA 2W41A 2NRXA 1LCUA 2AA4A 3KWIA 4H0PA 3VMFB 1GLJO 3CCUN 3ZX3A 2FXUA 1ZXOA 2P9UB 4DB3A 4M7YA 4A5BA 1BU6O 3H45C 2I7PA 3N4PA 3CXCM 4IO9L 3HRGA 3G25A 1M90O 4JKEA 3IMXA 1K49A 4FFJA 4IO8A 1Q18A 3R9PA 4IXCA 4C1NK 4PKGA 3SAGA 3MX2A 5ADXH 2V7YA 1X9JA 3I56N 5CE3A 1M1KO 4WFAL 4BG9A 3ZIHA 4YOXA 3CIPA 3O8MA 3VEVA 3K9KA 3IDHA 4FWOA 3MX5A 1SNNA 3CJ9A 3I33A 3MK6A 2W40A 1NGDA 2HBMA 3D2FA 3SBGA 4CZIA 4EIAA 4FWKA 2QWPA 4DCHA 1GLBG 2A5XA 3M1FA 3L4QA 1JCFA 3Q7CA 4IJNA 4CBUA 2ZF5O 3PLAA 2Q0UA 4J8FA 1VQ6N 1ILYA 3FLCO 3M3ZA 1HLUA 3GDQA 3MN6A 3ZEUA 2QWNA 5M1KA 2PAVA 4BY9C 3SJHA 3WQUA 4BR4A 4JKGB 3I55N 3ATUA 5AQGA 3ZETB 3H1VX 2ZGZA 3CPWM 2GWKA 3WQTA 5EXWA 3PIOL 2BH1A 3HBTA 4BGAA 2HBJA 1TUYA 3MK5A 4FWRA 4FBKA 4BR0A 5JVGL 4FL9A 4B1WB 3LM2A 1TYQA 2YCHA 1BO5O 2P9SA 3CI5A 5M1PA 3UE5A 3FGUA 3O80A 2NRTA 3DXMB 3L0QA 3CCRN 2QWQA 1K4PA 1ESVA 1G99A 3FZMA 3UKRB 4FO0A 4H5NA 2FF3B 5AQOA 3VF2A 4QS9A 3EE8A 4WQ5C 5AZJB 2NLXA 4BRPA 4BG8A 3OHRA 4H5RA 1QVGM 3NMUA 1Z6RA 4M7XA 5AQXA 1MDUB 2HOEA 2P9LA 1E4FT 2ZJPL 3E9OA 3M6GA 1IG8A 3E1YA 3R1XA 4G9ZA 3MWPA 5GIPA 1GLDG 4BQZA 4FOEA 1SZ2A 4FWSA 4JKHA 3ZX2A 4EAHD 2Q31A 1Q86O 4I14A 4JHDB 1W2BM 3ZIEA 4U7BA 4NLCA 1NGEA 4BRQA 3AAPA 4GNIA 1YHQN 2P9IB 1KC8O 3LRJA 3P04A 1V4SA 2EQAA 2P9BA 3LDPA 5F0XA 2QEXN 4E1BA 2YHWA 3VEXA 4H0OA 3DWLA 4JK8A 4K42A 3ZIGA 1KXPA 5E84A 1OVYA 2NRHA 1WOQA 5DM6L 3KZBA 2RIUA 1BDGA 3NVKA 2HF4A 2VCPA 3HM8A 3MN7A 3EZWA 4PHTX 3F2KA 3OBWA 2WC9A 4BC3A 3CCSN 3EKUA 2YHYA 4ISGA 4B1XB 3DXKB 3VTIA 2P9KA 2E2NA 4FPBA 1MWKA 5F1XA 1QQMA 4B1UB 5AQKA 2RE2A 2A3ZA 3O9RA 5C12A 2MX1A 4BR9A 3F5TA 2BUPA 5KPTA 1TKUA 1T6CA 1NBWA 4FVUA 2PFUA 2CGJA 5EY4A 2P9NB 3LDOA 4BROA 3DAWA 2D0OA 4JD2B 2Q0RA 1YF5L 3UKUB 2IIRA 5AFUH 4WCEL 1NGAA 3VGMA 4KH6A 5BRHA 4A57A 5GIOA 4O5FA 4CZLA 1Q82O 4OPAA 3BP8A 2QW9A 3EE9A 1H1VA 3QBXA 1E4GT 3CQXA 3H3NO 1VQ7N 1WUAA 3A5NC 1NGCA 4WQ4A 3VF6A 4BRHA 1HUXA 3ENOA 4CZKA 1T44A 2KHOA 4H0XB 1YXQA 4GVEA 5AZIA 4IFEA 2NRVA 2E88A 2GTDA 2E2QA 3R3LA 3C7NB 2OANA 3VGKA 5JMVA 4DQ8A 3J7ZO 1U2VB 3JS6A 4CZMA 4K41A 1ATRA 3CJAA 3O1BA 4B1ZA 2E1YA 1VQ5N 3CCVN 2V51B 3CJ1A 3CPEA 4JKFA 1LOTB 4A59A 2QXLA 3WXLA 1YITN 1G58A 3FE1A 5DM7L 3P31A 1GLAG 3AGKA 3HZ6A 1YI2N 4QS8A 4H5WA 4CI6A 4AM7A 4FWQA 3ZYYX 1T3VA 5MLCQ 2NNWA 4BRMA 4CBXA 3CF5L 4IOXA 1PVYA 4RCHA 4WFNL 1S22A 1QZ5A 1NJIO 4OPHA 3ID8A 4O8UA 1K4IA 4P8EA 3ULEB 5H1SQ 3BF3A 2JWLA 3FZKA 3QFUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEW A;  3TTC A;  3TSP A;  3TTF A;  3VER A;  3TSU A;  3VES A;  3VF2 A;  3VEN A;  3VF4 A;  3VEX A;  3VTH A;  3TTD A;  3VEZ A;  3VTI A;  3VET A;  3TSQ A;  3VEO A; 
#chains in the Genus database with same CATH topology
 1C1C A;  2VQF K;  1T6D A;  3HSC A;  4FZX C;  1JLB A;  4DQR A;  4CW7 B;  2ITG A;  2OZS A;  4KPY A;  3EKS A;  4TSX A;  1VQM N;  2HND A;  4IFV A;  4WYB A;  1ATN A;  3NGY A;  4K0K K;  3PIP L;  4AM6 A;  1KAZ A;  1VQK N;  5JVH L;  3BY5 A;  4CGH A;  3M8S A;  3OTO K;  4OKJ A;  2HST A;  3WNF A;  2G8H A;  4KBO A;  3SK3 A;  2VGM A;  4I6M B;  3MAQ A;  2DPN A;  1WB9 A;  1RFQ A;  2LN3 A;  4CBW A;  3T69 A;  2HHQ A;  5M1O A;  4F3O A;  4DQP A;  3QNO A;  3QER A;  3L2R A;  2RN2 A;  1KD1 O;  1KSP A;  3R6M A;  4I2Q A;  1JCE A;  3VQ6 A;  4CZG A;  2CGL A;  4XIU A;  1HNW K;  4HWI A;  1TGO A;  5LJV A;  4CE9 A;  3I0R A;  3RMC A;  1FW6 A;  3NVM A;  3HVR A;  4DR7 K;  1EET A;  1S72 N;  3HYF A;  1KFD A;  3T7Z A;  3J7Y P;  3LDN A;  1YVN A;  4YY3 K;  3PX6 A;  5AQW A;  1X3M A;  3TAF A;  5ELZ A;  3OYM A;  4QAG A;  4FLV A;  4W5Q A;  4LH5 A;  2YX6 A;  3DLG A;  1ITG A;  5JIC A;  2YNG A;  4WF9 L;  2UUB K;  2KFN A;  2O8F B;  2A6A A;  1IBL K;  1BHL A;  5KQD A;  4JHD A;  1U6Z A;  3V9U A;  3Q7B A;  4DF4 A;  4FSV A;  1PAV A;  3RSE B;  3KVG A;  4BC4 A;  2ASP A;  2GUI A;  3EL2 A;  4A62 A;  3ZII A;  3IUC A;  1NMD A;  3PX4 A;  5AQP A;  4IJA A;  2BKY X;  3E9L A;  3SMS A;  3SZ2 A;  3NH0 A;  3IS9 A;  3GL1 A;  3DXK A;  3U4L A;  2Q2R A;  2EK0 A;  4CZE A;  1BUP A;  4Z9E A;  5C2F A;  1QQC A;  4AHT A;  5FDL A;  5CHI A;  4EP5 A;  4BE2 A;  1X3N A;  4DQS A;  4Z94 A;  4JD2 A;  1P90 A;  1YAG A;  4B1V A;  2X6S A;  2VYP A;  5AZI B;  5FLX O;  4B9Q A;  1S1X A;  3CM6 A;  2E2O A;  2E2P A;  3LM9 A;  2D0P A;  4JAX A;  4BRI A;  4B3O A;  4NYF A;  4MO4 A;  4PA1 A;  4DWI A;  1FJG K;  4IEI A;  3TPQ A;  4CF2 A;  3NHG A;  3B8A X;  2EH1 A;  1YJW N;  2NZT A;  2FBY A;  4FJL A;  5C42 A;  4Q5V A;  1C1A A;  4XH5 A;  1QQO A;  1LWE A;  2ASM A;  1ZBF A;  1S1U A;  2HB5 A;  4BE0 A;  1C0F A;  4IDK A;  4FJX A;  3MIO A;  1VRU A;  1XEZ A;  3THW A;  1LW0 A;  1NGJ A;  4CHZ A;  3OBY A;  1DT9 A;  1KAY A;  3B6P A;  4IZ9 A;  3ZEU B;  4FLU A;  2ZE2 A;  3CMA N;  3AV9 A;  3KD1 E;  3QDK A;  4RW8 A;  3AVC A;  1FK9 A;  1VSE A;  4EZ6 A;  2A2Y A;  3UB5 A;  3HP9 A;  1TYQ B;  3SQ4 A;  3HZ7 A;  1A5V A;  3OJU A;  2YHX A;  4KHQ A;  1EWR A;  4DTX A;  3L6Q A;  2HHU A;  5M1N A;  1NK6 A;  1NGB A;  4M3X A;  3G10 A;  4N56 A;  1HPM A;  3SAF A;  1T8E A;  4LSN A;  3G4S N;  1RTH A;  1UOC A;  2I5J A;  3TTC A;  4ISE A;  3L2U A;  3QET A;  1YTA A;  5C0Y A;  4A2B A;  4JI4 K;  3CCJ N;  4EO0 A;  5AQH A;  4GMJ B;  4GY2 B;  4AHS A;  1XHX A;  2QWM A;  2P51 A;  3W0L A;  1RTI A;  5A2Q O;  2E6M A;  4C23 A;  1TUU A;  5J2M A;  1XMO K;  4FBW A;  1HPZ A;  1IKY A;  4IEE A;  2OYQ A;  3U9Z A;  4CJE A;  1NK4 A;  3HPH A;  3SCX A;  4N5S A;  4TWA A;  5FPD A;  4HD0 A;  5EU7 A;  3F9K A;  4JKA A;  1IH7 A;  3P5J A;  1CZB A;  2V7Z A;  1KVB A;  2HHV A;  4PWD A;  3ZX0 A;  4CD1 A;  1L5U A;  5AQJ A;  1CZA N;  3IKM A;  3DLL L;  1NK7 A;  4P6P A;  4NB4 A;  3MN9 A;  3KLI A;  1HNI A;  2YJF A;  2O8E B;  4P6D A;  4YOW A;  1D9D A;  2UUA K;  2D4W A;  3OJS A;  4CES A;  4MO5 A;  3TAM A;  3S3N A;  4LF7 K;  1ZBU A;  2IVP A;  1RBR A;  5AQZ A;  5C10 A;  1JLQ A;  3KWG A;  5GAG P;  4B9N A;  4F2R A;  3E66 A;  2ZWH A;  4Y1D A;  1XC9 A;  3A0I X;  1ATS A;  5J1E A;  3UKU A;  2EX3 A;  2P9P A;  5B8H A;  3I8B A;  4Q15 A;  5BRF A;  3ENB A;  1VQL N;  2F8S A;  3C0B A;  1JLE A;  4YOR A;  2Q1N A;  3ZSZ A;  1OVQ A;  1TKZ A;  1SL1 A;  2HBL A;  4EHT A;  1BA0 A;  2Q36 A;  1Q81 O;  3KIO A;  1A5W A;  5F2R A;  1U47 A;  4E7I A;  4FOI A;  3WUH A;  1BA1 A;  3B6O A;  1NJY A;  4AF1 A;  4F9O A;  4CEB A;  1HRU A;  5FPN A;  1JE3 A;  3IAB A;  2E1Z A;  2W41 A;  2NRX A;  3KLF A;  3KLH A;  2FXU A;  4DB3 A;  4DLE A;  1M90 O;  3HK2 A;  3DLK A;  4B9V A;  4FFJ A;  3HPG A;  3R9P A;  1HRH A;  3MX2 A;  2V7Y A;  3ZSR A;  4YOX A;  2HHT A;  2IFE A;  3MK6 A;  2B4J A;  2B6A A;  3I33 A;  3D2F A;  3SBG A;  3PSI A;  4CFD A;  1N32 K;  4OKE A;  3L4Q A;  1TKT A;  3MED A;  2Q0U A;  1VQ6 N;  4DTO A;  3GDQ A;  3K5M A;  3L2W A;  3SJH A;  4E0D A;  1XWL A;  3WQT A;  3PIO L;  1N6Q A;  4M3U A;  1BL3 A;  3MK5 A;  4RW7 A;  4BR0 A;  3KLG A;  4CJP A;  4FL9 A;  3AVH A;  1TKX A;  3FGU A;  3DXM B;  3L0Q A;  3LP0 A;  3FFI A;  1ZBH A;  4DV4 K;  4I7F A;  4OGC A;  4NCX A;  3LVJ C;  4LD0 A;  3VF2 A;  1VSL A;  2NLX A;  2KTQ A;  2O8B A;  1BIZ A;  2XHB A;  3NGI A;  3NF8 A;  1NKC A;  2P9L A;  3PSF A;  3E9O A;  3M6G A;  3MWP A;  4DTP A;  2HVH A;  4DR2 K;  2UXD K;  4BQZ A;  1JL2 A;  3VQQ A;  1Q86 O;  1LAW A;  2O8D A;  4K8X A;  4DFK A;  4U7B A;  4CIF A;  1NGE A;  1SUQ A;  2P9I B;  2Z1I A;  4YNQ A;  2EQA A;  3LDP A;  5F0X A;  3S9H A;  4FJ7 A;  3QLH A;  4K42 A;  3OS1 A;  2P1J A;  3KZB A;  3NVK A;  3WNH A;  3HVT A;  1NJ5 A;  3MEC A;  2WC9 A;  2Y1I A;  2RPI A;  4ISG A;  4C8L A;  2P9K A;  3RMD A;  4W5T A;  3AO2 A;  2QKB A;  3WNG A;  4CEZ A;  4B1U B;  3SI6 A;  3LZI A;  2RE2 A;  4ZTJ A;  1FXX A;  1ZBL A;  4BR9 A;  2BUP A;  4FVU A;  2CGJ A;  1EKE A;  3LDO A;  3DAW A;  4RW6 A;  3QIN A;  3UKU B;  5BRH A;  4BWM A;  3SUO A;  1L3S A;  5FRM A;  1RBS A;  3BP8 A;  4J2E A;  1H4S A;  3CQX A;  1S1T A;  1VQ7 N;  4OLF A;  4KFB A;  1WUA A;  4ZHR A;  1BQN A;  1RBU A;  4CK2 A;  3TWH A;  3C7N B;  4DTM A;  2IAJ A;  4G1Q A;  2X78 A;  1NKE A;  1U2V B;  3JS6 A;  4CZM A;  4K41 A;  1VQ5 N;  3IAB B;  5DK5 A;  5JS2 A;  1GLA G;  1C6V A;  4QS8 A;  4OVL A;  4DU3 A;  4B9S A;  2X6N A;  2XY5 A;  2NNW A;  4FJ9 A;  3CF5 L;  4IOX A;  1S22 A;  4DLG A;  4AH9 A;  1NJI O;  4P8E A;  3ULE B;  3BF3 A;  4Z4E A;  2JWL A;  4NCG A;  1RDC A;  3FZK A;  3QFU A;  3D2F B;  3CCE N;  5I9E B;  4FJI A;  3H46 O;  3PY8 A;  1YUW A;  4HTU A;  4KV8 A;  4JNE A;  3SQ0 A;  4NXN K;  2UXB K;  2WFB A;  1TIG A;  1NMN A;  4J2D A;  2Q3V A;  2A40 A;  4CF8 A;  4DSK A;  4IDH A;  4CIE A;  4M3W A;  4M3Z A;  1WSI A;  4B1Y B;  3EN9 A;  1C1B A;  4JI0 K;  1DCJ A;  3NBP A;  4DQQ A;  5E26 A;  1TK5 A;  1O13 A;  3GE1 A;  4EHU A;  4RTF D;  5J2Q A;  4CEE A;  2O8C A;  1HNX K;  4YOY A;  3CJB A;  3VEZ A;  4O44 A;  3S41 A;  4B9L A;  1TVR A;  4IOA L;  2FLO A;  1JO0 A;  3VQ9 A;  3O9T A;  3VEW A;  4CJK A;  1ZC6 A;  3C6A A;  2O8B B;  1OH5 A;  4DV7 K;  2P9L B;  4H4O A;  1LWF A;  3DLE A;  4JLH A;  2OCE A;  4DSE A;  2DFH A;  4X65 K;  4DV5 K;  4DV3 K;  4KH4 A;  4GW6 A;  4KRE A;  3SUP A;  3OYL A;  1NGI A;  3DOL A;  4B3T K;  3VN5 A;  3OYG A;  1NFJ A;  4ELV A;  4Y1C A;  4BQL A;  3HO1 A;  1BCM A;  3T1I A;  4Z4F A;  1B9D A;  1LW2 A;  1HKB A;  4NZR M;  1RDW X;  5JLH A;  2X74 A;  4FJ5 A;  1SKW A;  3THY B;  1HYZ A;  4BDP A;  3L2Q A;  1YJN N;  4BRF A;  4P77 A;  4FWN A;  3VER A;  5KPZ A;  3LS6 A;  3VEN A;  1VQP N;  2FSK A;  5BRE A;  3WEE B;  4WFB L;  2YHA A;  1UA1 A;  3PUF A;  3J8A A;  1NJW A;  3BF1 A;  3J7A P;  2KZZ A;  2PYJ A;  3DJC A;  1XUP O;  4JKD A;  3VEO A;  4KHU A;  3D2E B;  3QES A;  3VQ5 A;  3KHY A;  1EWQ A;  1GLL O;  3KK2 A;  3V81 A;  2KLA A;  3THX B;  2GEL A;  1H0Y A;  3RR7 A;  4JKB A;  4FJM A;  3AA5 X;  4ID5 A;  4GKJ K;  3HT3 A;  3NF9 A;  4IWV A;  1BCO A;  4DTS A;  1D9F A;  3RTV A;  4GVM A;  3O9U A;  1C0G A;  1HR0 K;  1HYS A;  4FBQ A;  1W9H A;  4CZJ A;  2GTC A;  1YTU A;  3AVL A;  1VQN N;  2XY8 A;  3CC7 N;  1Y9X A;  3MXM A;  1U49 A;  4FW2 A;  1IBK K;  3LAN A;  5LJW A;  4BGB A;  1SS6 A;  2YKN A;  1DGK N;  3TAE A;  3A5L C;  4FWM A;  2P9U A;  3AO5 A;  3KK3 A;  3O5B A;  1KK9 A;  4C1N I;  2PBD A;  4KAZ A;  3CCM N;  4DV6 K;  1VR4 A;  3CER A;  4NO7 A;  3K5O A;  1Q8I A;  4CIG A;  2E20 A;  2BE2 A;  2FBT A;  1YJ9 N;  4H0T B;  3O1W A;  4MDA A;  1V4T A;  3V1Q A;  4DUZ K;  1RCH A;  1G15 A;  1S1V A;  2FSJ A;  5AQV A;  5K14 A;  3CFO A;  2P9S B;  3PX0 A;  4CGG A;  4N41 A;  3HPO A;  4BC2 A;  3FFK B;  3FZL A;  4M3Y A;  3WXJ A;  4MLE A;  4CZF A;  1VSI A;  5LMN K;  3BUZ B;  2GEM A;  5HRP A;  1DEJ A;  3NE6 A;  4CJW A;  3ZT3 A;  2V52 B;  5CYQ A;  3QFP A;  3SV3 A;  2IVO A;  4Z4H A;  4B8A B;  3HI0 A;  1D4X A;  1KLM A;  4EFH A;  4BRL A;  5HL7 L;  5SWM A;  3FR0 A;  1U48 A;  1K8A O;  1VAZ A;  2NRW A;  5KGX A;  3PV8 A;  1GLC G;  1TAU A;  1KVA A;  4IG0 A;  4BC5 A;  5HBM A;  3V9S A;  3DLH A;  3QEX A;  4KTZ A;  4GV6 A;  1PVW A;  1SKR A;  1DKG D;  1HQU A;  4X66 K;  3ULD A;  1NJZ A;  3VQ8 A;  1J53 A;  3RVC A;  3H6E A;  3K5L A;  5AQR A;  2JGU A;  1CXU A;  3SJJ A;  1Q7Y O;  4GKK K;  3JSM A;  4NLB A;  3LAL A;  4FCX A;  3NDK A;  2F4V K;  1HC7 A;  4KRF A;  1JCG A;  4YDU A;  2F96 A;  3TAR A;  3CCL N;  2NRZ A;  4I9Q A;  3VET A;  1NWK A;  2QWO A;  3D7E O;  4CJ4 A;  1RT6 A;  3P83 D;  3AAQ A;  5C2D A;  3J81 O;  4BWJ A;  3WXI A;  3CFP A;  5CY4 A;  3VPZ A;  1KQS M;  3A8Y A;  4DHY A;  4FXD A;  4MDB A;  4ILH A;  4CJL A;  3EZ5 A;  4XH4 A;  1U04 A;  3C95 A;  4CEO A;  4AHU A;  2DFF A;  3SV4 A;  4WQ4 C;  4FLX A;  3LAM A;  1W97 L;  2HF3 A;  1J6Z A;  4BRD A;  1S1W A;  2IDO A;  3HJF A;  1R0A A;  3A5M C;  4GV3 A;  1QVF M;  4YFU A;  4H03 B;  2HW3 A;  5AJ3 K;  4CHO A;  3JAM O;  2CH6 A;  2XO7 A;  1WSF A;  3P1G A;  4H4M A;  4JI7 K;  3H07 A;  1VQ8 N;  1W0H A;  3KWI A;  2L8Y A;  1LCU A;  2AA4 A;  4H0P A;  3ZX3 A;  1ZXO A;  2FC0 A;  2P9U B;  4YHH K;  1BU6 O;  3N4P A;  4FK4 A;  4IO9 L;  4IO8 A;  1Q18 A;  4IXC A;  5DMR A;  4PKG A;  1JXB A;  3I56 N;  3V9W A;  2Z1J A;  3C94 A;  3ZIH A;  4BG9 A;  1RDA A;  3O8M A;  3IDH A;  3MX5 A;  1SNN A;  4WI1 A;  4Z4G A;  4OGE A;  3IRX A;  2HBM A;  1JKH A;  1BI4 A;  4CF0 A;  4DTU A;  4JI5 K;  2XY6 A;  1JDQ A;  3Q7C A;  3SUN A;  2NUB A;  4BY9 C;  4BR4 A;  1H4Q A;  3I55 N;  3I0S A;  3ATU A;  5AQG A;  3F73 A;  3ZT0 A;  3H1V X;  2H9U A;  3HBT A;  4BGA A;  2HBJ A;  1TUY A;  4JS5 A;  4FWR A;  2VWK A;  3NF6 A;  4B1W B;  3LM2 A;  3A2F A;  2FBV A;  4E19 A;  1BO5 O;  1VRT A;  5LL6 Z;  3UE5 A;  4W5O A;  1D8Y A;  4CCH A;  2QWQ A;  4DUY K;  1TKD A;  4M3T A;  1WLJ A;  1X1P A;  3VA3 A;  2FF3 B;  3TI0 A;  3V1O A;  4WQ5 C;  5C24 A;  3OHR A;  3AVB A;  3NMU A;  2YV0 X;  4M7X A;  5J2P A;  1VM0 A;  2HOE A;  2G8K A;  1IG8 A;  3E1Y A;  3R1X A;  4G9Z A;  3J80 O;  2YNF A;  1GLD G;  5JS1 A;  1SZ2 A;  4JKH A;  3ZX2 A;  4EAH D;  2Q31 A;  3IG1 A;  3AO4 A;  4JHD B;  3TAN A;  4DFP A;  4F3T A;  3NF7 A;  3DYA A;  3ZIE A;  2YNH A;  3AAP A;  4AHC A;  3LRJ A;  1QE1 A;  3P04 A;  1V4S A;  1WSH A;  5I42 A;  1DTQ A;  1REV A;  4MQ3 A;  2W6K A;  2YHW A;  1DLO A;  4H0O A;  4AHR A;  3DWL A;  4JK8 A;  5HP1 A;  3ZIG A;  5E84 A;  2NRH A;  2A1S A;  1VSD A;  3F2K A;  4BC3 A;  1J5E K;  5I3U A;  1YVU A;  4B1X B;  3DXK B;  2E2N A;  4FPB A;  1MWK A;  4LFC K;  1QQM A;  3OYB A;  2A3Z A;  3O9R A;  4AIL C;  5EY4 A;  4BRO A;  4DMN A;  4JD2 B;  4WCE L;  2D0A A;  1OH8 A;  4KH6 A;  4KHP K;  3LP1 A;  4FM0 A;  5GIO A;  1XNR K;  4O5F A;  1Q82 O;  4DR4 K;  1U4B A;  3EE9 A;  1E4G T;  4KI6 A;  3H3N O;  1XNQ K;  3K0S A;  4B3M K;  4WQ4 A;  1HUX A;  3ENO A;  4CZK A;  1EXQ A;  4DTN A;  3LP2 A;  2UXC K;  1YXQ A;  1RNH A;  2E2Q A;  1XI1 A;  3L8B A;  1NJ2 A;  4DQ8 A;  1ATR A;  1SV5 A;  2PY5 A;  1HNZ K;  3ASM A;  3CJ1 A;  1O1W A;  3V1R A;  1NKB A;  4JKF A;  1LOT B;  3G0Z A;  4CER A;  4A59 A;  3SPY A;  4DFJ A;  1YIT N;  3THW B;  1X9W A;  4H5W A;  2XRI A;  4K87 A;  4AQY K;  3ZYY X;  4EZ9 A;  4CFC A;  4OPJ A;  3VQE A;  4RCH A;  2XY7 A;  4CJ3 A;  3OS0 A;  4HVJ A;  2HNY A;  1K4L A;  1S9E A;  4R79 A;  1WBD A;  1BI4 B;  4HCB A;  5CZ2 A;  3O3G A;  3T1A A;  4C8K A;  4QCL A;  1KTQ A;  2Z1H A;  3WNE A;  3SUQ A;  4PKI A;  3MCP A;  1Y64 A;  3ZT1 A;  2QWR A;  1K4O A;  4K43 A;  4YOU A;  3LDL A;  4DTJ A;  1EQY A;  2JLE A;  3HXM A;  3NFA A;  4NCB A;  2KFZ A;  4U67 L;  1NGH A;  4CGJ A;  3G6E N;  1Q9Y A;  1RTD A;  1VSF A;  4BVP A;  1SQK A;  1FKO A;  3EO3 A;  4CFB A;  3JXU A;  4PL7 A;  2ZM6 K;  3T19 A;  4B9T A;  1LWC A;  3D6R A;  4DR1 K;  4DS5 A;  3QEI A;  1NGF A;  4GV9 A;  3ZET A;  1NG9 A;  2DFE A;  2OPP A;  4N47 A;  2F9T A;  4BRA A;  5BPN A;  1H0X A;  3O08 A;  4DR6 K;  4DQI A;  4A5A A;  2WTU A;  2AP1 A;  5FPM A;  5LY3 A;  3L7V A;  3QIC A;  4KO0 A;  4WQ5 A;  4CJU A;  2E8A A;  3AO1 A;  3O9S A;  4DV2 K;  4FM1 A;  4E7K A;  1TL3 A;  3TU5 A;  4LF6 K;  1SL2 A;  1K73 O;  3UKR A;  3LP3 A;  3CQY A;  4JEP A;  3DRR A;  4H5T A;  3AAR A;  2DTU A;  1LAV A;  1KVC A;  1S6P A;  3SLC A;  1JLG A;  3O3H A;  4HUG A;  4J2B A;  2Y1B A;  1RT4 A;  1T03 A;  4CJS A;  3CHW A;  1QHT A;  4LF8 K;  3MWT A;  1QZ6 A;  4CJR A;  3RRG A;  5AQN A;  1CZ9 A;  3QBW A;  1BQM A;  2WUS A;  3TSQ A;  1K6Y A;  5LMU K;  2QM1 A;  1NOY A;  3PO5 A;  2G8W A;  1TK0 A;  5AQF A;  3F9M A;  5J2N A;  1II7 A;  1WAF A;  3MCA B;  1BIS A;  4E3S A;  1VSH A;  3CC4 N;  3SMP A;  2P9P B;  1GLE G;  2JWK A;  2H3G X;  3OA9 A;  3P39 A;  1RTJ A;  1K8K A;  4XH1 A;  5BPL A;  3OW2 M;  2QWL A;  1HJO A;  3EYZ A;  3ZSY A;  1KRP A;  3LAK A;  4E7H A;  4JYA K;  4M63 C;  1VQ4 N;  2ZJR L;  3MXJ A;  4V19 S;  1IEZ A;  3TAP A;  4Z4I A;  3AJE A;  2P9N A;  1IG9 A;  4PQU A;  1JJ2 M;  1VSM A;  4JK9 A;  4CJ7 A;  4LF4 K;  4C8N A;  3HM9 A;  3U9D A;  4EP4 A;  3KD5 E;  4BDZ A;  4AHV A;  1BGX T;  5EX5 A;  3L4I A;  3SBT A;  1T7P A;  5TKY A;  2CH5 A;  2A42 A;  3EEQ A;  1XHZ A;  1L3T A;  4BRN A;  3HOT A;  3U8X A;  1HKG A;  4K88 A;  3QIP A;  2A41 A;  3RMB A;  1VQO N;  5BN8 A;  4X64 K;  3IFR A;  5BN9 A;  4ILG B;  3ZT2 A;  5KQ8 A;  4DG1 A;  4XEI A;  4NXM K;  1RDD A;  1QQN A;  3ZT4 A;  1F21 A;  5HRN A;  3CC2 N;  2F9W A;  3MXI A;  3CD6 N;  1WBB A;  3U3G A;  1NJ1 A;  5HLF A;  2BTF A;  2RIS A;  5AQS A;  3TTF A;  2E4L A;  3T1H K;  1J9A A;  2VG7 A;  3KJV A;  5AQY A;  2ZGY A;  4BRK A;  4DSJ A;  4CJT A;  4E7J A;  3FZH A;  4JRQ A;  1CXQ A;  4JKG A;  3M8R A;  3VQA A;  4CF1 A;  2EHG A;  4DSI A;  2F8T A;  1JLF A;  3GG4 A;  3MN5 A;  2RHK A;  4Q0B A;  2AJQ A;  4ID1 A;  4NZT M;  2D1K A;  3LDQ A;  1QHA A;  1XQS C;  4JRP A;  4PL8 A;  4X62 K;  3DSD A;  4I6M A;  4RW4 A;  1NLV A;  4YOT A;  4CGF A;  3V6D A;  5AQM A;  3ENH A;  3NGZ A;  2IGI A;  3K2P A;  5AQI A;  2NRR A;  1RBT A;  3OYK A;  2O8D B;  2QXF A;  3DSC A;  3CJ7 A;  4P6C A;  3QB0 A;  3CG7 A;  1KCF A;  3A5O C;  4H5V A;  4BR2 A;  3OYH A;  4I9L A;  5M1F A;  4RWT A;  5GAH P;  3AVK A;  4A2A A;  4CVN E;  3SPZ A;  4KI4 A;  4KH5 A;  4DTR A;  3V9Z A;  1YT3 A;  1T05 A;  3QML A;  1IKX A;  3LQU A;  3VQ7 A;  4PUO A;  2P9K B;  3O4W A;  4FLY A;  4UY8 O;  2HHX A;  2LSN A;  1NJX A;  2O8F A;  5C15 A;  1NGG A;  3ZSV A;  4FLW A;  1JCU A;  4NYN A;  5SZT A;  2KW4 A;  4MLH A;  2J4R A;  4YDU C;  2ITM A;  3VOV A;  4BR5 A;  3P4I A;  3RSE A;  1WNS A;  3SAH A;  1VQ9 N;  1K8K B;  4DFM A;  1UA0 A;  3QNN A;  4M45 A;  1KLN A;  2GV9 A;  3ATV A;  3VES A;  2R7Y A;  1BG3 A;  2EWS A;  3AA3 A;  5T7B A;  5HOO A;  4FJK A;  1WN7 A;  3N4Q A;  4I2P A;  3C6H A;  1I39 A;  3KK7 A;  3M8Q A;  4FWP A;  4O55 A;  4OO1 J;  4ELT A;  4KKO A;  3CFR A;  1P8Z A;  5FRO A;  3FZF A;  3LDS A;  5HRS A;  3MGZ A;  1RGI A;  3R8E A;  3VGL A;  3VA0 A;  2DY4 A;  2Q3S A;  2F7T A;  5EOY A;  1WAJ A;  4B9U A;  4BRC A;  2KKZ A;  3RRH A;  4DV0 K;  1K9M O;  3KTQ A;  3HTV A;  3LPT A;  1RDU A;  4BDY A;  3CCU N;  1SKS A;  1GLJ O;  2ETJ A;  2Z7C A;  4LY7 A;  4M7Y A;  4A5B A;  3H45 C;  2I7P A;  3OYN A;  4BAC A;  3BZC A;  3K59 A;  3IMX A;  1NK5 A;  1K49 A;  1HJR A;  4C1N K;  1NU0 A;  1M1K O;  4B9M A;  1NJ8 A;  1X9J A;  1IBM K;  4WFA L;  1RT3 A;  3CIP A;  3CJ9 A;  3CQ8 A;  2W42 A;  4CZI A;  4FWK A;  2UU9 K;  1GLB G;  2A5X A;  1JCF A;  3IAY A;  3DOK A;  2A1R A;  1ILY A;  3FLC O;  3MN6 A;  3ZEU A;  1SL0 A;  5M1K A;  4F2S A;  4FJG A;  3WQU A;  4JKG B;  3HST B;  2RKI A;  2O8C B;  3CPW M;  2ZGZ A;  2E6L A;  2GWK A;  2BH1 A;  2UUC K;  4FJJ A;  3OYC A;  4FBK A;  2IS3 A;  1TYQ A;  3CYM A;  2YCH A;  5HRR A;  3CI5 A;  3SQ1 A;  3I8D A;  2NRT A;  3CCR N;  1G99 A;  1JLC A;  4CF9 A;  1TV6 A;  3K5N A;  4FO0 A;  4H5N A;  5FRN A;  3L3V A;  3AA4 A;  4CJV A;  2LXR A;  4JS4 A;  4H5R A;  1QVG M;  4N76 A;  5AQX A;  2ZJP L;  1FKP A;  1E4F T;  2HVI A;  2RF2 A;  5GIP A;  4MFB A;  4FWS A;  4I14 A;  3T3F A;  1W2B M;  4M42 A;  4NLC A;  4DS4 A;  4CHP A;  1KC8 O;  1YHQ N;  4M41 A;  1JLA A;  1EP4 A;  2QEX N;  4CEA A;  3VEX A;  2YKM A;  1HNV A;  1KXP A;  1WOQ A;  2HF4 A;  2VCP A;  3HM8 A;  3MN7 A;  3EZW A;  4PHT X;  3DLB A;  2KQ2 A;  4JI3 K;  1UWB A;  2YHY A;  4FM2 A;  1GOB A;  5F1X A;  3VTI A;  3L2V A;  1A5X A;  4KB0 A;  4FCY A;  5BR8 K;  4O0I A;  1RBV A;  3AVI A;  3F5T A;  5KPT A;  2O8E A;  1VHX A;  4DR5 K;  1L3V A;  2IIR A;  3VGM A;  1Z26 A;  1RDB A;  4JV5 K;  1RT7 A;  2OPR A;  4OPA A;  3D0P A;  3QBX A;  1Y97 A;  1IV0 A;  3A5N C;  1NGC A;  3LZJ A;  2O4I A;  4OLA A;  4H0X B;  1E3M A;  4K86 A;  2OPS A;  1Q9X A;  1VSK A;  2OZM A;  2QKK A;  4RW9 A;  3KLE A;  2OAN A;  5KRS A;  5JMV A;  4DU1 A;  4L8R B;  1WSG A;  3J7Z O;  3VQB A;  1S9G A;  1C0T A;  5KI6 A;  3O1B A;  2E1Y A;  3CCV N;  3H08 A;  3CPE A;  1RT2 A;  3ZSW A;  1J54 A;  3WXL A;  1UDV A;  5DM7 L;  3P31 A;  1YI2 N;  4CI6 A;  4AM7 A;  3S3O A;  1T3V A;  2D5R A;  5MLC Q;  4BRM A;  4CBX A;  2VG6 A;  1PVY A;  4FLZ A;  1H4T A;  4WFN L;  1QZ5 A;  1N36 K;  4OPH A;  3ID8 A;  1K4I A;  5H1S Q;  4DV1 K;  4LF9 K;  5KTQ A;  2WOM A;  4F8R A;  1CLQ A;  3AO3 A;  3MEE A;  4CJF A;  4ZTF A;  1Z05 A;  1Y2I A;  3KKR A;  3ZCM A;  3TAQ A;  2BDP A;  5BR9 A;  3TAG A;  1GOA A;  1N8R O;  1NK8 A;  1NJ6 A;  5GIN A;  3P38 A;  1I3A A;  2FSN A;  3OVN A;  4JI6 K;  3O9Q A;  3LWM A;  3U3Y A;  2B5J A;  4FK2 A;  3D45 A;  1R59 O;  1IKW A;  5IT9 O;  4HCC A;  3UIQ A;  1RQ8 A;  2BGG A;  4H0Y B;  4O5B A;  3OS2 A;  1HKC A;  4LC9 B;  3WXK A;  3K9J A;  4CHQ A;  4BRE A;  2HMP A;  3ZSX A;  3TSP A;  4KTW A;  4CK3 A;  4E1M A;  4KHY A;  3QO9 A;  4BE1 A;  5ADX A;  1XC3 A;  2PZS A;  3VEY A;  2KZM A;  2ASO A;  2OTL N;  4LF5 K;  3DMJ A;  1NFH A;  2IVN A;  3ISN C;  2VWB A;  3DXM A;  3O3F A;  4E89 A;  4FJH A;  1NM1 A;  1TL1 A;  2YHB A;  4PY5 A;  2VGN A;  3OYJ A;  5BRD A;  3NH1 A;  3T1Y K;  4YDQ A;  3HL8 A;  3M5R A;  3TTD A;  4CZH A;  3AVG A;  1EX4 A;  2HHW A;  2YJE A;  1ZBS A;  1MA9 B;  2UYT A;  1SAZ A;  5TKW A;  5FPE A;  2P5O A;  2GWJ A;  1ZBI A;  3ZLJ A;  1HYV A;  1K7J A;  3H1Q A;  1HX1 A;  2O4G A;  3H3O B;  3O4Q A;  2FF6 A;  2P9I A;  3VQP A;  4LH4 A;  2G8V A;  4DSF A;  5BPM A;  4R5P A;  3NAE A;  2G8F A;  5JLF A;  5D3G A;  1TKS A;  4L3Q A;  4FPA A;  3CET A;  4Y0W A;  4WE1 A;  2ZJQ L;  1N34 K;  3SAG A;  3KKS A;  2D0B A;  3K58 A;  3CME N;  3MMV A;  5AQL A;  3MDQ A;  3OY9 A;  2VQE K;  3QIO A;  3GBT A;  1VK0 A;  4JI8 K;  3BEX A;  5AQU A;  5AQQ A;  4DU4 A;  4HVZ A;  3G71 N;  2CGK A;  3WT0 A;  1GLF O;  4E7L A;  2G8I A;  3GOI A;  2ATQ A;  3E9P A;  4C8M A;  2P5G A;  4OX9 K;  1JL1 A;  4E1N A;  4CFA A;  2QA4 N;  4HHT A;  3C7N A;  2HHS A;  1UAX A;  5AFU A;  4YOV A;  1U2V A;  4BVO A;  3AVM A;  5C25 A;  4E1J A;  3ID6 A;  5M1Q A;  3SQ2 A;  4DKW A;  1N33 K;  5HRO A;  4FJ8 A;  3QEP A;  4JK7 A;  3AA2 A;  2W6L A;  4O4G A;  3C6T A;  3O6W A;  4LSL A;  3K57 A;  3W3D A;  2G8U A;  3RWU A;  3PO4 A;  4BR7 A;  3AY9 A;  3ALY A;  4CJ5 A;  3ULE A;  2Z1G A;  3LWL A;  5KRT A;  1C0M A;  1IKV A;  3BGR A;  4B3R K;  4B08 A;  1TK8 A;  4CHY A;  4B3S K;  4FZY A;  4W5N A;  1OH7 A;  2I7N A;  4K25 A;  1IJJ A;  1RT5 A;  1B9F A;  4FW1 A;  1RIL A;  5IWA K;  4KTQ A;  1S3X A;  4RG8 A;  3VQD A;  1X9S A;  1TAQ A;  4JI2 K;  4OPK A;  1BOT O;  4CJQ A;  4UQG A;  4H0V B;  5GAD P;  1RT1 A;  2YI1 A;  3RMA A;  4O0J A;  4DSL A;  1QS4 A;  4K8Z A;  4QS7 A;  4A61 A;  4CGD A;  5GAE P;  4P8J A;  4W5R A;  4KB1 A;  1G57 A;  5KPR A;  3CJC A;  3U6Y A;  3VTH A;  5AZJ A;  2QI2 A;  2VG5 A;  3CCQ N;  1KAX A;  3WBM A;  4ELU A;  2GX9 A;  3C65 A;  3OYD A;  4YKE A;  3TOE A;  3MEG A;  3ITH A;  2QTD A;  1OH6 A;  4HTL A;  5AQT A;  1N5Y A;  4CK1 A;  4IOC L;  4QOZ B;  3M8P A;  1IO2 A;  5CR4 A;  3QEV A;  1BWF O;  1Z25 A;  4ILJ A;  2GUP A;  3HOS A;  3SYZ A;  3DI6 A;  3WXM B;  1ASU A;  4CEC A;  4FVM A;  5AR0 A;  1EO1 A;  3CM5 A;  1HMV A;  2BAN A;  1HQE A;  4BRG A;  3VQ4 A;  3U6F A;  3TSU A;  2WBN A;  3THY A;  1MWM A;  4Z0U A;  2OTJ N;  2IC3 A;  3NH2 A;  1WSJ A;  3VF4 A;  2HNZ A;  1NNE A;  1J5O A;  4IKF A;  3WEE A;  4HVC A;  1DTT A;  4CEQ A;  1L3U A;  4O8K A;  3C6U A;  4FWL A;  3LL3 A;  1WSE A;  1W7A A;  5KGW A;  5EVZ A;  4CD3 A;  1KFS A;  1LN4 A;  4ISF A;  4FZZ A;  3D2E A;  2Q97 A;  1OKJ A;  4J2A A;  4PKH A;  2VWJ A;  2IOC A;  1YIJ N;  4Z4C A;  1LV5 A;  3BZK A;  3THX A;  3S3M A;  4JKC A;  3DRS A;  2ZD1 A;  4FK0 A;  3AGR A;  1ASV A;  4FLT A;  2M71 A;  3VMF B;  3OYE A;  1QSS A;  4FJN A;  3CXC M;  3HRG A;  3DLR A;  3G25 A;  4JKE A;  2GBZ A;  2CRQ A;  5ADX H;  3AVA A;  5CE3 A;  1QSY A;  3VEV A;  3K9K A;  4H8K A;  4FWO A;  2W40 A;  1NGD A;  3AVN A;  2HMI A;  3OYF A;  4EIA A;  1JXE A;  2QWP A;  4DCH A;  3M1F A;  4IJN A;  3HP6 A;  4CBU A;  2ZF5 O;  3PLA A;  4J8F A;  3M3Z A;  1HLU A;  2QWN A;  2PAV A;  3SNN A;  3ZET B;  4M3R A;  4OLB A;  4OJR A;  5EXW A;  3KK1 A;  3VQC A;  3ZSO A;  4DF8 A;  3OYA A;  4CGI A;  1S5J A;  3LVK B;  1S6Q A;  1NK9 A;  5JVG L;  1B92 A;  4B8C A;  4CEF A;  3QKB A;  2P9S A;  5M1P A;  3O80 A;  3V9X A;  1XMQ K;  3DRP A;  1NH9 A;  5CZ1 A;  1K4P A;  1ESV A;  3FZM A;  3LPU A;  3L3U A;  3UKR B;  4HUE A;  1NOZ A;  4IG3 A;  5AQO A;  2PYL A;  4QS9 A;  2OPQ A;  3EE8 A;  5AZJ B;  4BRP A;  3DM2 A;  4BG8 A;  2E5L K;  3RR8 A;  1Z6R A;  1MDU B;  3OYI A;  3QEW A;  4KHW A;  5E41 A;  4NCA A;  4FOE A;  3V4I A;  1QTM A;  3O4N A;  3THV A;  2QK9 A;  4BRQ A;  4GNI A;  3NCI A;  2P9B A;  4E1B A;  1QSL A;  4ICL A;  1ASW A;  5CYM A;  4IFY A;  5DM6 L;  1OVY A;  2HHH K;  2RIU A;  1BDG A;  4HUF A;  3EY1 A;  3OBW A;  3CCS N;  3EKU A;  2FBX A;  4OKK A;  1NK0 A;  3ZSQ A;  2D0C A;  4CHN A;  4KHS A;  3AVF A;  5AQK A;  2OA8 A;  2MX1 A;  5C12 A;  2ZQB A;  1TKU A;  1T6C A;  1NBW A;  3TAB A;  2PFU A;  4C8O A;  2P9N B;  3AVJ A;  2D0O A;  2WON A;  2Q0R A;  1YF5 L;  5AFU H;  1NGA A;  3BDP A;  4A57 A;  4CZL A;  4FYD A;  4LFB K;  1VSJ A;  2QW9 A;  1H1V A;  1D5A A;  1X9M A;  1U45 A;  1S8E A;  3VF6 A;  4BRH A;  1MU2 A;  1T44 A;  2YNI A;  2KHO A;  4GVE A;  5AZI A;  4IFE A;  2NRV A;  4LFA K;  2E88 A;  2GTD A;  3R3L A;  3JYT A;  1GOC A;  4F4K A;  3VGK A;  1BIU A;  3TR8 A;  2Y1J A;  3CJA A;  4B1Z A;  4KHN A;  2V51 B;  2QXL A;  1G58 A;  3IAL A;  3FE1 A;  3AGK A;  3HZ6 A;  4DR3 K;  4CED A;  1ZYQ A;  1I94 K;  4FWQ A;  3E01 A;  4O8U A;  4IBN A;  4JI1 K;  1C0U A;  2HBK A;  4JN4 A; 
#chains in the Genus database with same CATH homology
 1K4L A;  3D2F B;  3CCE N;  1Z05 A;  1T6D A;  4R79 A;  5I9E B;  3HSC A;  3H46 O;  5BR9 A;  1YUW A;  1N8R O;  3EKS A;  4PKI A;  1VQM N;  3MCP A;  5GIN A;  1Y64 A;  4WYB A;  4JNE A;  1ATN A;  3P38 A;  2FSN A;  2QWR A;  1K4O A;  3PIP L;  4K43 A;  4YOU A;  2WFB A;  3LDL A;  1KAZ A;  4AM6 A;  1VQK N;  5JVH L;  2A40 A;  1EQY A;  3O9Q A;  4IDH A;  1R59 O;  4U67 L;  1NGH A;  1TKS A;  3G6E N;  4B1Y B;  4H0Y B;  2HST A;  4KBO A;  1HKC A;  2VGM A;  1SQK A;  3EN9 A;  4I6M B;  3SK3 A;  2DPN A;  4BVP A;  4LC9 B;  3EO3 A;  3WXK A;  1RFQ A;  3K9J A;  3JXU A;  4BRE A;  2LN3 A;  4PL7 A;  4CBW A;  5E26 A;  2HMP A;  3T69 A;  1O13 A;  3TSP A;  3GE1 A;  3D6R A;  4RTF D;  4EHU A;  4GV9 A;  1NGF A;  5M1O A;  3ZET A;  5ADX A;  4YOY A;  3CJB A;  3VEZ A;  2F9T A;  4BRA A;  3S41 A;  1KD1 O;  1XC3 A;  5BPN A;  3O08 A;  3R6M A;  4A5A A;  4IOA L;  1JCE A;  2FLO A;  2AP1 A;  4CZG A;  5FPM A;  3VEY A;  2CGL A;  5LY3 A;  3L7V A;  2ASO A;  2OTL N;  3O9T A;  3VEW A;  1ZC6 A;  3QIC A;  4HWI A;  2IVN A;  3C6A A;  2VWB A;  4WQ5 A;  2E8A A;  3DXM A;  3O9S A;  5LJV A;  3TU5 A;  2P9L B;  3NVM A;  1K73 O;  3UKR A;  1NM1 A;  1S72 N;  3CQY A;  3T7Z A;  3LDN A;  4JEP A;  1YVN A;  2VGN A;  4H5T A;  3AAR A;  5BRD A;  5AQW A;  3SLC A;  1X3M A;  5ELZ A;  3M5R A;  3TTD A;  4KH4 A;  4CZH A;  3CHW A;  2YJE A;  2YX6 A;  5JIC A;  1NGI A;  1ZBS A;  1MA9 B;  2UYT A;  1SAZ A;  4WF9 L;  5TKW A;  5FPE A;  3MWT A;  1QZ6 A;  2A6A A;  4BQL A;  5AQN A;  3T1I A;  2GWJ A;  5KQD A;  4JHD A;  1U6Z A;  3Q7B A;  1K7J A;  3H1Q A;  3QBW A;  1HX1 A;  4FSV A;  1HKB A;  2WUS A;  3TSQ A;  3KVG A;  4NZR M;  2QM1 A;  3H3O B;  3RSE B;  1RDW X;  2FF6 A;  2P9I A;  2ASP A;  4BC4 A;  5JLH A;  5AQF A;  3F9M A;  5BPM A;  1YJN N;  3EL2 A;  4BRF A;  5JLF A;  4A62 A;  4P77 A;  4FWN A;  4L3Q A;  3MCA B;  3ZII A;  4FPA A;  3VER A;  3IUC A;  1NMD A;  3VEN A;  5KPZ A;  3CC4 N;  3CET A;  4Y0W A;  5AQP A;  4IJA A;  1VQP N;  2FSK A;  3E9L A;  3WEE B;  3SMS A;  3SMP A;  5BRE A;  4WFB L;  2ZJQ L;  2P9P B;  3J8A A;  1GLE G;  3BF1 A;  2JWK A;  2H3G X;  3OA9 A;  3GL1 A;  3P39 A;  1K8K A;  4XH1 A;  3DXK A;  3U4L A;  2QWL A;  1HJO A;  5BPL A;  3DJC A;  1XUP O;  4JKD A;  3CME N;  2Q2R A;  3MMV A;  3MDQ A;  4M63 C;  5AQL A;  3VEO A;  4CZE A;  1BUP A;  1VQ4 N;  3D2E B;  5C2F A;  2ZJR L;  3GBT A;  2HBK A;  1IEZ A;  5CHI A;  3BEX A;  3KHY A;  1GLL O;  5AQU A;  5AQQ A;  2KLA A;  2GEL A;  3AJE A;  4HVZ A;  2P9N A;  3G71 N;  1X3N A;  4Z94 A;  2CGK A;  4JD2 A;  4CJ7 A;  4JK9 A;  3WT0 A;  1JJ2 M;  1P90 A;  1YAG A;  1GLF O;  4JKB A;  4B1V A;  2VYP A;  5AZI B;  3U9D A;  3OW2 M;  4B9Q A;  3GOI A;  2E2O A;  4IWV A;  2E2P A;  5EX5 A;  3L4I A;  3LM9 A;  3SBT A;  2D0P A;  3E9P A;  4JAX A;  4BRI A;  3O9U A;  1C0G A;  5TKY A;  2CH5 A;  4FBQ A;  2A42 A;  4MO4 A;  4CZJ A;  2QA4 N;  4IEI A;  3TPQ A;  3B8A X;  1YJW N;  1VQN N;  3C7N A;  2NZT A;  3CC7 N;  4XH5 A;  4BRN A;  1QQO A;  5AFU A;  3HOT A;  3U8X A;  1HKG A;  1U2V A;  2ASM A;  4BVO A;  4BGB A;  5LJW A;  4YOV A;  1SS6 A;  2A41 A;  1C0F A;  1VQO N;  1DGK N;  4E1J A;  5BN8 A;  3MIO A;  3A5L C;  3ID6 A;  4FWM A;  2P9U A;  5M1Q A;  3IFR A;  5BN9 A;  4DKW A;  4ILG B;  1XEZ A;  5KQ8 A;  4XEI A;  1NGJ A;  1QQN A;  3O5B A;  1DT9 A;  3OBY A;  1KAY A;  4JK7 A;  1KK9 A;  4C1N I;  2PBD A;  3CCM N;  3CC2 N;  4IZ9 A;  3CER A;  2F9W A;  3ZEU B;  3O6W A;  4NO7 A;  3CD6 N;  3CMA N;  2RIS A;  2BTF A;  2E20 A;  5AQS A;  3W3D A;  3TTF A;  1YJ9 N;  4H0T B;  4BR7 A;  3AY9 A;  3O1W A;  4MDA A;  3ULE A;  3QDK A;  1V4T A;  5AQY A;  2ZGY A;  4BRK A;  3LS6 A;  3FZH A;  3UB5 A;  2FSJ A;  1TYQ B;  5AQV A;  4JKG A;  2P9S B;  2I7N A;  4K25 A;  1IJJ A;  4BC2 A;  3FFK B;  3FZL A;  3GG4 A;  3MN5 A;  2RHK A;  2YHX A;  3WXJ A;  4MLE A;  1S3X A;  4CZF A;  3L6Q A;  4NZT M;  2D1K A;  3BUZ B;  1BOT O;  3LDQ A;  2GEM A;  1QHA A;  1DEJ A;  1XQS C;  5M1N A;  1NGB A;  4PL8 A;  4H0V B;  5GAD P;  2V52 B;  2YI1 A;  4I6M A;  1HPM A;  3SAF A;  1NLV A;  4YOT A;  3G4S N;  3QFP A;  5AQM A;  2IVO A;  3ENH A;  3HI0 A;  3TTC A;  1D4X A;  4ISE A;  4EFH A;  4QS7 A;  5AQI A;  4A61 A;  4BRL A;  5HL7 L;  2NRR A;  5C0Y A;  3FR0 A;  4A2B A;  5GAE P;  4P8J A;  1K8A O;  3CCJ N;  1G57 A;  1VAZ A;  2NRW A;  4EO0 A;  5KPR A;  3CJC A;  5AQH A;  4GY2 B;  1GLC G;  3VTH A;  2QWM A;  5AZJ A;  3W0L A;  2QI2 A;  4BC5 A;  3CJ7 A;  4P6C A;  3CCQ N;  1KAX A;  3QB0 A;  4C23 A;  1TUU A;  2GX9 A;  4FBW A;  3A5O C;  4H5V A;  3C65 A;  4BR2 A;  4IEE A;  4YKE A;  3U9Z A;  5M1F A;  4RWT A;  5GAH P;  2QTD A;  4A2A A;  4HTL A;  5FPD A;  5AQT A;  4IOC L;  4JKA A;  4GV6 A;  4KH5 A;  2V7Z A;  1PVW A;  5CR4 A;  3QML A;  3LQU A;  1BWF O;  1DKG D;  3ZX0 A;  4ILJ A;  2GUP A;  4CD1 A;  3HOS A;  3WXM B;  2P9K B;  4JN4 A;  3O4W A;  1CZA N;  3IKM A;  5AQJ A;  3DLL L;  4UY8 O;  3RVC A;  3H6E A;  4P6P A;  5AQR A;  4NB4 A;  3MN9 A;  5AR0 A;  2YJF A;  1Q7Y O;  5C15 A;  1NGG A;  1EO1 A;  1JCU A;  4NLB A;  4P6D A;  4YOW A;  2D4W A;  4MLH A;  2J4R A;  4YDU C;  2ITM A;  4MO5 A;  3VOV A;  4FCX A;  4BR5 A;  3P4I A;  3RSE A;  4BRG A;  3SAH A;  1VQ9 N;  2IVP A;  3TSU A;  1JCG A;  4YDU A;  1K8K B;  5AQZ A;  2WBN A;  5C10 A;  1MWM A;  5GAG P;  2NRZ A;  3KWG A;  3CCL N;  3VET A;  2OTJ N;  3E66 A;  1NWK A;  3ATV A;  2QWO A;  3VF4 A;  3D7E O;  2ZWH A;  3VES A;  1BG3 A;  2EWS A;  3AAQ A;  3A0I X;  1ATS A;  3WEE A;  5C2D A;  3WXI A;  3UKU A;  5HOO A;  3N4Q A;  2P9P A;  5B8H A;  3VPZ A;  3I8B A;  1KQS M;  3A8Y A;  3C6H A;  4FWL A;  4O8K A;  4DHY A;  3KK7 A;  3LL3 A;  4MDB A;  4ILH A;  4FWP A;  4XH4 A;  5BRF A;  4OO1 J;  3ENB A;  1VQL N;  5EVZ A;  4CD3 A;  4ISF A;  3C0B A;  3D2E A;  2Q97 A;  1OKJ A;  4WQ4 C;  4PKH A;  1YIJ N;  4YOR A;  1W97 L;  1P8Z A;  1J6Z A;  2HF3 A;  2Q1N A;  4BRD A;  3FZF A;  4JKC A;  3MGZ A;  1RGI A;  2HBL A;  3A5M C;  4EHT A;  4GV3 A;  1BA0 A;  4H03 B;  3R8E A;  2Q36 A;  3VGL A;  1QVF M;  1Q81 O;  2F7T A;  2CH6 A;  5EOY A;  5F2R A;  4BRC A;  2KKZ A;  3AGR A;  4FOI A;  3WUH A;  1BA1 A;  1K9M O;  4AF1 A;  4F9O A;  1HRU A;  5FPN A;  3H07 A;  1VQ8 N;  3HTV A;  2E1Z A;  1RDU A;  2W41 A;  2NRX A;  1LCU A;  2AA4 A;  3KWI A;  4H0P A;  3VMF B;  1GLJ O;  3CCU N;  3ZX3 A;  2FXU A;  1ZXO A;  2P9U B;  4DB3 A;  4M7Y A;  4A5B A;  1BU6 O;  3H45 C;  2I7P A;  3N4P A;  3CXC M;  4IO9 L;  3HRG A;  3G25 A;  1M90 O;  4JKE A;  3IMX A;  1K49 A;  4FFJ A;  4IO8 A;  1Q18 A;  3R9P A;  4IXC A;  4C1N K;  4PKG A;  3SAG A;  3MX2 A;  5ADX H;  2V7Y A;  1X9J A;  3I56 N;  5CE3 A;  1M1K O;  4WFA L;  4BG9 A;  3ZIH A;  4YOX A;  3CIP A;  3O8M A;  3VEV A;  3K9K A;  3IDH A;  4FWO A;  3MX5 A;  1SNN A;  3CJ9 A;  3I33 A;  3MK6 A;  2W40 A;  1NGD A;  2HBM A;  3D2F A;  3SBG A;  4CZI A;  4EIA A;  4FWK A;  2QWP A;  4DCH A;  1GLB G;  2A5X A;  3M1F A;  3L4Q A;  1JCF A;  3Q7C A;  4IJN A;  4CBU A;  2ZF5 O;  3PLA A;  2Q0U A;  4J8F A;  1VQ6 N;  1ILY A;  3FLC O;  3M3Z A;  1HLU A;  3GDQ A;  3MN6 A;  3ZEU A;  2QWN A;  5M1K A;  2PAV A;  4BY9 C;  3SJH A;  3WQU A;  4BR4 A;  4JKG B;  3I55 N;  3ATU A;  5AQG A;  3ZET B;  3H1V X;  2ZGZ A;  3CPW M;  2GWK A;  3WQT A;  5EXW A;  3PIO L;  2BH1 A;  3HBT A;  4BGA A;  2HBJ A;  1TUY A;  3MK5 A;  4FWR A;  4FBK A;  4BR0 A;  5JVG L;  4FL9 A;  4B1W B;  3LM2 A;  1TYQ A;  2YCH A;  1BO5 O;  2P9S A;  3CI5 A;  5M1P A;  3UE5 A;  3FGU A;  3O80 A;  2NRT A;  3DXM B;  3L0Q A;  3CCR N;  2QWQ A;  1K4P A;  1ESV A;  1G99 A;  3FZM A;  3UKR B;  4FO0 A;  4H5N A;  2FF3 B;  5AQO A;  3VF2 A;  4QS9 A;  3EE8 A;  4WQ5 C;  5AZJ B;  2NLX A;  4BRP A;  4BG8 A;  3OHR A;  4H5R A;  1QVG M;  3NMU A;  1Z6R A;  4M7X A;  5AQX A;  1MDU B;  2HOE A;  2P9L A;  1E4F T;  2ZJP L;  3E9O A;  3M6G A;  1IG8 A;  3E1Y A;  3R1X A;  4G9Z A;  3MWP A;  5GIP A;  1GLD G;  4BQZ A;  4FOE A;  1SZ2 A;  4FWS A;  4JKH A;  3ZX2 A;  4EAH D;  2Q31 A;  1Q86 O;  4I14 A;  4JHD B;  1W2B M;  3ZIE A;  4U7B A;  4NLC A;  1NGE A;  4BRQ A;  3AAP A;  4GNI A;  1YHQ N;  2P9I B;  1KC8 O;  3LRJ A;  3P04 A;  1V4S A;  2EQA A;  2P9B A;  3LDP A;  5F0X A;  2QEX N;  4E1B A;  2YHW A;  3VEX A;  4H0O A;  3DWL A;  4JK8 A;  4K42 A;  3ZIG A;  1KXP A;  5E84 A;  1OVY A;  2NRH A;  1WOQ A;  5DM6 L;  3KZB A;  2RIU A;  1BDG A;  3NVK A;  2HF4 A;  2VCP A;  3HM8 A;  3MN7 A;  3EZW A;  4PHT X;  3F2K A;  3OBW A;  2WC9 A;  4BC3 A;  3CCS N;  3EKU A;  2YHY A;  4ISG A;  4B1X B;  3DXK B;  3VTI A;  2P9K A;  2E2N A;  4FPB A;  1MWK A;  5F1X A;  1QQM A;  4B1U B;  5AQK A;  2RE2 A;  2A3Z A;  3O9R A;  5C12 A;  2MX1 A;  4BR9 A;  3F5T A;  2BUP A;  5KPT A;  1TKU A;  1T6C A;  1NBW A;  4FVU A;  2PFU A;  2CGJ A;  5EY4 A;  2P9N B;  3LDO A;  4BRO A;  3DAW A;  2D0O A;  4JD2 B;  2Q0R A;  1YF5 L;  3UKU B;  2IIR A;  5AFU H;  4WCE L;  1NGA A;  3VGM A;  4KH6 A;  5BRH A;  4A57 A;  5GIO A;  4O5F A;  4CZL A;  1Q82 O;  4OPA A;  3BP8 A;  2QW9 A;  3EE9 A;  1H1V A;  3QBX A;  1E4G T;  3CQX A;  3H3N O;  1VQ7 N;  1WUA A;  3A5N C;  1NGC A;  4WQ4 A;  3VF6 A;  4BRH A;  1HUX A;  3ENO A;  4CZK A;  1T44 A;  2KHO A;  4H0X B;  1YXQ A;  4GVE A;  5AZI A;  4IFE A;  2NRV A;  2E88 A;  2GTD A;  2E2Q A;  3R3L A;  3C7N B;  2OAN A;  3VGK A;  5JMV A;  4DQ8 A;  3J7Z O;  1U2V B;  3JS6 A;  4CZM A;  4K41 A;  1ATR A;  3CJA A;  3O1B A;  4B1Z A;  2E1Y A;  1VQ5 N;  3CCV N;  2V51 B;  3CJ1 A;  3CPE A;  4JKF A;  1LOT B;  4A59 A;  2QXL A;  3WXL A;  1YIT N;  1G58 A;  3FE1 A;  5DM7 L;  3P31 A;  1GLA G;  3AGK A;  3HZ6 A;  1YI2 N;  4QS8 A;  4H5W A;  4CI6 A;  4AM7 A;  4FWQ A;  3ZYY X;  1T3V A;  5MLC Q;  2NNW A;  4BRM A;  4CBX A;  3CF5 L;  4IOX A;  1PVY A;  4RCH A;  4WFN L;  1S22 A;  1QZ5 A;  1NJI O;  4OPH A;  3ID8 A;  4O8U A;  1K4I A;  4P8E A;  3ULE B;  5H1S Q;  3BF3 A;  2JWL A;  3FZK A;  3QFU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...