3TTFA

Crystal structure of e. coli hypf with amp and carbamoyl phosphate
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Transcriptional regulatory protein
total genus 218
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttfA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttfA01
3VENA 3VEZA 3TSPA 3VTIA 3TSUA 3VESA 3TSQA 3VF4A 3VERA 3TTFA 3TTCA 3VF2A 3VETA 3VEOA 3VEWA 3TTDA 3VTHA 3VEXA
chains in the Genus database with same CATH superfamily
2DFEA 3IFRA 5AQTA 1Q82O 5J1EA 4FL9A 4A62A 3I0RA 3K5NA 3G6EN 3DLLL 2VYPA 4KAZA 3DAWA 3I0SA 4E7LA 3DRSA 3TAMA 3KHYA 4IXCA 5AQHA 4HVZA 2OCEA 4IDHA 4CGFA 4CZLA 3PLAA 3OHRA 1CLQA 3P83D 4KHWA 3O3FA 2KFNA 3AVHA 4J2DA 3EE9A 4X62K 1OKJA 5F1XA 2HF4A 4JI5K 5JS1A 4LSLA 3OYHA 1FJGK 3IABA 4LF6K 4P6PA 1RGIA 1EXQA 1SL1A 3ZT3A 3LPUA 5BRHA 3EL2A 1F21A 3KTQA 1E4GT 1JLBA 1YJ9N 1S72N 3H3OB 4KHQA 1Q9YA 3ZETB 3QIOA 4DG1A 3TAFA 5BPLA 3HI0A 3DYAA 4BR0A 1DCJA 3QBWA 4B1WB 2ZGZA 3ZLJA 1MWKA 4JYAK 3CJAA 3A8YA 2VWBA 3QBXA 1RILA 1NGDA 3LQUA 1X3MA 5M1QA 3WXJA 4CHZA 2RN2A 2D0AA 4B3SK 5DK5A 3O9UA 3HP6A 4YOWA 3EKUA 1NJ5A 4WCEL 1W7AA 5C2DA 4YHHK 3H08A 3G4SN 4DQ8A 1Z05A 4CBUA 3SPZA 4WYBA 5A2QO 4O5BA 1T7PA 2QEXN 1L3TA 4IOXA 5AQUA 3K5MA 2O8DB 2HSTA 4GY2B 4Z4HA 2P9SB 4IO9L 3SPYA 2G8KA 1RTHA 2KFZA 3M6GA 3NCIA 3P31A 3L4QA 4KFBA 3SV3A 3NE6A 4G9ZA 4E7JA 1HRUA 4FVUA 3LL3A 2LSNA 2GUIA 3CFPA 2Q1NA 1BG3A 3QFUA 4MO5A 1E3MA 5HRNA 3O1BA 4CHNA 3SMPA 2QI2A 1JL2A 1VK0A 3MEEA 3E1YA 1U45A 4CJ3A 1RT5A 3EZWA 4BRPA 4FBQA 3F73A 3V4IA 1N33K 5CZ1A 5M1OA 4AM6A 4KI4A 4I2QA 5ADXA 5KPTA 3O6WA 4B8CA 2P9UA 4F9OA 2G8FA 3JSMA 1C0TA 4O8KA 1SAZA 4OPHA 1KQSM 4DCHA 4CZKA 3GG4A 1U2VA 5KGWA 4EIAA 1XC9A 4FJ5A 1WSEA 2YI1A 4IZ9A 3S3MA 5AQZA 1P90A 4EHUA 4FM1A 1NK9A 3ZIEA 1TKDA 4FK2A 1VSJA 3V81A 4ELVA 1YUWA 2IIRA 2JLEA 1C1CA 4CVNE 1RBSA 4MLEA 4CZMA 5TKYA 3ZT1A 2E8AA 4EHTA 1L3SA 2RE2A 1G15A 3DLBA 4KTZA 4XIUA 1S3XA 4FK4A 3ZSQA 3G0ZA 4IJNA 1ZBSA 4UQGA 4IWVA 2Q97A 4GV6A 2V7ZA 2NRXA 2YNGA 4Q15A 2YKMA 5M1KA 4LF9K 2M71A 3CCQN 1RDBA 5AQIA 1NJ1A 3LDSA 4OVLA 1NGEA 1Q9XA 4CZIA 1TKTA 1DTTA 4OPJA 1N8RO 3U9DA 4K86A 2F8TA 1RDWX 4DSLA 4O0JA 2FBVA 4LH5A 5BRFA 3WBMA 2NRRA 5BN9A 3NGZA 1IBLK 2WBNA 3L4IA 1ESVA 4TWAA 4E1NA 3SQ4A 3CM5A 1Q81O 4JKGA 1GOCA 5DM7L 4M3TA 3TU5A 3FR0A 3ZSOA 4PHTX 1VQON 3CJ7A 3P4IA 1Z6RA 2ASPA 4BR4A 3NF7A 5E41A 4KH4A 1ASWA 3A5LC 4YNQA 4W5OA 3HM9A 4FM0A 1J5OA 1QSYA 1TGOA 5JLHA 5KPRA 2VQFK 2L8YA 1DLOA 4NXMK 4YY3K 4DR3K 5T7BA 1O13A 2ASOA 3CCEN 2WFBA 3Q7BA 3M5RA 3SAGA 2IVOA 4CIEA 4DR6K 4QS8A 3KWGA 4Y1DA 2IFEA 4GV9A 3LANA 4W5RA 3L2WA 4JI7K 3CC7N 3L7VA 3S41A 4GVEA 4QCLA 3CYMA 4CHPA 5CYQA 4CJTA 4FJGA 3AY9A 4KBOA 3NH1A 2ZJQL 5AQFA 1TUUA 3D2FB 1VSKA 3AO2A 4E1BA 3KIOA 4FW2A 4C23A 3LP2A 3SQ0A 1IO2A 3C7NB 3AVAA 1T05A 1SKWA 4MO4A 4OPKA 1S1UA 1VSEA 4DUZK 1V4TA 3AO4A 3K9KA 1K73O 1KD1O 1VSIA 2H3GX 2UYTA 3D7EO 3DXKA 3V9WA 4FWLA 4RWTA 2DTUA 4E0DA 1ATNA 1BL3A 3T1HK 2A2YA 3F5TA 2F7TA 1QTMA 3CJ1A 3TI0A 3FZFA 3ZSXA 4Q0BA 3S3NA 5DMRA 4BRGA 4CHQA 4M3UA 5AQQA 4IEEA 3VN5A 4PKIA 4CF9A 5SZTA 3C94A 4NB4A 3QEPA 5KRTA 4DMNA 3VERA 3D6RA 4FJ9A 4NZTM 3ZT4A 3C65A 2ZGYA 1KAXA 1BU6O 4CF1A 1NMDA 3C0BA 2DY4A 3SUNA 1NOZA 4E3SA 1RTJA 4BRAA 4ILHA 1LV5A 1TL3A 5AQJA 1BHLA 5C12A 4BC3A 3VF2A 4NLCA 3THXA 4WQ5C 3S9HA 4A61A 1JCGA 2YNFA 5AQSA 1VQ4N 4U67L 1TK8A 4IFVA 4B3OA 3ZX0A 5AZJB 1B92A 4N5SA 2YCHA 3H1VX 2GWJA 3DRRA 4AHUA 3PIOL 2P9NB 2HBKA 4CBWA 1VHXA 4K41A 4FJLA 1K8KB 1XWLA 3TAEA 3ID6A 5F0XA 2OYQA 3KD5E 2Z1HA 3Q7CA 4KRFA 3VQAA 4J2EA 3D2FA 4JKFA 3GBTA 1RBUA 2GV9A 3BEXA 4B9LA 1B9DA 2KQ2A 2WUSA 1HNIA 3C7NA 2IS3A 4AHCA 2RPIA 3V9SA 3UIQA 4DR2K 1WBBA 3DXKB 4IOAL 2P9UB 4QOZB 4LF8K 5LY3A 3GL1A 4A57A 3P1GA 4HCBA 3P38A 1GLCG 4DTOA 2OPRA 3FLCO 3WEEB 4P77A 2KKZA 1KCFA 3DOLA 1PVYA 4CJEA 1ZC6A 4DFKA 1S8EA 4P8JA 2ITMA 1WBDA 1XI1A 3I55N 3K9JA 1QHTA 4BRKA 3NH0A 1L3VA 4TSXA 3C6AA 4HVJA 1WSHA 1NJ2A 4WF9L 3IS9A 4NLBA 4MQ3A 1OVQA 5EX5A 3RMDA 5IWAK 1SKSA 1ATSA 4JI1K 1IG9A 4CEAA 1HX1A 3ATUA 4I6MB 4CJVA 1W2BM 1VR4A 3WNGA 3L3UA 1JLFA 2G8UA 1W0HA 4FXDA 4LH4A 5AFUH 3VEWA 4KHNA 1C6VA 2GX9A 3AA2A 4FWPA 4C8KA 3NFAA 5AQOA 4W5TA 4XEIA 3L0QA 4R79A 3CCSN 1T8EA 5BRDA 5FPNA 3QKBA 1LWCA 5E26A 1GLBG 3NMUA 5AZJA 1NFHA 4H5WA 1RNHA 3CQYA 4Z4GA 4AHSA 5BN8A 2P9NA 3OYGA 3QICA 4O0IA 3T1AA 5J2MA 3J81O 3LWLA 4BRLA 5I9EB 2KZZA 1JO0A 1HYSA 2P51A 3VMFB 2AP1A 4CGGA 3T1IA 2ZWHA 1NGBA 2E2NA 3TSUA 1NGGA 4N41A 2YNIA 4B9UA 3I33A 2VGMA 1SKRA 3K0SA 1QQMA 4A5BA 1YVUA 4KH6A 3KK3A 1XHZA 3FFKB 2VWKA 2OTLN 3HO1A 2Q0RA 3T3FA 3TTDA 3IAYA 1NJIO 3R8EA 2W40A 2D4WA 2FBXA 3F9KA 1Q86O 3H3NO 1NGAA 1UOCA 1O1WA 3MAQA 2P9IB 4ICLA 4R5PA 3J80O 4J2AA 4BDZA 2CH6A 4WFBL 3CF5L 4JS5A 2OPSA 3ENHA 1VQ5N 3AVIA 1H1VA 3VF6A 3K5LA 3SMSA 4AH9A 2E1YA 5GIOA 3CHWA 1HRHA 1ITGA 4I6MA 4Y1CA 2HHXA 1YTAA 2HVHA 1BA1A 2O4IA 2GBZA 2W42A 3LM9A 1REVA 5FPMA 5ADXH 4CFDA 3M1FA 1LAWA 1G57A 3O9QA 1SUQA 3H46O 3T69A 4DR4K 4M7XA 4CJ7A 3L2QA 4BACA 3WNEA 4NZRM 4NCXA 3BUZB 5FRNA 2O4GA 4DR7K 1NJYA 5BREA 3DLGA 3MECA 4B9MA 4FZYA 2O8EB 4C8NA 3O4WA 3QNNA 2VG7A 3LP0A 1XC3A 4JS4A 4DSIA 3OS0A 3AGKA 4RW8A 4JRQA 3EKSA 2QA4N 3ZSYA 4CGJA 3JS6A 4Z4EA 4H0VB 3M8SA 2NRZA 1OH5A 3HOSA 4MLHA 1D9DA 3D2EA 2G8VA 2PYLA 4KHSA 3FZLA 2P9LA 3QLHA 4JD2A 1KK9A 4CEBA 3E9OA 4BREA 1K9MO 4F8RA 4O5FA 1VQ9N 4WE1A 4MFBA 2D0BA 3O1WA 4I7FA 4DV1K 5EXWA 3VQDA 2X74A 3VA0A 2PBDA 5LMNK 3BF1A 4FCXA 2Z1GA 3KK1A 1WSJA 1EP4A 1WAFA 3LAMA 4CK3A 5KRSA 1UA0A 4K8ZA 3VEXA 5AQWA 2V52B 4AHVA 3MN7A 2WOMA 1MA9B 1PVWA 4F3TA 3VGKA 3VQ8A 1NMNA 3LAKA 3TABA 1NG9A 3VQ5A 3MCPA 4LFBK 1Q8IA 3RRHA 2QKKA 3AARA 2QKBA 5LL6Z 4B9VA 3VEYA 2Q0UA 1TYQA 1CZ9A 5I42A 2BE2A 4H4MA 4NO7A 4H8KA 1UDVA 1QVGM 4OGEA 4N56A 3DSCA 2Q2RA 3S3OA 3VQPA 3AA4A 3VTHA 3EZ5A 3IMXA 4YKEA 3V9UA 4PWDA 1VAZA 2A3ZA 1IKXA 3KLFA 4O4GA 3CJCA 3SQ2A 2QXFA 4LF4K 2CRQA 3HZ7A 2G8IA 2O8BA 3SI6A 3QINA 4H0OA 3R3LA 1X3NA 1JLEA 1HKBA 4BRCA 5FRMA 1QQCA 3UB5A 2F8SA 3ZT2A 4B9SA 4I14A 3AVKA 3U9ZA 2ETJA 3VF4A 3AVLA 1KRPA 4M3YA 4FJNA 1YHQN 3HOTA 1BIUA 3I8BA 1QZ5A 3AVJA 1GLJO 1RBVA 4ELTA 2A1RA 4DV3K 4IO8A 2UU9K 4FJ7A 1HKCA 4IOCL 3ZSVA 2OA8A 2FF3B 3K57A 2GTCA 3L2VA 4J2BA 4KTWA 4EP4A 4BR9A 3RSEA 3HSTB 1IKWA 4Z4FA 4PQUA 2QXLA 1QSSA 3MGZA 1IH7A 1IKYA 1S6QA 3HPGA 3ZSWA 3SJHA 2O8CA 3MN6A 1NNEA 2GUPA 4CJQA 2GELA 4DSFA 3IKMA 3VQ4A 2I7PA 4FLXA 2XY6A 2ZE2A 5JS2A 4DLGA 3QETA 3ATVA 2R7YA 4BG9A 2QM1A 3RVCA 1QE1A 4FJHA 5DM6L 4IKFA 5D3GA 4HTUA 3OYCA 3LZIA 1L3UA 4JKEA 3PX0A 3SJJA 4ID1A 4DF4A 3U3YA 4ILGB 3P39A 1P8ZA 1TYQB 3L2RA 1Z26A 3ZETA 4P6DA 4KPYA 2XHBA 1TL1A 5AQLA 4IG3A 2BDPA 2D5RA 4K0KK 5JVGL 2A42A 3VQ9A 3AA3A 2WTUA 3MK6A 4FZZA 5JLFA 5CZ2A 4HHTA 4BWMA 4BWJA 4DV6K 1I39A 1Y64A 4OO1J 4BE2A 4PUOA 1HNXK 3VETA 3KJVA 2P9IA 3PV8A 3ZSRA 3H45C 1ASVA 5FPDA 3THWA 4FJKA 2ZQBA 2PZSA 3JYTA 4CEEA 4G1QA 4BC5A 4M3WA 3CD6N 3EN9A 3NF9A 3TTFA 3FZHA 3AA5X 3UKRB 4WQ4C 4L8RB 4OLBA 1H4SA 4FLWA 1BIZA 4K42A 5CHIA 1VQLN 4ELUA 1EO1A 5M1PA 4DQIA 1KFDA 1TKZA 3L3VA 3SBGA 1HJOA 4JHDA 1XQSC 3CJ9A 4PL7A 3IALA 4DSEA 3LVJC 1FXXA 3C6TA 1RT4A 4H0YB 5HP1A 5HOOA 4BRQA 1A5VA 1Z25A 4F2RA 4H5TA 1KTQA 4B3TK 5BR9A 3HBTA 4DSJA 1LW0A 3OVNA 1G99A 3KK7A 4BRIA 5GAGP 4V19S 2HF3A 1JL1A 4Z9EA 2ZJPL 5AQRA 4AQYK 2E20A 4RTFD 3WT0A 4JKAA 3CCRN 3EE8A 4CF2A 3DLEA 2UXBK 4JV5K 4GKKK 4JNEA 3CIPA 3O9RA 4PA1A 4DWIA 1S1VA 3A0IX 4OKEA 2NLXA 3ALYA 3CG7A 4B1YB 2JGUA 4FOIA 5EY4A 3HPOA 2JWLA 4BQZA 1HNWK 1LW2A 4CEFA 3VA3A 4B1VA 3VEVA 2P9PA 3TSQA 1C1AA 4M42A 4JI3K 1RQ8A 4CFBA 3THYB 3QO9A 1A5XA 3VQ7A 4IG0A 4AHTA 4ZHRA 3UKUA 4PKGA 2OZMA 1JCUA 1D5AA 4IFEA 1IJJA 4HUEA 4AILC 1YT3A 5IT9O 3C6UA 3OJUA 1NGHA 2HW3A 5J2QA 3L6QA 4CECA 2E4LA 2Y1JA 1B9FA 1K8AO 3VENA 4BE0A 1EX4A 1TUYA 1BOTO 4E1MA 4FW1A 1VSFA 4CIFA 5CE3A 4CZEA 3IRXA 3LDNA 4FVMA 4DTRA 3NVKA 1CZBA 3OBWA 4LD0A 3J7YP 3OW2M 4B9NA 3LDLA 1WB9A 3E9PA 2RF2A 3I8DA 2HHSA 1JCFA 1NWKA 2QWPA 5AQKA 4CD3A 4CZHA 3AV9A 3ZSZA 3AGRA 4DFPA 1TAQA 1ATRA 4RW4A 4WQ5A 4CF0A 5J2NA 3KK2A 2EWSA 4YOXA 4IJAA 3CCUN 4FJ8A 2D0PA 4K43A 2E88A 2XO7A 2D0OA 4NCAA 5B8HA 5GADP 4E1JA 1RT3A 4K25A 3LP1A 5M1NA 4HVCA 1HNZK 4BGAA 3RSEB 4DV2K 1QZ6A 4OJRA 4YOTA 4FFJA 3OYEA 3ZIIA 3ZYYX 4JK9A 3G25A 4KHUA 3NVMA 4GKJK 1T6DA 2KLAA 4A59A 4MDBA 2O8CB 1BWFO 1NBWA 1NK0A 3T7ZA 3KWIA 2BH1A 4B1ZA 3PY8A 3PIPL 4CFAA 2ITGA 3PX4A 4BGBA 1VQPN 4HWIA 5HRSA 1ZBIA 1N32K 4FO0A 3J7AP 4DS5A 3MEDA 3MMVA 3E66A 4FJJA 4JI4K 1R0AA 3UKUB 1W9HA 4K88A 5I3UA 4BRMA 4M3RA 3IG1A 3AVNA 1XUPO 3HT3A 2G8HA 2LN3A 3DXMB 4E7KA 4Z94A 4YOUA 1LCUA 1IKVA 3OYJA 4CK1A 4M45A 3BY5A 4J8FA 1GOAA 1CZAN 3BZCA 3FGUA 5MLCQ 4GV3A 4K8XA 1II7A 4DFJA 1LWEA 1BUPA 3U4LA 4EZ9A 3P5JA 4DLEA 4P6CA 1WSGA 1S6PA 1HPMA 4GVMA 3HP9A 1RDCA 4HTLA 3V1RA 3F2KA 5AQNA 2Y1IA 3MIOA 2RISA 1S9GA 1KAYA 4BR2A 4PKHA 4F2SA 4N76A 4H5RA 3MX5A 1YTUA 1S9EA 1N34K 3W0LA 1OH8A 4CJ4A 5LJVA 2EQAA 4CJRA 2O8FB 3UKRA 1CXUA 2DFHA 4DV5K 1Y97A 2HBLA 1SV5A 3EEQA 2HBJA 2P5OA 1PAVA 4CESA 4JHDB 5AFUA 4FLYA 4FJIA 3E01A 4BDYA 3WXIA 1GOBA 1H0YA 5JICA 3AVBA 1OVYA 1NKBA 1K8KA 2A5XA 4DTSA 4X65K 4JAXA 3PSFA 4CJLA 4JK8A 1K49A 4AM7A 1KSPA 2HOEA 4H0TB 3RTVA 4JKGB 4DU1A 3MWTA 3LRJA 1J6ZA 1ZBFA 4ILJA 4BE1A 3BGRA 3ULEA 1IBMK 2YKNA 4AHRA 1JKHA 5AQYA 1NH9A 1HJRA 5AQVA 4DQRA 1T6CA 3VGLA 3MX2A 4FWMA 1H4QA 3SQ1A 5AR0A 3MN9A 2YV0X 4LFCK 1N5YA 5C2FA 3AO3A 4CJUA 4KTQA 1RFQA 3AVGA 4CZJA 2W41A 2UUBK 2V51B 1GLDG 2OANA 1RT6A 3KZBA 2J4RA 2QK9A 1GLEG 2YHYA 4OLFA 3D45A 4M3ZA 2BTFA 1J54A 3CFOA 3QDKA 2E5LK 4M41A 5EVZA 1QHAA 3WXKA 2Z1JA 3J8AA 4CI6A 4CZFA 3M3ZA 4BQLA 4PL8A 3SAFA 2CH5A 3DRPA 2WC9A 1JCEA 1NKEA 1VQ8N 3CC4N 3A5NC 3ENOA 4FK0A 3NBPA 3QEIA 1X9WA 2VGNA 1ZBHA 2D1KA 1KVCA 2Q3SA 3A2FA 3DJCA 4JK7A 2X6NA 3KLEA 2HBMA 4O8UA 1EETA 1LOTB 4BC4A 2MX1A 1DKGD 3VQBA 4O55A 3ZX3A 1K4LA 1DEJA 4CJFA 2Q36A 1VM0A 2O8DA 4CCHA 4JKHA 4UY8O 4BRNA 2P9SA 4JLHA 4DB3A 2NZTA 4LY7A 2D0CA 1ZBUA 4RW6A 2PY5A 1U47A 3TR8A 1RBTA 1JLGA 4BVPA 4DQPA 1HLUA 4N47A 4DTJA 3OYAA 3LVKB 1DTQA 4CJPA 1NJXA 1VQ6N 1U4BA 4B08A 2P9KA 1SL2A 4DV4K 3LDOA 4B9QA 1M1KO 2KW4A 4ISGA 4HCCA 2X6SA 4Z0UA 2NRTA 1KAZA 1LN4A 3THXB 3VOVA 1Y9XA 2ATQA 1W97L 4ZTFA 4M63C 2E1ZA 5AQPA 1S22A 4L3QA 1KXPA 3OYIA 4HUFA 1WAJA 3K59A 3TSPA 3EY1A 4M3XA 2OPQA 1MWMA 1XHXA 4DFMA 2FF6A 3HZ6A 1WOQA 3OYMA 5C24A 1FK9A 3ITHA 1JJ2M 3D0PA 4B3RK 1U2VB 4I9LA 4DTMA 4PY5A 3SBTA 4BRFA 4IEIA 4DHYA 5AQMA 3CMEN 4DU4A 4QAGA 2HVIA 4YFUA 1HPZA 2VWJA 3VQ6A 1CXQA 1JDQA 1SNNA 3CC2N 5C0YA 1NK7A 1RDAA 1KFSA 3O3GA 3W3DA 1K4IA 3OJSA 3KLIA 4WFNL 2F96A 3F9MA 2H9UA 4X66K 1TVRA 1H4TA 1XMOK 3QIPA 3U8XA 5CR4A 3HTVA 3HJFA 3AO5A 1TK5A 3CPWM 2HMPA 2CGJA 4CW7B 4LFAK 1JXEA 1SL0A 4RW9A 1RDDA 4H4OA 3IDHA 4RCHA 4ISEA 1HMVA 2A41A 3QB0A 5KTQA 5J2PA 1G58A 4BR5A 2P9BA 3RMCA 1NGFA 3ZX2A 1U6ZA 2YHWA 2IC3A 4C8LA 5ELZA 1BCMA 4BC2A 1HC7A 2E6LA 5K14A 3VPZA 2DPNA 1TV6A 3DSDA 4DV7K 3OBYA 4KO0A 2O8EA 2BANA 2HB5A 1YJNN 2EHGA 1X9SA 2NUBA 1GLAG 1VQNN 2IVNA 2FC0A 2P9KB 3SZ2A 1V4SA 1HYZA 3TPQA 4C8MA 3QEXA 4FM2A 5JMVA 2RHKA 3IUCA 5H1SQ 5HROA 3TTCA 5GINA 3D2EB 4ID5A 2P9LB 2CGKA 2FBTA 2QTDA 4B9TA 4E89A 4H5VA 4IBNA 2ZF5O 3HXMA 3AAPA 2YJEA 2ZJRL 3VESA 4YORA 4CBXA 3MN5A 2ASMA 5HRPA 3MK5A 3CETA 3HSCA 4DQQA 2NNWA 4EZ6A 3AVFA 3SCXA 2EH1A 3RMAA 3ZIGA 3TANA 2WONA 5C25A 4RW7A 3VQEA 5FDLA 1QQOA 1D4XA 3DM2A 3SNNA 3ULDA 4YOVA 3PSIA 4KH5A 3FZKA 3NGIA 4CIGA 4MDAA 3LPTA 4NCGA 5CYMA 3MXIA 2UXDK 3C6HA 1IG8A 1KVAA 3AVMA 3NGYA 2P5GA 3ID8A 1U49A 4DTUA 4HD0A 1RTIA 1EWQA 1NJWA 1XEZA 2VCPA 2YHAA 3SK3A 1HNVA 1Y2IA 4YDQA 3NF6A 4JEPA 3DI6A 3OYNA 1KLMA 4FPAA 1FKOA 1KVBA 4DS4A 1YJWN 1BQMA 1I94K 2YX6A 1NU0A 2ZM6K 4CHOA 4U7BA 5FLXO 4CD1A 4W5NA 1BI4A 2XY8A 3QMLA 2HHUA 4JN4A 5BPMA 1YXQA 4O44A 3P04A 2AJQA 2IVPA 1NJ6A 1IV0A 1TAUA 3O9SA 4Z4CA 3G71N 1NK8A 3L2UA 3CXCM 3B8AX 3ASMA 4YDUC 4CERA 2B4JA 3K58A 1VSHA 4KHYA 4BY9C 4P8EA 3O3HA 4CZGA 2F9WA 1C0MA 3KKSA 1T03A 3SUPA 2XRIA 4FJMA 2E2QA 2RKIA 2X78A 3OYKA 3MDQA 1BO5O 4JRPA 5HRRA 3T19A 1J9AA 4FCYA 4DTNA 4C8OA 2HHTA 3PX6A 2YJFA 4AF1A 3KLHA 2FSJA 3O5BA 3UE5A 4B1XB 4JI0K 3CI5A 2LXRA 3MXMA 2XY7A 3KVGA 1D9FA 3TAGA 3QNOA 4DR5K 4LF5K 3DMJA 1NJ8A 5KGXA 2YHXA 4FWKA 3OYBA 4B3MK 4NYNA 1WSIA 3V9XA 1RDUA 1QSLA 3DLHA 4JD2B 2BKYX 4JI6K 1MDUB 2GTDA 4I9QA 3HM8A 4YDUA 3DLKA 2JWKA 3B6PA 3LDQA 3MCAB 1OH6A 4JI2K 3N4QA 2FLOA 1M90O 2UUCK 3VQCA 3CPEA 1YITN 3FFIA 3O4QA 4DTXA 3WEEA 5HLFA 1NGJA 4KKOA 3ISNC 4FSVA 3VGMA 3G10A 4FLTA 1IBKK 2QW9A 4GW6A 1WSFA 3DWLA 4FJXA 1UWBA 3C95A 3MEGA 4A2AA 2XY5A 2BGGA 3R1XA 3WUHA 1K6YA 4XH5A 1NM1A 4OLAA 1N36K 4BDPA 1D8YA 1BI4B 4FYDA 4DF8A 2QWNA 1Q18A 3CERA 4B1UB 4CFCA 2YHBA 1QVFM 4KREA 3RMBA 3CCVN 4KHPK 3LS6A 1TKSA 1YAGA 3SV4A 1KC8O 3SAHA 1TK0A 2O8BB 1A5WA 3ZCMA 4DKWA 2FSNA 3WQTA 3NHGA 4A5AA 4ZTJA 2Q3VA 3O9TA 3THVA 2HHWA 3MXJA 3V1OA 1GLLO 2UUAK 1VSMA 4NYFA 1XNRK 3SLCA 3HVTA 5EU7A 3U6FA 2QWQA 3RR7A 1ZXOA 2A6AA 2HMIA 2Z7CA 4IFYA 2Z1IA 1L5UA 4FWOA 3A5MC 1VQ7N 3I56N 5F2RA 3VEZA 2E2OA 1NJZA 5AZIA 1SS6A 4BVOA 2A1SA 5HBMA 3MWPA 2RIUA 4KB0A 3CQ8A 1HKGA 3L8BA 2HHQA 2CGLA 2IGIA 4H03B 1GLFO 4GNIA 4DV0K 3ZIHA 3M8PA 1S1WA 5AQXA 4WFAL 1NGCA 3RR8A 4EO0A 1UA1A 4E7HA 3TWHA 1U48A 4FWQA 3M8QA 5FPEA 4A2BA 2NRWA 3V1QA 2V7YA 3RWUA 3THYA 1DGKN 1U04A 1HQEA 2F9TA 1R59O 1VRUA 3FE1A 4EFHA 4QS9A 3EYZA 5KI6A 3B6OA 3QEWA 1TKUA 3LP3A 1E4FT 5C15A 3CFRA 2PFUA 1FW6A 1QS4A 4Y0WA 1ZBLA 3H07A 2DFFA 4DSKA 3NDKA 4IDKA 1BDGA 1H0XA 5GAHP 3OYLA 3VTIA 1MU2A 2W6KA 1VRTA 4CEQA 1JLAA 1T44A 3O4NA 1YF5L 5KPZA 1NFJA 4BR7A 3ZT0A 3BF3A 1K4PA 4JKCA 3VEOA 3CM6A 1WUAA 1YVNA 2IAJA 4FWRA 5C10A 3KLGA 3LALA 3PUFA 1OH7A 3THWB 1VSDA 3LWMA 1RBRA 3CCLN 4YOYA 3TAPA 3EO3A 2KZMA 1HR0K 2VG5A 3HL8A 1T3VA 4CJWA 1J5EK 4C1NI 3HRGA 3CQXA 3QESA 3KKRA 4LC9B 5C42A 3TARA 1EWRA 4EAHD 3WXMB 3O80A 5HL7L 3U3GA 1EQYA 2AA4A 4I2PA 1X9MA 1S1TA 3J7ZO 3CMAN 1Q7YO 1YIJN 4W5QA 4FPBA 2FSKA 2F4VK 4NCBA 4FZXC 4H5NA 1NK6A 5M1FA 1UAXA 4F4KA 3AO1A 5LMUK 3ZEUB 1JLCA 4M7YA 4CGHA 5AQGA 1SZ2A 4CGIA 1I3AA 3NF8A 2GEMA 4QS7A 2FXUA 5GAEP 1C1BA 4BROA 1TIGA 2QWLA 1KLNA 1QQNA 1NOYA 1RTDA 1HUXA 2EX3A 1XNQK 3DLRA 3GOIA 2HHVA 3HPHA 5LJWA 2EK0A 1JLQA 1RT1A 3DXMA 3WQUA 2NRVA 2B5JA 1NK5A 3WNHA 2UXCK 4HUGA 2IDOA 3T1YK 2HNZA 2P9PB 2W6LA 4KB1A 4H0PA 1J53A 2HHHK 1ASUA 4EP5A 1NK4A 1YI2N 1XMQK 4WI1A 3JAMO 1K4OA 3H1QA 4CF8A 3GE1A 2QWMA 1BISA 2KTQA 4LSNA 1S5JA 1NGIA 2IOCA 2VG6A 4DUYK 1NLVA 5CY4A 4BRDA 3O8MA 2PYJA 4CEDA 5SWMA 4RG8A 4OKJA 1VSLA 1HQUA 3QFPA 4DTPA 2OZSA 1VQMN 2HNDA 4KV8A 2QWOA 4E19A 4FOEA 1JXBA 2Q31A 3CCJN 4JI8K 1DT9A 5AJ3K 4OGCA 3CCMN 3K2PA 4CE9A 5JVHL 2HNYA 4BG8A 3OYFA 4C1NK 3OY9A 1BA0A 4B8AB 4JKDA 2NRHA 3OS1A 4FLVA 4GMJB 4ISFA 4OX9K 3OTOK 2G8WA 3K5OA 3DOKA 2PAVA 3ZEUA 3AVCA 1WNSA 1C0GA 4CEZA 4BRHA 1ZYQA 1JE3A 2Y1BA 1WLJA 4CHYA 4FLZA 4DQSA 3BP8A 5TKWA 1EKEA 3ULEB 1TKXA 1LAVA 3PO5A 5AZIB 2A40A 4OKKA 1VQKN 3RRGA 3V6DA 3QEVA 2B6AA 1RT7A 4DU3A 4FLUA 1SQKA 3AAQA 1X9JA 4F3OA 3WXLA 3LDPA 4WQ4A 1NKCA 4CJSA 4CEOA 1WN7A 4CK2A 4CJ5A 3U6YA 3HVRA 1C0UA 2VQEK 3OS2A 2KHOA 3NAEA 3SUOA 3PO4A 1ILYA 2FBYA 3R9PA 1HYVA 3OA9A 4CGDA 3SYZA 3KD1E 3HK2A 3BZKA 3E9LA 5KQ8A 1BQNA 2I5JA 3LM2A 3IABB 3N4PA 1LWFA 4E7IA 4JKBA 1C0FA 4LF7K 2GWKA 3VQQA 4K87A 3BDPA 4FBKA 3AJEA 4XH4A 4OPAA 4FWSA 3FZMA 5EOYA 4Q5VA 4DR1K 1X1PA 1RT2A 1RCHA 3JXUA 2OTJN 4FBWA 2E6MA 4H0XB 2E2PA 3NH2A 4X64K 1N6QA 3TOEA 5E84A 4KI6A 1S1XA 4NXNK 3WNFA 3HYFA 3M8RA 3CJBA 5GIPA 4Z4IA 4XH1A 3O08A 4CJKA 3LZJA 2BUPA 1K7JA 3R6MA 3ENBA 3V9ZA 3GDQA 5BR8K 3A5OC 1FKPA 2OPPA 5KQDA 2O8FA 2ZD1A 1BGXT 3H6EA 3QERA 1BCOA 5FROA 2P1JA 1IEZA 3OYDA 3SUQA 2I7NA 4FWNA 2QWRA 3TAQA 2YNHA 5BPNA
chains in the Genus database with same CATH topology
3O5BA 3UE5A 4B1XB 3IFRA 5AQTA 4BGAA 5I9EB 1Q82O 3RSEB 3CI5A 4FL9A 1QZ6A 4A62A 4YOTA 4FFJA 3ZIIA 3ZYYX 4JK9A 3G25A 3VMFB 2AP1A 3KVGA 3G6EN 3NVMA 3DLLL 3T1IA 2VYPA 3DAWA 1T6DA 2KLAA 2ZWHA 1NGBA 4A59A 2YHXA 4FWKA 4MDBA 1BWFO 2E2NA 1NBWA 3KHYA 4IXCA 5AQHA 4HVZA 4IDHA 3TSUA 3T7ZA 4CZLA 3KWIA 3OHRA 1NGGA 1RDUA 2BH1A 4B1ZA 3I33A 3PIPL 2VGMA 4JD2B 4BGBA 1VQPN 1QQMA 4HWIA 1MDUB 2GTDA 4A5BA 3HM8A 4KH6A 3EE9A 4FO0A 4YDUA 3FFKB 2JWKA 1OKJA 2OTLN 5F1XA 3LDQA 3MMVA 2HF4A 3MCAB 3E66A 2Q0RA 3N4QA 2FLOA 3TTDA 3UKUB 1YITN 3CPEA 1M90O 4P6PA 1NJIO 1RGIA 4BRMA 3R8EA 3WEEA 1NGJA 2W40A 4FSVA 2D4WA 3VGMA 1XUPO 2LN3A 5BRHA 3EL2A 1Q86O 3DXMB 1NGAA 3H3NO 4Z94A 1E4GT 1LCUA 2QW9A 4YOUA 1YJ9N 1S72N 3H3OB 4J8FA 3DWLA 1CZAN 2P9IB 3ZETB 3FGUA 5MLCQ 4GV3A 4A2AA 5BPLA 3R1XA 3HI0A 3WUHA 4XH5A 2CH6A 4BR0A 4WFBL 1BUPA 3U4LA 3QBWA 1NM1A 4B1WB 2ZGZA 1MWKA 3CJAA 3CERA 1Q18A 3A8YA 2QWNA 2VWBA 3ENHA 3QBXA 4B1UB 3CF5L 1VQ5N 4P6CA 1H1VA 1HPMA 1NGDA 1QVFM 4HTLA 3VF6A 1X3MA 5M1QA 3SMSA 3WXJA 3LQUA 2E1YA 5GIOA 3CCVN 3F2KA 3CHWA 5AQNA 3LS6A 4I6MA 1TKSA 1YAGA 3O9UA 3MIOA 1KC8O 4YOWA 3EKUA 1BA1A 4WCEL 1Q7YO 3SAHA 2RISA 1KAYA 4BR2A 4PKHA 5C2DA 3LM9A 4H5RA 4DKWA 3MX5A 5FPMA 2FSNA 3WQTA 3G4SN 5ADXH 1G57A 3M1FA 4A5AA 4DQ8A 1Z05A 3W0LA 3O9QA 3O9TA 4CBUA 4WYBA 3H46O 3T69A 5LJVA 2QEXN 4M7XA 4CJ7A 2EQAA 4NZRM 4IOXA 1GLLO 3BUZB 5AQUA 3UKRA 2HSTA 3SLCA 4GY2B 2QWQA 5BREA 1ZXOA 2A6AA 2HBLA 2P9SB 4IO9L 2HBJA 3O4WA 4JHDB 5AFUA 3M6GA 4FWOA 3A5MC 1VQ7N 3I56N 5F2RA 1XC3A 3P31A 3WXIA 3VEZA 2E2OA 3AGKA 3L4QA 5AZIA 1SS6A 3EKSA 5JICA 2QA4N 4BVOA 4G9ZA 1OVYA 1HRUA 3JS6A 4FVUA 4H0VB 1K8KA 3MWPA 2A5XA 3LL3A 2RIUA 2NRZA 4JAXA 3HOSA 4MLHA 1HKGA 4JK8A 1K49A 3D2EA 2Q1NA 3FZLA 1BG3A 3QFUA 4MO5A 2P9LA 3O1BA 4AM7A 2CGLA 4JD2A 4H03B 1KK9A 3SMPA 3E9OA 1GLFO 2QI2A 4BREA 2HOEA 4GNIA 4O5FA 3E1YA 1K9MO 1VQ9N 3ZIHA 4H0TB 4JKGB 5AQXA 4WFAL 1NGCA 3MWTA 3O1WA 3LRJA 3EZWA 4EO0A 1J6ZA 4BRPA 4FBQA 4FWQA 4ILJA 5EXWA 3ULEA 5FPEA 4A2BA 2PBDA 3PLAA 2NRWA 5M1OA 4AM6A 3BF1A 5AQYA 5ADXA 4FCXA 2V7YA 5AQVA 5KPTA 3O6WA 1T6CA 2P9UA 3VGLA 3MX2A 4FWMA 3VEXA 5AQWA 4F9OA 2V52B 1DGKN 3MN7A 5AR0A 1MA9B 2F9TA 1SAZA 3MN9A 4O8KA 1R59O 3FE1A 4OPHA 1PVWA 1KQSM 3VGKA 4EFHA 4DCHA 4QS9A 4CZKA 5C2FA 3GG4A 1TKUA 1RFQA 1E4FT 4CZJA 2W41A 1U2VA 2V51B 3MCPA 1GLDG 2OANA 2PFUA 5C15A 4EIAA 3KZBA 4Y0WA 3AARA 3H07A 2J4RA 1GLEG 2YHYA 2Q0UA 1TYQA 3VEYA 2YI1A 4IZ9A 1BDGA 5GAHP 2BTFA 5AQZA 1P90A 3VTIA 4NO7A 4EHUA 1QVGM 3QDKA 2Q2RA 5EVZA 1QHAA 3WXKA 3ZIEA 3VTHA 3IMXA 4YKEA 3J8AA 1T44A 1VAZA 1YUWA 2A3ZA 1YF5L 2IIRA 3M3ZA 4BQLA 4CI6A 4PL8A 3CJCA 4BR7A 4CZFA 5KPZA 3SAFA 4MLEA 2CH5A 5TKYA 4CZMA 2WC9A 1JCEA 1VQ8N 3BF3A 3CC4N 2E8AA 3A5NC 4EHTA 4H0OA 3R3LA 1K4PA 1X3NA 3ENOA 4JKCA 1HKBA 2RE2A 3VEOA 4BRCA 3UB5A 1WUAA 2VGNA 4I14A 1S3XA 3U9ZA 2D1KA 1YVNA 3DJCA 4JK7A 4FWRA 3VF4A 5C10A 2HBMA 4O8UA 4IJNA 1LOTB 1ZBSA 4BC4A 4IWVA 2MX1A 1DKGD 2Q97A 4GV6A 2V7ZA 3ZX3A 1YHQN 1DEJA 3HOTA 2NRXA 1K4LA 3I8BA 2Q36A 1QZ5A 5M1KA 4JKHA 4UY8O 3CCLN 1GLJO 4BRNA 3CCQN 5AQIA 2P9SA 4YOYA 3EO3A 4DB3A 1T3VA 1NGEA 4CZIA 2NZTA 4IO8A 4C1NI 3HRGA 1HKCA 3CQXA 3U9DA 4IOCL 4LC9B 1N8RO 4EAHD 1RDWX 3WXMB 2FF3B 4BVPA 1HLUA 3O80A 5HL7L 5BRFA 1EQYA 2AA4A 4BR9A 3RSEA 2NRRA 5BN9A 1VQ6N 2P9KA 2WBNA 3J7ZO 3CMAN 3L4IA 3LDOA 2QXLA 1ESVA 4B9QA 1YIJN 4FPBA 2FSKA 1M1KO 3MGZA 1Q81O 4JKGA 4ISGA 5DM7L 3SJHA 4H5NA 3MN6A 3TU5A 3FR0A 2NRTA 2GUPA 4PHTX 1VQON 1KAZA 3CJ7A 2GELA 3P4IA 1Z6RA 2ASPA 4BR4A 5M1FA 3IKMA 4KH4A 3VOVA 3A5LC 2I7PA 1W97L 3ZEUB 4M63C 2E1ZA 4M7YA 5AQGA 5JLHA 1SZ2A 5KPRA 5AQPA 2GEMA 1S22A 4L3QA 1KXPA 4QS7A 3ATVA 2FXUA 3TSPA 4BG9A 1O13A 2QM1A 2ASOA 3RVCA 5GAEP 3CCEN 2WFBA 3Q7BA 4BROA 3M5RA 3SAGA 1MWMA 5DM6L 2FF6A 2IVOA 2QWLA 1QQNA 3HZ6A 4QS8A 1WOQA 3KWGA 1HUXA 4JKEA 1JJ2M 3GOIA 4GV9A 1U2VB 3SBTA 4BRFA 5LJWA 4IEIA 3CC7N 4DHYA 5AQMA 3L7VA 4ILGB 3DXMA 3S41A 3WQUA 3CMEN 4GVEA 3P39A 1P8ZA 2NRVA 1TYQB 3AY9A 4KBOA 2ZJQL 5AQFA 3ZETA 4P6DA 1TUUA 3D2FB 1SNNA 4E1BA 3CC2N 5C0YA 4C23A 2P9PB 5AQLA 4H0PA 3W3DA 3C7NB 1K4IA 5JVGL 4MO4A 1YI2N 1K73O 1V4TA 3K9KA 2A42A 4WFNL 1KD1O 1K4OA 2H3GX 3H1QA 2UYTA 3D7EO 3F9MA 3DXKA 4FWLA 3MK6A 5JLFA 3U8XA 4RWTA 3GE1A 5CR4A 3HTVA 2QWMA 3CPWM 1Y64A 1ATNA 4OO1J 1NGIA 2HMPA 2CGJA 3VETA 2P9IA 1NLVA 3F5TA 3H45C 2F7TA 5FPDA 4BRDA 3IDHA 3O8MA 4RCHA 4ISEA 2A41A 3QB0A 1G58A 3CJ1A 4BC5A 4BR5A 2P9BA 3CD6N 1NGFA 3FZFA 3ZX2A 3EN9A 3TTFA 1U6ZA 2YHWA 3FZHA 3QFPA 1VQMN 5ELZA 4BRGA 2QWOA 3UKRB 4BC2A 4WQ4C 4FOEA 5AQQA 3VPZA 4IEEA 2DPNA 1VQLN 4K42A 5CHIA 1EO1A 4PKIA 2Q31A 3OBYA 3CCJN 1DT9A 4NB4A 5M1PA 1YJNN 4JHDA 1HJOA 3D6RA 3SBGA 3VERA 4NZTM 1XQSC 3CCMN 3C65A 4BG8A 2ZGYA 1GLAG 3CJ9A 4PL7A 1KAXA 4C1NK 1BU6O 1VQNN 2IVNA 1NMDA 2P9KB 3C0BA 1BA0A 4H0YB 1V4SA 4JKDA 2NRHA 3TPQA 4ISFA 5HOOA 4BRAA 4ILHA 4BRQA 2RHKA 5JMVA 3IUCA 5AQJA 5H1SQ 5C12A 3TTCA 3VF2A 4BC3A 4NLCA 4H5TA 5GINA 3D2EB 2PAVA 2P9LB 2CGKA 5BR9A 2QTDA 3HBTA 4WQ5C 3ZEUA 4A61A 1JCGA 4H5VA 1G99A 3KK7A 5AQSA 1C0GA 2ZF5O 4BRIA 5GAGP 4BRHA 4U67L 1VQ4N 2HF3A 3AAPA 2YJEA 3ZX0A 2ZJRL 5AZJB 3VESA 3BP8A 4YORA 5TKWA 4CBXA 2YCHA 3H1VX 2GWJA 3MN5A 5AQRA 2ZJPL 3ULEB 2ASMA 2E20A 4RTFD 3WT0A 4JKAA 3CCRN 3PIOL 2P9NB 3MK5A 5AZIB 2A40A 3CETA 2HBKA 1VQKN 4CBWA 3HSCA 3EE8A 4K41A 2NNWA 1K8KB 1SQKA 3AAQA 3CIPA 3ID6A 1X9JA 3O9RA 4JNEA 5F0XA 3A0IX 3WXLA 2NLXA 3LDPA 4WQ4A 3Q7CA 3ZIGA 4B1YB 4FOIA 5EY4A 2JWLA 3D2FA 1QQOA 1D4XA 4JKFA 4BQZA 2KHOA 3GBTA 4B1VA 3VEVA 2P9PA 3BEXA 4YOVA 4KH5A 3TSQA 3FZKA 1ILYA 2WUSA 3C7NA 4MDAA 3R9PA 3OA9A 3C6HA 4IOAL 3DXKB 2P9UB 1IG8A 3E9LA 5KQ8A 5LY3A 5JVHL 3ID8A 3GL1A 3LM2A 4A57A 3UKUA 4PKGA 1JCUA 3N4PA 3P38A 1GLCG 3FLCO 4IFEA 1IJJA 1XEZA 3WEEB 4JKBA 2KKZA 1C0FA 2VCPA 4P77A 2GWKA 3SK3A 5BPNA 4FBKA 3AJEA 4JEPA 4XH4A 4FPAA 1NGHA 1PVYA 1ZC6A 4OPAA 1YJWN 3L6QA 4FWSA 2YX6A 4P8JA 2ITMA 3FZMA 5EOYA 3I55N 3K9JA 4BRKA 4U7BA 3C6AA 3JXUA 4CD1A 1K8AO 3VENA 4WF9L 4NLBA 2OTJN 3QMLA 4JN4A 5BPMA 4FBWA 5EX5A 1TUYA 1BOTO 1YXQA 1ATSA 4H0XB 2E2PA 3P04A 5CE3A 2IVPA 3LDNA 1HX1A 3ATUA 5E84A 4CZEA 3O9SA 4I6MB 3G71N 1W2BM 3NVKA 3OBWA 3CXCM 3B8AX 3OW2M 3LDLA 3E9PA 4YDUC 1JCFA 1NWKA 2QWPA 3CJBA 5AQKA 5GIPA 5AFUH 3VEWA 4CD3A 4XH1A 3O08A 4CZHA 2GX9A 2BUPA 4FWPA 1K7JA 4BY9C 5AQOA 3R6MA 3AGRA 3ENBA 3GDQA 4XEIA 4P8EA 3L0QA 1ATRA 4R79A 3CCSN 4WQ5A 4CZGA 3A5OC 5FPNA 5BRDA 2F9WA 5E26A 2EWSA 1GLBG 4YOXA 3NMUA 4IJAA 5AZJA 5KQDA 4H5WA 2E2QA 3CCUN 2D0PA 2E88A 3CQYA 4K43A 2D0OA 3H6EA 3MDQA 1BO5O 5BN8A 1IEZA 2P9NA 2I7NA 5B8HA 5GADP 4FWNA 4E1JA 4K25A 2YJFA 3QICA 2QWRA 4AF1A 5M1NA 2FSJA 4BRLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VEN A;  3VEZ A;  3TSP A;  3VTI A;  3TSU A;  3VES A;  3TSQ A;  3VF4 A;  3VER A;  3TTF A;  3TTC A;  3VF2 A;  3VET A;  3VEO A;  3VEW A;  3TTD A;  3VTH A;  3VEX A; 
#chains in the Genus database with same CATH topology
 2DFE A;  3IFR A;  5AQT A;  1Q82 O;  5J1E A;  4FL9 A;  4A62 A;  3I0R A;  3K5N A;  3G6E N;  3DLL L;  2VYP A;  4KAZ A;  3DAW A;  3I0S A;  4E7L A;  3DRS A;  3TAM A;  3KHY A;  4IXC A;  5AQH A;  4HVZ A;  2OCE A;  4IDH A;  4CGF A;  4CZL A;  3PLA A;  3OHR A;  1CLQ A;  3P83 D;  4KHW A;  3O3F A;  2KFN A;  3AVH A;  4J2D A;  3EE9 A;  4X62 K;  1OKJ A;  5F1X A;  2HF4 A;  4JI5 K;  5JS1 A;  4LSL A;  3OYH A;  1FJG K;  3IAB A;  4LF6 K;  4P6P A;  1RGI A;  1EXQ A;  1SL1 A;  3ZT3 A;  3LPU A;  5BRH A;  3EL2 A;  1F21 A;  3KTQ A;  1E4G T;  1JLB A;  1YJ9 N;  1S72 N;  3H3O B;  4KHQ A;  1Q9Y A;  3ZET B;  3QIO A;  4DG1 A;  3TAF A;  5BPL A;  3HI0 A;  3DYA A;  4BR0 A;  1DCJ A;  3QBW A;  4B1W B;  2ZGZ A;  3ZLJ A;  1MWK A;  4JYA K;  3CJA A;  3A8Y A;  2VWB A;  3QBX A;  1RIL A;  1NGD A;  3LQU A;  1X3M A;  5M1Q A;  3WXJ A;  4CHZ A;  2RN2 A;  2D0A A;  4B3S K;  5DK5 A;  3O9U A;  3HP6 A;  4YOW A;  3EKU A;  1NJ5 A;  4WCE L;  1W7A A;  5C2D A;  4YHH K;  3H08 A;  3G4S N;  4DQ8 A;  1Z05 A;  4CBU A;  3SPZ A;  4WYB A;  5A2Q O;  4O5B A;  1T7P A;  2QEX N;  1L3T A;  4IOX A;  5AQU A;  3K5M A;  2O8D B;  2HST A;  4GY2 B;  4Z4H A;  2P9S B;  4IO9 L;  3SPY A;  2G8K A;  1RTH A;  2KFZ A;  3M6G A;  3NCI A;  3P31 A;  3L4Q A;  4KFB A;  3SV3 A;  3NE6 A;  4G9Z A;  4E7J A;  1HRU A;  4FVU A;  3LL3 A;  2LSN A;  2GUI A;  3CFP A;  2Q1N A;  1BG3 A;  3QFU A;  4MO5 A;  1E3M A;  5HRN A;  3O1B A;  4CHN A;  3SMP A;  2QI2 A;  1JL2 A;  1VK0 A;  3MEE A;  3E1Y A;  1U45 A;  4CJ3 A;  1RT5 A;  3EZW A;  4BRP A;  4FBQ A;  3F73 A;  3V4I A;  1N33 K;  5CZ1 A;  5M1O A;  4AM6 A;  4KI4 A;  4I2Q A;  5ADX A;  5KPT A;  3O6W A;  4B8C A;  2P9U A;  4F9O A;  2G8F A;  3JSM A;  1C0T A;  4O8K A;  1SAZ A;  4OPH A;  1KQS M;  4DCH A;  4CZK A;  3GG4 A;  1U2V A;  5KGW A;  4EIA A;  1XC9 A;  4FJ5 A;  1WSE A;  2YI1 A;  4IZ9 A;  3S3M A;  5AQZ A;  1P90 A;  4EHU A;  4FM1 A;  1NK9 A;  3ZIE A;  1TKD A;  4FK2 A;  1VSJ A;  3V81 A;  4ELV A;  1YUW A;  2IIR A;  2JLE A;  1C1C A;  4CVN E;  1RBS A;  4MLE A;  4CZM A;  5TKY A;  3ZT1 A;  2E8A A;  4EHT A;  1L3S A;  2RE2 A;  1G15 A;  3DLB A;  4KTZ A;  4XIU A;  1S3X A;  4FK4 A;  3ZSQ A;  3G0Z A;  4IJN A;  1ZBS A;  4UQG A;  4IWV A;  2Q97 A;  4GV6 A;  2V7Z A;  2NRX A;  2YNG A;  4Q15 A;  2YKM A;  5M1K A;  4LF9 K;  2M71 A;  3CCQ N;  1RDB A;  5AQI A;  1NJ1 A;  3LDS A;  4OVL A;  1NGE A;  1Q9X A;  4CZI A;  1TKT A;  1DTT A;  4OPJ A;  1N8R O;  3U9D A;  4K86 A;  2F8T A;  1RDW X;  4DSL A;  4O0J A;  2FBV A;  4LH5 A;  5BRF A;  3WBM A;  2NRR A;  5BN9 A;  3NGZ A;  1IBL K;  2WBN A;  3L4I A;  1ESV A;  4TWA A;  4E1N A;  3SQ4 A;  3CM5 A;  1Q81 O;  4JKG A;  1GOC A;  5DM7 L;  4M3T A;  3TU5 A;  3FR0 A;  3ZSO A;  4PHT X;  1VQO N;  3CJ7 A;  3P4I A;  1Z6R A;  2ASP A;  4BR4 A;  3NF7 A;  5E41 A;  4KH4 A;  1ASW A;  3A5L C;  4YNQ A;  4W5O A;  3HM9 A;  4FM0 A;  1J5O A;  1QSY A;  1TGO A;  5JLH A;  5KPR A;  2VQF K;  2L8Y A;  1DLO A;  4NXM K;  4YY3 K;  4DR3 K;  5T7B A;  1O13 A;  2ASO A;  3CCE N;  2WFB A;  3Q7B A;  3M5R A;  3SAG A;  2IVO A;  4CIE A;  4DR6 K;  4QS8 A;  3KWG A;  4Y1D A;  2IFE A;  4GV9 A;  3LAN A;  4W5R A;  3L2W A;  4JI7 K;  3CC7 N;  3L7V A;  3S41 A;  4GVE A;  4QCL A;  3CYM A;  4CHP A;  5CYQ A;  4CJT A;  4FJG A;  3AY9 A;  4KBO A;  3NH1 A;  2ZJQ L;  5AQF A;  1TUU A;  3D2F B;  1VSK A;  3AO2 A;  4E1B A;  3KIO A;  4FW2 A;  4C23 A;  3LP2 A;  3SQ0 A;  1IO2 A;  3C7N B;  3AVA A;  1T05 A;  1SKW A;  4MO4 A;  4OPK A;  1S1U A;  1VSE A;  4DUZ K;  1V4T A;  3AO4 A;  3K9K A;  1K73 O;  1KD1 O;  1VSI A;  2H3G X;  2UYT A;  3D7E O;  3DXK A;  3V9W A;  4FWL A;  4RWT A;  2DTU A;  4E0D A;  1ATN A;  1BL3 A;  3T1H K;  2A2Y A;  3F5T A;  2F7T A;  1QTM A;  3CJ1 A;  3TI0 A;  3FZF A;  3ZSX A;  4Q0B A;  3S3N A;  5DMR A;  4BRG A;  4CHQ A;  4M3U A;  5AQQ A;  4IEE A;  3VN5 A;  4PKI A;  4CF9 A;  5SZT A;  3C94 A;  4NB4 A;  3QEP A;  5KRT A;  4DMN A;  3VER A;  3D6R A;  4FJ9 A;  4NZT M;  3ZT4 A;  3C65 A;  2ZGY A;  1KAX A;  1BU6 O;  4CF1 A;  1NMD A;  3C0B A;  2DY4 A;  3SUN A;  1NOZ A;  4E3S A;  1RTJ A;  4BRA A;  4ILH A;  1LV5 A;  1TL3 A;  5AQJ A;  1BHL A;  5C12 A;  4BC3 A;  3VF2 A;  4NLC A;  3THX A;  4WQ5 C;  3S9H A;  4A61 A;  1JCG A;  2YNF A;  5AQS A;  1VQ4 N;  4U67 L;  1TK8 A;  4IFV A;  4B3O A;  3ZX0 A;  5AZJ B;  1B92 A;  4N5S A;  2YCH A;  3H1V X;  2GWJ A;  3DRR A;  4AHU A;  3PIO L;  2P9N B;  2HBK A;  4CBW A;  1VHX A;  4K41 A;  4FJL A;  1K8K B;  1XWL A;  3TAE A;  3ID6 A;  5F0X A;  2OYQ A;  3KD5 E;  2Z1H A;  3Q7C A;  4KRF A;  3VQA A;  4J2E A;  3D2F A;  4JKF A;  3GBT A;  1RBU A;  2GV9 A;  3BEX A;  4B9L A;  1B9D A;  2KQ2 A;  2WUS A;  1HNI A;  3C7N A;  2IS3 A;  4AHC A;  2RPI A;  3V9S A;  3UIQ A;  4DR2 K;  1WBB A;  3DXK B;  4IOA L;  2P9U B;  4QOZ B;  4LF8 K;  5LY3 A;  3GL1 A;  4A57 A;  3P1G A;  4HCB A;  3P38 A;  1GLC G;  4DTO A;  2OPR A;  3FLC O;  3WEE B;  4P77 A;  2KKZ A;  1KCF A;  3DOL A;  1PVY A;  4CJE A;  1ZC6 A;  4DFK A;  1S8E A;  4P8J A;  2ITM A;  1WBD A;  1XI1 A;  3I55 N;  3K9J A;  1QHT A;  4BRK A;  3NH0 A;  1L3V A;  4TSX A;  3C6A A;  4HVJ A;  1WSH A;  1NJ2 A;  4WF9 L;  3IS9 A;  4NLB A;  4MQ3 A;  1OVQ A;  5EX5 A;  3RMD A;  5IWA K;  1SKS A;  1ATS A;  4JI1 K;  1IG9 A;  4CEA A;  1HX1 A;  3ATU A;  4I6M B;  4CJV A;  1W2B M;  1VR4 A;  3WNG A;  3L3U A;  1JLF A;  2G8U A;  1W0H A;  4FXD A;  4LH4 A;  5AFU H;  3VEW A;  4KHN A;  1C6V A;  2GX9 A;  3AA2 A;  4FWP A;  4C8K A;  3NFA A;  5AQO A;  4W5T A;  4XEI A;  3L0Q A;  4R79 A;  3CCS N;  1T8E A;  5BRD A;  5FPN A;  3QKB A;  1LWC A;  5E26 A;  1GLB G;  3NMU A;  5AZJ A;  1NFH A;  4H5W A;  1RNH A;  3CQY A;  4Z4G A;  4AHS A;  5BN8 A;  2P9N A;  3OYG A;  3QIC A;  4O0I A;  3T1A A;  5J2M A;  3J81 O;  3LWL A;  4BRL A;  5I9E B;  2KZZ A;  1JO0 A;  1HYS A;  2P51 A;  3VMF B;  2AP1 A;  4CGG A;  3T1I A;  2ZWH A;  1NGB A;  2E2N A;  3TSU A;  1NGG A;  4N41 A;  2YNI A;  4B9U A;  3I33 A;  2VGM A;  1SKR A;  3K0S A;  1QQM A;  4A5B A;  1YVU A;  4KH6 A;  3KK3 A;  1XHZ A;  3FFK B;  2VWK A;  2OTL N;  3HO1 A;  2Q0R A;  3T3F A;  3TTD A;  3IAY A;  1NJI O;  3R8E A;  2W40 A;  2D4W A;  2FBX A;  3F9K A;  1Q86 O;  3H3N O;  1NGA A;  1UOC A;  1O1W A;  3MAQ A;  2P9I B;  4ICL A;  4R5P A;  3J80 O;  4J2A A;  4BDZ A;  2CH6 A;  4WFB L;  3CF5 L;  4JS5 A;  2OPS A;  3ENH A;  1VQ5 N;  3AVI A;  1H1V A;  3VF6 A;  3K5L A;  3SMS A;  4AH9 A;  2E1Y A;  5GIO A;  3CHW A;  1HRH A;  1ITG A;  4I6M A;  4Y1C A;  2HHX A;  1YTA A;  2HVH A;  1BA1 A;  2O4I A;  2GBZ A;  2W42 A;  3LM9 A;  1REV A;  5FPM A;  5ADX H;  4CFD A;  3M1F A;  1LAW A;  1G57 A;  3O9Q A;  1SUQ A;  3H46 O;  3T69 A;  4DR4 K;  4M7X A;  4CJ7 A;  3L2Q A;  4BAC A;  3WNE A;  4NZR M;  4NCX A;  3BUZ B;  5FRN A;  2O4G A;  4DR7 K;  1NJY A;  5BRE A;  3DLG A;  3MEC A;  4B9M A;  4FZY A;  2O8E B;  4C8N A;  3O4W A;  3QNN A;  2VG7 A;  3LP0 A;  1XC3 A;  4JS4 A;  4DSI A;  3OS0 A;  3AGK A;  4RW8 A;  4JRQ A;  3EKS A;  2QA4 N;  3ZSY A;  4CGJ A;  3JS6 A;  4Z4E A;  4H0V B;  3M8S A;  2NRZ A;  1OH5 A;  3HOS A;  4MLH A;  1D9D A;  3D2E A;  2G8V A;  2PYL A;  4KHS A;  3FZL A;  2P9L A;  3QLH A;  4JD2 A;  1KK9 A;  4CEB A;  3E9O A;  4BRE A;  1K9M O;  4F8R A;  4O5F A;  1VQ9 N;  4WE1 A;  4MFB A;  2D0B A;  3O1W A;  4I7F A;  4DV1 K;  5EXW A;  3VQD A;  2X74 A;  3VA0 A;  2PBD A;  5LMN K;  3BF1 A;  4FCX A;  2Z1G A;  3KK1 A;  1WSJ A;  1EP4 A;  1WAF A;  3LAM A;  4CK3 A;  5KRS A;  1UA0 A;  4K8Z A;  3VEX A;  5AQW A;  2V52 B;  4AHV A;  3MN7 A;  2WOM A;  1MA9 B;  1PVW A;  4F3T A;  3VGK A;  3VQ8 A;  1NMN A;  3LAK A;  3TAB A;  1NG9 A;  3VQ5 A;  3MCP A;  4LFB K;  1Q8I A;  3RRH A;  2QKK A;  3AAR A;  2QKB A;  5LL6 Z;  4B9V A;  3VEY A;  2Q0U A;  1TYQ A;  1CZ9 A;  5I42 A;  2BE2 A;  4H4M A;  4NO7 A;  4H8K A;  1UDV A;  1QVG M;  4OGE A;  4N56 A;  3DSC A;  2Q2R A;  3S3O A;  3VQP A;  3AA4 A;  3VTH A;  3EZ5 A;  3IMX A;  4YKE A;  3V9U A;  4PWD A;  1VAZ A;  2A3Z A;  1IKX A;  3KLF A;  4O4G A;  3CJC A;  3SQ2 A;  2QXF A;  4LF4 K;  2CRQ A;  3HZ7 A;  2G8I A;  2O8B A;  3SI6 A;  3QIN A;  4H0O A;  3R3L A;  1X3N A;  1JLE A;  1HKB A;  4BRC A;  5FRM A;  1QQC A;  3UB5 A;  2F8S A;  3ZT2 A;  4B9S A;  4I14 A;  3AVK A;  3U9Z A;  2ETJ A;  3VF4 A;  3AVL A;  1KRP A;  4M3Y A;  4FJN A;  1YHQ N;  3HOT A;  1BIU A;  3I8B A;  1QZ5 A;  3AVJ A;  1GLJ O;  1RBV A;  4ELT A;  2A1R A;  4DV3 K;  4IO8 A;  2UU9 K;  4FJ7 A;  1HKC A;  4IOC L;  3ZSV A;  2OA8 A;  2FF3 B;  3K57 A;  2GTC A;  3L2V A;  4J2B A;  4KTW A;  4EP4 A;  4BR9 A;  3RSE A;  3HST B;  1IKW A;  4Z4F A;  4PQU A;  2QXL A;  1QSS A;  3MGZ A;  1IH7 A;  1IKY A;  1S6Q A;  3HPG A;  3ZSW A;  3SJH A;  2O8C A;  3MN6 A;  1NNE A;  2GUP A;  4CJQ A;  2GEL A;  4DSF A;  3IKM A;  3VQ4 A;  2I7P A;  4FLX A;  2XY6 A;  2ZE2 A;  5JS2 A;  4DLG A;  3QET A;  3ATV A;  2R7Y A;  4BG9 A;  2QM1 A;  3RVC A;  1QE1 A;  4FJH A;  5DM6 L;  4IKF A;  5D3G A;  4HTU A;  3OYC A;  3LZI A;  1L3U A;  4JKE A;  3PX0 A;  3SJJ A;  4ID1 A;  4DF4 A;  3U3Y A;  4ILG B;  3P39 A;  1P8Z A;  1TYQ B;  3L2R A;  1Z26 A;  3ZET A;  4P6D A;  4KPY A;  2XHB A;  1TL1 A;  5AQL A;  4IG3 A;  2BDP A;  2D5R A;  4K0K K;  5JVG L;  2A42 A;  3VQ9 A;  3AA3 A;  2WTU A;  3MK6 A;  4FZZ A;  5JLF A;  5CZ2 A;  4HHT A;  4BWM A;  4BWJ A;  4DV6 K;  1I39 A;  1Y64 A;  4OO1 J;  4BE2 A;  4PUO A;  1HNX K;  3VET A;  3KJV A;  2P9I A;  3PV8 A;  3ZSR A;  3H45 C;  1ASV A;  5FPD A;  3THW A;  4FJK A;  2ZQB A;  2PZS A;  3JYT A;  4CEE A;  4G1Q A;  4BC5 A;  4M3W A;  3CD6 N;  3EN9 A;  3NF9 A;  3TTF A;  3FZH A;  3AA5 X;  3UKR B;  4WQ4 C;  4L8R B;  4OLB A;  1H4S A;  4FLW A;  1BIZ A;  4K42 A;  5CHI A;  1VQL N;  4ELU A;  1EO1 A;  5M1P A;  4DQI A;  1KFD A;  1TKZ A;  3L3V A;  3SBG A;  1HJO A;  4JHD A;  1XQS C;  3CJ9 A;  4PL7 A;  3IAL A;  4DSE A;  3LVJ C;  1FXX A;  3C6T A;  1RT4 A;  4H0Y B;  5HP1 A;  5HOO A;  4BRQ A;  1A5V A;  1Z25 A;  4F2R A;  4H5T A;  1KTQ A;  4B3T K;  5BR9 A;  3HBT A;  4DSJ A;  1LW0 A;  3OVN A;  1G99 A;  3KK7 A;  4BRI A;  5GAG P;  4V19 S;  2HF3 A;  1JL1 A;  4Z9E A;  2ZJP L;  5AQR A;  4AQY K;  2E20 A;  4RTF D;  3WT0 A;  4JKA A;  3CCR N;  3EE8 A;  4CF2 A;  3DLE A;  2UXB K;  4JV5 K;  4GKK K;  4JNE A;  3CIP A;  3O9R A;  4PA1 A;  4DWI A;  1S1V A;  3A0I X;  4OKE A;  2NLX A;  3ALY A;  3CG7 A;  4B1Y B;  2JGU A;  4FOI A;  5EY4 A;  3HPO A;  2JWL A;  4BQZ A;  1HNW K;  1LW2 A;  4CEF A;  3VA3 A;  4B1V A;  3VEV A;  2P9P A;  3TSQ A;  1C1A A;  4M42 A;  4JI3 K;  1RQ8 A;  4CFB A;  3THY B;  3QO9 A;  1A5X A;  3VQ7 A;  4IG0 A;  4AHT A;  4ZHR A;  3UKU A;  4PKG A;  2OZM A;  1JCU A;  1D5A A;  4IFE A;  1IJJ A;  4HUE A;  4AIL C;  1YT3 A;  5IT9 O;  3C6U A;  3OJU A;  1NGH A;  2HW3 A;  5J2Q A;  3L6Q A;  4CEC A;  2E4L A;  2Y1J A;  1B9F A;  1K8A O;  3VEN A;  4BE0 A;  1EX4 A;  1TUY A;  1BOT O;  4E1M A;  4FW1 A;  1VSF A;  4CIF A;  5CE3 A;  4CZE A;  3IRX A;  3LDN A;  4FVM A;  4DTR A;  3NVK A;  1CZB A;  3OBW A;  4LD0 A;  3J7Y P;  3OW2 M;  4B9N A;  3LDL A;  1WB9 A;  3E9P A;  2RF2 A;  3I8D A;  2HHS A;  1JCF A;  1NWK A;  2QWP A;  5AQK A;  4CD3 A;  4CZH A;  3AV9 A;  3ZSZ A;  3AGR A;  4DFP A;  1TAQ A;  1ATR A;  4RW4 A;  4WQ5 A;  4CF0 A;  5J2N A;  3KK2 A;  2EWS A;  4YOX A;  4IJA A;  3CCU N;  4FJ8 A;  2D0P A;  4K43 A;  2E88 A;  2XO7 A;  2D0O A;  4NCA A;  5B8H A;  5GAD P;  4E1J A;  1RT3 A;  4K25 A;  3LP1 A;  5M1N A;  4HVC A;  1HNZ K;  4BGA A;  3RSE B;  4DV2 K;  1QZ6 A;  4OJR A;  4YOT A;  4FFJ A;  3OYE A;  3ZII A;  3ZYY X;  4JK9 A;  3G25 A;  4KHU A;  3NVM A;  4GKJ K;  1T6D A;  2KLA A;  4A59 A;  4MDB A;  2O8C B;  1BWF O;  1NBW A;  1NK0 A;  3T7Z A;  3KWI A;  2BH1 A;  4B1Z A;  3PY8 A;  3PIP L;  4CFA A;  2ITG A;  3PX4 A;  4BGB A;  1VQP N;  4HWI A;  5HRS A;  1ZBI A;  1N32 K;  4FO0 A;  3J7A P;  4DS5 A;  3MED A;  3MMV A;  3E66 A;  4FJJ A;  4JI4 K;  1R0A A;  3UKU B;  1W9H A;  4K88 A;  5I3U A;  4BRM A;  4M3R A;  3IG1 A;  3AVN A;  1XUP O;  3HT3 A;  2G8H A;  2LN3 A;  3DXM B;  4E7K A;  4Z94 A;  4YOU A;  1LCU A;  1IKV A;  3OYJ A;  4CK1 A;  4M45 A;  3BY5 A;  4J8F A;  1GOA A;  1CZA N;  3BZC A;  3FGU A;  5MLC Q;  4GV3 A;  4K8X A;  1II7 A;  4DFJ A;  1LWE A;  1BUP A;  3U4L A;  4EZ9 A;  3P5J A;  4DLE A;  4P6C A;  1WSG A;  1S6P A;  1HPM A;  4GVM A;  3HP9 A;  1RDC A;  4HTL A;  3V1R A;  3F2K A;  5AQN A;  2Y1I A;  3MIO A;  2RIS A;  1S9G A;  1KAY A;  4BR2 A;  4PKH A;  4F2S A;  4N76 A;  4H5R A;  3MX5 A;  1YTU A;  1S9E A;  1N34 K;  3W0L A;  1OH8 A;  4CJ4 A;  5LJV A;  2EQA A;  4CJR A;  2O8F B;  3UKR A;  1CXU A;  2DFH A;  4DV5 K;  1Y97 A;  2HBL A;  1SV5 A;  3EEQ A;  2HBJ A;  2P5O A;  1PAV A;  4CES A;  4JHD B;  5AFU A;  4FLY A;  4FJI A;  3E01 A;  4BDY A;  3WXI A;  1GOB A;  1H0Y A;  5JIC A;  3AVB A;  1OVY A;  1NKB A;  1K8K A;  2A5X A;  4DTS A;  4X65 K;  4JAX A;  3PSF A;  4CJL A;  4JK8 A;  1K49 A;  4AM7 A;  1KSP A;  2HOE A;  4H0T B;  3RTV A;  4JKG B;  4DU1 A;  3MWT A;  3LRJ A;  1J6Z A;  1ZBF A;  4ILJ A;  4BE1 A;  3BGR A;  3ULE A;  1IBM K;  2YKN A;  4AHR A;  1JKH A;  5AQY A;  1NH9 A;  1HJR A;  5AQV A;  4DQR A;  1T6C A;  3VGL A;  3MX2 A;  4FWM A;  1H4Q A;  3SQ1 A;  5AR0 A;  3MN9 A;  2YV0 X;  4LFC K;  1N5Y A;  5C2F A;  3AO3 A;  4CJU A;  4KTQ A;  1RFQ A;  3AVG A;  4CZJ A;  2W41 A;  2UUB K;  2V51 B;  1GLD G;  2OAN A;  1RT6 A;  3KZB A;  2J4R A;  2QK9 A;  1GLE G;  2YHY A;  4OLF A;  3D45 A;  4M3Z A;  2BTF A;  1J54 A;  3CFO A;  3QDK A;  2E5L K;  4M41 A;  5EVZ A;  1QHA A;  3WXK A;  2Z1J A;  3J8A A;  4CI6 A;  4CZF A;  3M3Z A;  4BQL A;  4PL8 A;  3SAF A;  2CH5 A;  3DRP A;  2WC9 A;  1JCE A;  1NKE A;  1VQ8 N;  3CC4 N;  3A5N C;  3ENO A;  4FK0 A;  3NBP A;  3QEI A;  1X9W A;  2VGN A;  1ZBH A;  2D1K A;  1KVC A;  2Q3S A;  3A2F A;  3DJC A;  4JK7 A;  2X6N A;  3KLE A;  2HBM A;  4O8U A;  1EET A;  1LOT B;  4BC4 A;  2MX1 A;  1DKG D;  3VQB A;  4O55 A;  3ZX3 A;  1K4L A;  1DEJ A;  4CJF A;  2Q36 A;  1VM0 A;  2O8D A;  4CCH A;  4JKH A;  4UY8 O;  4BRN A;  2P9S A;  4JLH A;  4DB3 A;  2NZT A;  4LY7 A;  2D0C A;  1ZBU A;  4RW6 A;  2PY5 A;  1U47 A;  3TR8 A;  1RBT A;  1JLG A;  4BVP A;  4DQP A;  1HLU A;  4N47 A;  4DTJ A;  3OYA A;  3LVK B;  1DTQ A;  4CJP A;  1NJX A;  1VQ6 N;  1U4B A;  4B08 A;  2P9K A;  1SL2 A;  4DV4 K;  3LDO A;  4B9Q A;  1M1K O;  2KW4 A;  4ISG A;  4HCC A;  2X6S A;  4Z0U A;  2NRT A;  1KAZ A;  1LN4 A;  3THX B;  3VOV A;  1Y9X A;  2ATQ A;  1W97 L;  4ZTF A;  4M63 C;  2E1Z A;  5AQP A;  1S22 A;  4L3Q A;  1KXP A;  3OYI A;  4HUF A;  1WAJ A;  3K59 A;  3TSP A;  3EY1 A;  4M3X A;  2OPQ A;  1MWM A;  1XHX A;  4DFM A;  2FF6 A;  3HZ6 A;  1WOQ A;  3OYM A;  5C24 A;  1FK9 A;  3ITH A;  1JJ2 M;  3D0P A;  4B3R K;  1U2V B;  4I9L A;  4DTM A;  4PY5 A;  3SBT A;  4BRF A;  4IEI A;  4DHY A;  5AQM A;  3CME N;  4DU4 A;  4QAG A;  2HVI A;  4YFU A;  1HPZ A;  2VWJ A;  3VQ6 A;  1CXQ A;  1JDQ A;  1SNN A;  3CC2 N;  5C0Y A;  1NK7 A;  1RDA A;  1KFS A;  3O3G A;  3W3D A;  1K4I A;  3OJS A;  3KLI A;  4WFN L;  2F96 A;  3F9M A;  2H9U A;  4X66 K;  1TVR A;  1H4T A;  1XMO K;  3QIP A;  3U8X A;  5CR4 A;  3HTV A;  3HJF A;  3AO5 A;  1TK5 A;  3CPW M;  2HMP A;  2CGJ A;  4CW7 B;  4LFA K;  1JXE A;  1SL0 A;  4RW9 A;  1RDD A;  4H4O A;  3IDH A;  4RCH A;  4ISE A;  1HMV A;  2A41 A;  3QB0 A;  5KTQ A;  5J2P A;  1G58 A;  4BR5 A;  2P9B A;  3RMC A;  1NGF A;  3ZX2 A;  1U6Z A;  2YHW A;  2IC3 A;  4C8L A;  5ELZ A;  1BCM A;  4BC2 A;  1HC7 A;  2E6L A;  5K14 A;  3VPZ A;  2DPN A;  1TV6 A;  3DSD A;  4DV7 K;  3OBY A;  4KO0 A;  2O8E A;  2BAN A;  2HB5 A;  1YJN N;  2EHG A;  1X9S A;  2NUB A;  1GLA G;  1VQN N;  2IVN A;  2FC0 A;  2P9K B;  3SZ2 A;  1V4S A;  1HYZ A;  3TPQ A;  4C8M A;  3QEX A;  4FM2 A;  5JMV A;  2RHK A;  3IUC A;  5H1S Q;  5HRO A;  3TTC A;  5GIN A;  3D2E B;  4ID5 A;  2P9L B;  2CGK A;  2FBT A;  2QTD A;  4B9T A;  4E89 A;  4H5V A;  4IBN A;  2ZF5 O;  3HXM A;  3AAP A;  2YJE A;  2ZJR L;  3VES A;  4YOR A;  4CBX A;  3MN5 A;  2ASM A;  5HRP A;  3MK5 A;  3CET A;  3HSC A;  4DQQ A;  2NNW A;  4EZ6 A;  3AVF A;  3SCX A;  2EH1 A;  3RMA A;  3ZIG A;  3TAN A;  2WON A;  5C25 A;  4RW7 A;  3VQE A;  5FDL A;  1QQO A;  1D4X A;  3DM2 A;  3SNN A;  3ULD A;  4YOV A;  3PSI A;  4KH5 A;  3FZK A;  3NGI A;  4CIG A;  4MDA A;  3LPT A;  4NCG A;  5CYM A;  3MXI A;  2UXD K;  3C6H A;  1IG8 A;  1KVA A;  3AVM A;  3NGY A;  2P5G A;  3ID8 A;  1U49 A;  4DTU A;  4HD0 A;  1RTI A;  1EWQ A;  1NJW A;  1XEZ A;  2VCP A;  2YHA A;  3SK3 A;  1HNV A;  1Y2I A;  4YDQ A;  3NF6 A;  4JEP A;  3DI6 A;  3OYN A;  1KLM A;  4FPA A;  1FKO A;  1KVB A;  4DS4 A;  1YJW N;  1BQM A;  1I94 K;  2YX6 A;  1NU0 A;  2ZM6 K;  4CHO A;  4U7B A;  5FLX O;  4CD1 A;  4W5N A;  1BI4 A;  2XY8 A;  3QML A;  2HHU A;  4JN4 A;  5BPM A;  1YXQ A;  4O44 A;  3P04 A;  2AJQ A;  2IVP A;  1NJ6 A;  1IV0 A;  1TAU A;  3O9S A;  4Z4C A;  3G71 N;  1NK8 A;  3L2U A;  3CXC M;  3B8A X;  3ASM A;  4YDU C;  4CER A;  2B4J A;  3K58 A;  1VSH A;  4KHY A;  4BY9 C;  4P8E A;  3O3H A;  4CZG A;  2F9W A;  1C0M A;  3KKS A;  1T03 A;  3SUP A;  2XRI A;  4FJM A;  2E2Q A;  2RKI A;  2X78 A;  3OYK A;  3MDQ A;  1BO5 O;  4JRP A;  5HRR A;  3T19 A;  1J9A A;  4FCY A;  4DTN A;  4C8O A;  2HHT A;  3PX6 A;  2YJF A;  4AF1 A;  3KLH A;  2FSJ A;  3O5B A;  3UE5 A;  4B1X B;  4JI0 K;  3CI5 A;  2LXR A;  3MXM A;  2XY7 A;  3KVG A;  1D9F A;  3TAG A;  3QNO A;  4DR5 K;  4LF5 K;  3DMJ A;  1NJ8 A;  5KGX A;  2YHX A;  4FWK A;  3OYB A;  4B3M K;  4NYN A;  1WSI A;  3V9X A;  1RDU A;  1QSL A;  3DLH A;  4JD2 B;  2BKY X;  4JI6 K;  1MDU B;  2GTD A;  4I9Q A;  3HM8 A;  4YDU A;  3DLK A;  2JWK A;  3B6P A;  3LDQ A;  3MCA B;  1OH6 A;  4JI2 K;  3N4Q A;  2FLO A;  1M90 O;  2UUC K;  3VQC A;  3CPE A;  1YIT N;  3FFI A;  3O4Q A;  4DTX A;  3WEE A;  5HLF A;  1NGJ A;  4KKO A;  3ISN C;  4FSV A;  3VGM A;  3G10 A;  4FLT A;  1IBK K;  2QW9 A;  4GW6 A;  1WSF A;  3DWL A;  4FJX A;  1UWB A;  3C95 A;  3MEG A;  4A2A A;  2XY5 A;  2BGG A;  3R1X A;  3WUH A;  1K6Y A;  4XH5 A;  1NM1 A;  4OLA A;  1N36 K;  4BDP A;  1D8Y A;  1BI4 B;  4FYD A;  4DF8 A;  2QWN A;  1Q18 A;  3CER A;  4B1U B;  4CFC A;  2YHB A;  1QVF M;  4KRE A;  3RMB A;  3CCV N;  4KHP K;  3LS6 A;  1TKS A;  1YAG A;  3SV4 A;  1KC8 O;  3SAH A;  1TK0 A;  2O8B B;  1A5W A;  3ZCM A;  4DKW A;  2FSN A;  3WQT A;  3NHG A;  4A5A A;  4ZTJ A;  2Q3V A;  3O9T A;  3THV A;  2HHW A;  3MXJ A;  3V1O A;  1GLL O;  2UUA K;  1VSM A;  4NYF A;  1XNR K;  3SLC A;  3HVT A;  5EU7 A;  3U6F A;  2QWQ A;  3RR7 A;  1ZXO A;  2A6A A;  2HMI A;  2Z7C A;  4IFY A;  2Z1I A;  1L5U A;  4FWO A;  3A5M C;  1VQ7 N;  3I56 N;  5F2R A;  3VEZ A;  2E2O A;  1NJZ A;  5AZI A;  1SS6 A;  4BVO A;  2A1S A;  5HBM A;  3MWP A;  2RIU A;  4KB0 A;  3CQ8 A;  1HKG A;  3L8B A;  2HHQ A;  2CGL A;  2IGI A;  4H03 B;  1GLF O;  4GNI A;  4DV0 K;  3ZIH A;  3M8P A;  1S1W A;  5AQX A;  4WFA L;  1NGC A;  3RR8 A;  4EO0 A;  1UA1 A;  4E7H A;  3TWH A;  1U48 A;  4FWQ A;  3M8Q A;  5FPE A;  4A2B A;  2NRW A;  3V1Q A;  2V7Y A;  3RWU A;  3THY A;  1DGK N;  1U04 A;  1HQE A;  2F9T A;  1R59 O;  1VRU A;  3FE1 A;  4EFH A;  4QS9 A;  3EYZ A;  5KI6 A;  3B6O A;  3QEW A;  1TKU A;  3LP3 A;  1E4F T;  5C15 A;  3CFR A;  2PFU A;  1FW6 A;  1QS4 A;  4Y0W A;  1ZBL A;  3H07 A;  2DFF A;  4DSK A;  3NDK A;  4IDK A;  1BDG A;  1H0X A;  5GAH P;  3OYL A;  3VTI A;  1MU2 A;  2W6K A;  1VRT A;  4CEQ A;  1JLA A;  1T44 A;  3O4N A;  1YF5 L;  5KPZ A;  1NFJ A;  4BR7 A;  3ZT0 A;  3BF3 A;  1K4P A;  4JKC A;  3VEO A;  3CM6 A;  1WUA A;  1YVN A;  2IAJ A;  4FWR A;  5C10 A;  3KLG A;  3LAL A;  3PUF A;  1OH7 A;  3THW B;  1VSD A;  3LWM A;  1RBR A;  3CCL N;  4YOY A;  3TAP A;  3EO3 A;  2KZM A;  1HR0 K;  2VG5 A;  3HL8 A;  1T3V A;  4CJW A;  1J5E K;  4C1N I;  3HRG A;  3CQX A;  3QES A;  3KKR A;  4LC9 B;  5C42 A;  3TAR A;  1EWR A;  4EAH D;  3WXM B;  3O80 A;  5HL7 L;  3U3G A;  1EQY A;  2AA4 A;  4I2P A;  1X9M A;  1S1T A;  3J7Z O;  3CMA N;  1Q7Y O;  1YIJ N;  4W5Q A;  4FPB A;  2FSK A;  2F4V K;  4NCB A;  4FZX C;  4H5N A;  1NK6 A;  5M1F A;  1UAX A;  4F4K A;  3AO1 A;  5LMU K;  3ZEU B;  1JLC A;  4M7Y A;  4CGH A;  5AQG A;  1SZ2 A;  4CGI A;  1I3A A;  3NF8 A;  2GEM A;  4QS7 A;  2FXU A;  5GAE P;  1C1B A;  4BRO A;  1TIG A;  2QWL A;  1KLN A;  1QQN A;  1NOY A;  1RTD A;  1HUX A;  2EX3 A;  1XNQ K;  3DLR A;  3GOI A;  2HHV A;  3HPH A;  5LJW A;  2EK0 A;  1JLQ A;  1RT1 A;  3DXM A;  3WQU A;  2NRV A;  2B5J A;  1NK5 A;  3WNH A;  2UXC K;  4HUG A;  2IDO A;  3T1Y K;  2HNZ A;  2P9P B;  2W6L A;  4KB1 A;  4H0P A;  1J53 A;  2HHH K;  1ASU A;  4EP5 A;  1NK4 A;  1YI2 N;  1XMQ K;  4WI1 A;  3JAM O;  1K4O A;  3H1Q A;  4CF8 A;  3GE1 A;  2QWM A;  1BIS A;  2KTQ A;  4LSN A;  1S5J A;  1NGI A;  2IOC A;  2VG6 A;  4DUY K;  1NLV A;  5CY4 A;  4BRD A;  3O8M A;  2PYJ A;  4CED A;  5SWM A;  4RG8 A;  4OKJ A;  1VSL A;  1HQU A;  3QFP A;  4DTP A;  2OZS A;  1VQM N;  2HND A;  4KV8 A;  2QWO A;  4E19 A;  4FOE A;  1JXB A;  2Q31 A;  3CCJ N;  4JI8 K;  1DT9 A;  5AJ3 K;  4OGC A;  3CCM N;  3K2P A;  4CE9 A;  5JVH L;  2HNY A;  4BG8 A;  3OYF A;  4C1N K;  3OY9 A;  1BA0 A;  4B8A B;  4JKD A;  2NRH A;  3OS1 A;  4FLV A;  4GMJ B;  4ISF A;  4OX9 K;  3OTO K;  2G8W A;  3K5O A;  3DOK A;  2PAV A;  3ZEU A;  3AVC A;  1WNS A;  1C0G A;  4CEZ A;  4BRH A;  1ZYQ A;  1JE3 A;  2Y1B A;  1WLJ A;  4CHY A;  4FLZ A;  4DQS A;  3BP8 A;  5TKW A;  1EKE A;  3ULE B;  1TKX A;  1LAV A;  3PO5 A;  5AZI B;  2A40 A;  4OKK A;  1VQK N;  3RRG A;  3V6D A;  3QEV A;  2B6A A;  1RT7 A;  4DU3 A;  4FLU A;  1SQK A;  3AAQ A;  1X9J A;  4F3O A;  3WXL A;  3LDP A;  4WQ4 A;  1NKC A;  4CJS A;  4CEO A;  1WN7 A;  4CK2 A;  4CJ5 A;  3U6Y A;  3HVR A;  1C0U A;  2VQE K;  3OS2 A;  2KHO A;  3NAE A;  3SUO A;  3PO4 A;  1ILY A;  2FBY A;  3R9P A;  1HYV A;  3OA9 A;  4CGD A;  3SYZ A;  3KD1 E;  3HK2 A;  3BZK A;  3E9L A;  5KQ8 A;  1BQN A;  2I5J A;  3LM2 A;  3IAB B;  3N4P A;  1LWF A;  4E7I A;  4JKB A;  1C0F A;  4LF7 K;  2GWK A;  3VQQ A;  4K87 A;  3BDP A;  4FBK A;  3AJE A;  4XH4 A;  4OPA A;  4FWS A;  3FZM A;  5EOY A;  4Q5V A;  4DR1 K;  1X1P A;  1RT2 A;  1RCH A;  3JXU A;  2OTJ N;  4FBW A;  2E6M A;  4H0X B;  2E2P A;  3NH2 A;  4X64 K;  1N6Q A;  3TOE A;  5E84 A;  4KI6 A;  1S1X A;  4NXN K;  3WNF A;  3HYF A;  3M8R A;  3CJB A;  5GIP A;  4Z4I A;  4XH1 A;  3O08 A;  4CJK A;  3LZJ A;  2BUP A;  1K7J A;  3R6M A;  3ENB A;  3V9Z A;  3GDQ A;  5BR8 K;  3A5O C;  1FKP A;  2OPP A;  5KQD A;  2O8F A;  2ZD1 A;  1BGX T;  3H6E A;  3QER A;  1BCO A;  5FRO A;  2P1J A;  1IEZ A;  3OYD A;  3SUQ A;  2I7N A;  4FWN A;  2QWR A;  3TAQ A;  2YNH A;  5BPN A; 
#chains in the Genus database with same CATH homology
 3O5B A;  3UE5 A;  4B1X B;  3IFR A;  5AQT A;  4BGA A;  5I9E B;  1Q82 O;  3RSE B;  3CI5 A;  4FL9 A;  1QZ6 A;  4A62 A;  4YOT A;  4FFJ A;  3ZII A;  3ZYY X;  4JK9 A;  3G25 A;  3VMF B;  2AP1 A;  3KVG A;  3G6E N;  3NVM A;  3DLL L;  3T1I A;  2VYP A;  3DAW A;  1T6D A;  2KLA A;  2ZWH A;  1NGB A;  4A59 A;  2YHX A;  4FWK A;  4MDB A;  1BWF O;  2E2N A;  1NBW A;  3KHY A;  4IXC A;  5AQH A;  4HVZ A;  4IDH A;  3TSU A;  3T7Z A;  4CZL A;  3KWI A;  3OHR A;  1NGG A;  1RDU A;  2BH1 A;  4B1Z A;  3I33 A;  3PIP L;  2VGM A;  4JD2 B;  4BGB A;  1VQP N;  1QQM A;  4HWI A;  1MDU B;  2GTD A;  4A5B A;  3HM8 A;  4KH6 A;  3EE9 A;  4FO0 A;  4YDU A;  3FFK B;  2JWK A;  1OKJ A;  2OTL N;  5F1X A;  3LDQ A;  3MMV A;  2HF4 A;  3MCA B;  3E66 A;  2Q0R A;  3N4Q A;  2FLO A;  3TTD A;  3UKU B;  1YIT N;  3CPE A;  1M90 O;  4P6P A;  1NJI O;  1RGI A;  4BRM A;  3R8E A;  3WEE A;  1NGJ A;  2W40 A;  4FSV A;  2D4W A;  3VGM A;  1XUP O;  2LN3 A;  5BRH A;  3EL2 A;  1Q86 O;  3DXM B;  1NGA A;  3H3N O;  4Z94 A;  1E4G T;  1LCU A;  2QW9 A;  4YOU A;  1YJ9 N;  1S72 N;  3H3O B;  4J8F A;  3DWL A;  1CZA N;  2P9I B;  3ZET B;  3FGU A;  5MLC Q;  4GV3 A;  4A2A A;  5BPL A;  3R1X A;  3HI0 A;  3WUH A;  4XH5 A;  2CH6 A;  4BR0 A;  4WFB L;  1BUP A;  3U4L A;  3QBW A;  1NM1 A;  4B1W B;  2ZGZ A;  1MWK A;  3CJA A;  3CER A;  1Q18 A;  3A8Y A;  2QWN A;  2VWB A;  3ENH A;  3QBX A;  4B1U B;  3CF5 L;  1VQ5 N;  4P6C A;  1H1V A;  1HPM A;  1NGD A;  1QVF M;  4HTL A;  3VF6 A;  1X3M A;  5M1Q A;  3SMS A;  3WXJ A;  3LQU A;  2E1Y A;  5GIO A;  3CCV N;  3F2K A;  3CHW A;  5AQN A;  3LS6 A;  4I6M A;  1TKS A;  1YAG A;  3O9U A;  3MIO A;  1KC8 O;  4YOW A;  3EKU A;  1BA1 A;  4WCE L;  1Q7Y O;  3SAH A;  2RIS A;  1KAY A;  4BR2 A;  4PKH A;  5C2D A;  3LM9 A;  4H5R A;  4DKW A;  3MX5 A;  5FPM A;  2FSN A;  3WQT A;  3G4S N;  5ADX H;  1G57 A;  3M1F A;  4A5A A;  4DQ8 A;  1Z05 A;  3W0L A;  3O9Q A;  3O9T A;  4CBU A;  4WYB A;  3H46 O;  3T69 A;  5LJV A;  2QEX N;  4M7X A;  4CJ7 A;  2EQA A;  4NZR M;  4IOX A;  1GLL O;  3BUZ B;  5AQU A;  3UKR A;  2HST A;  3SLC A;  4GY2 B;  2QWQ A;  5BRE A;  1ZXO A;  2A6A A;  2HBL A;  2P9S B;  4IO9 L;  2HBJ A;  3O4W A;  4JHD B;  5AFU A;  3M6G A;  4FWO A;  3A5M C;  1VQ7 N;  3I56 N;  5F2R A;  1XC3 A;  3P31 A;  3WXI A;  3VEZ A;  2E2O A;  3AGK A;  3L4Q A;  5AZI A;  1SS6 A;  3EKS A;  5JIC A;  2QA4 N;  4BVO A;  4G9Z A;  1OVY A;  1HRU A;  3JS6 A;  4FVU A;  4H0V B;  1K8K A;  3MWP A;  2A5X A;  3LL3 A;  2RIU A;  2NRZ A;  4JAX A;  3HOS A;  4MLH A;  1HKG A;  4JK8 A;  1K49 A;  3D2E A;  2Q1N A;  3FZL A;  1BG3 A;  3QFU A;  4MO5 A;  2P9L A;  3O1B A;  4AM7 A;  2CGL A;  4JD2 A;  4H03 B;  1KK9 A;  3SMP A;  3E9O A;  1GLF O;  2QI2 A;  4BRE A;  2HOE A;  4GNI A;  4O5F A;  3E1Y A;  1K9M O;  1VQ9 N;  3ZIH A;  4H0T B;  4JKG B;  5AQX A;  4WFA L;  1NGC A;  3MWT A;  3O1W A;  3LRJ A;  3EZW A;  4EO0 A;  1J6Z A;  4BRP A;  4FBQ A;  4FWQ A;  4ILJ A;  5EXW A;  3ULE A;  5FPE A;  4A2B A;  2PBD A;  3PLA A;  2NRW A;  5M1O A;  4AM6 A;  3BF1 A;  5AQY A;  5ADX A;  4FCX A;  2V7Y A;  5AQV A;  5KPT A;  3O6W A;  1T6C A;  2P9U A;  3VGL A;  3MX2 A;  4FWM A;  3VEX A;  5AQW A;  4F9O A;  2V52 B;  1DGK N;  3MN7 A;  5AR0 A;  1MA9 B;  2F9T A;  1SAZ A;  3MN9 A;  4O8K A;  1R59 O;  3FE1 A;  4OPH A;  1PVW A;  1KQS M;  3VGK A;  4EFH A;  4DCH A;  4QS9 A;  4CZK A;  5C2F A;  3GG4 A;  1TKU A;  1RFQ A;  1E4F T;  4CZJ A;  2W41 A;  1U2V A;  2V51 B;  3MCP A;  1GLD G;  2OAN A;  2PFU A;  5C15 A;  4EIA A;  3KZB A;  4Y0W A;  3AAR A;  3H07 A;  2J4R A;  1GLE G;  2YHY A;  2Q0U A;  1TYQ A;  3VEY A;  2YI1 A;  4IZ9 A;  1BDG A;  5GAH P;  2BTF A;  5AQZ A;  1P90 A;  3VTI A;  4NO7 A;  4EHU A;  1QVG M;  3QDK A;  2Q2R A;  5EVZ A;  1QHA A;  3WXK A;  3ZIE A;  3VTH A;  3IMX A;  4YKE A;  3J8A A;  1T44 A;  1VAZ A;  1YUW A;  2A3Z A;  1YF5 L;  2IIR A;  3M3Z A;  4BQL A;  4CI6 A;  4PL8 A;  3CJC A;  4BR7 A;  4CZF A;  5KPZ A;  3SAF A;  4MLE A;  2CH5 A;  5TKY A;  4CZM A;  2WC9 A;  1JCE A;  1VQ8 N;  3BF3 A;  3CC4 N;  2E8A A;  3A5N C;  4EHT A;  4H0O A;  3R3L A;  1K4P A;  1X3N A;  3ENO A;  4JKC A;  1HKB A;  2RE2 A;  3VEO A;  4BRC A;  3UB5 A;  1WUA A;  2VGN A;  4I14 A;  1S3X A;  3U9Z A;  2D1K A;  1YVN A;  3DJC A;  4JK7 A;  4FWR A;  3VF4 A;  5C10 A;  2HBM A;  4O8U A;  4IJN A;  1LOT B;  1ZBS A;  4BC4 A;  4IWV A;  2MX1 A;  1DKG D;  2Q97 A;  4GV6 A;  2V7Z A;  3ZX3 A;  1YHQ N;  1DEJ A;  3HOT A;  2NRX A;  1K4L A;  3I8B A;  2Q36 A;  1QZ5 A;  5M1K A;  4JKH A;  4UY8 O;  3CCL N;  1GLJ O;  4BRN A;  3CCQ N;  5AQI A;  2P9S A;  4YOY A;  3EO3 A;  4DB3 A;  1T3V A;  1NGE A;  4CZI A;  2NZT A;  4IO8 A;  4C1N I;  3HRG A;  1HKC A;  3CQX A;  3U9D A;  4IOC L;  4LC9 B;  1N8R O;  4EAH D;  1RDW X;  3WXM B;  2FF3 B;  4BVP A;  1HLU A;  3O80 A;  5HL7 L;  5BRF A;  1EQY A;  2AA4 A;  4BR9 A;  3RSE A;  2NRR A;  5BN9 A;  1VQ6 N;  2P9K A;  2WBN A;  3J7Z O;  3CMA N;  3L4I A;  3LDO A;  2QXL A;  1ESV A;  4B9Q A;  1YIJ N;  4FPB A;  2FSK A;  1M1K O;  3MGZ A;  1Q81 O;  4JKG A;  4ISG A;  5DM7 L;  3SJH A;  4H5N A;  3MN6 A;  3TU5 A;  3FR0 A;  2NRT A;  2GUP A;  4PHT X;  1VQO N;  1KAZ A;  3CJ7 A;  2GEL A;  3P4I A;  1Z6R A;  2ASP A;  4BR4 A;  5M1F A;  3IKM A;  4KH4 A;  3VOV A;  3A5L C;  2I7P A;  1W97 L;  3ZEU B;  4M63 C;  2E1Z A;  4M7Y A;  5AQG A;  5JLH A;  1SZ2 A;  5KPR A;  5AQP A;  2GEM A;  1S22 A;  4L3Q A;  1KXP A;  4QS7 A;  3ATV A;  2FXU A;  3TSP A;  4BG9 A;  1O13 A;  2QM1 A;  2ASO A;  3RVC A;  5GAE P;  3CCE N;  2WFB A;  3Q7B A;  4BRO A;  3M5R A;  3SAG A;  1MWM A;  5DM6 L;  2FF6 A;  2IVO A;  2QWL A;  1QQN A;  3HZ6 A;  4QS8 A;  1WOQ A;  3KWG A;  1HUX A;  4JKE A;  1JJ2 M;  3GOI A;  4GV9 A;  1U2V B;  3SBT A;  4BRF A;  5LJW A;  4IEI A;  3CC7 N;  4DHY A;  5AQM A;  3L7V A;  4ILG B;  3DXM A;  3S41 A;  3WQU A;  3CME N;  4GVE A;  3P39 A;  1P8Z A;  2NRV A;  1TYQ B;  3AY9 A;  4KBO A;  2ZJQ L;  5AQF A;  3ZET A;  4P6D A;  1TUU A;  3D2F B;  1SNN A;  4E1B A;  3CC2 N;  5C0Y A;  4C23 A;  2P9P B;  5AQL A;  4H0P A;  3W3D A;  3C7N B;  1K4I A;  5JVG L;  4MO4 A;  1YI2 N;  1K73 O;  1V4T A;  3K9K A;  2A42 A;  4WFN L;  1KD1 O;  1K4O A;  2H3G X;  3H1Q A;  2UYT A;  3D7E O;  3F9M A;  3DXK A;  4FWL A;  3MK6 A;  5JLF A;  3U8X A;  4RWT A;  3GE1 A;  5CR4 A;  3HTV A;  2QWM A;  3CPW M;  1Y64 A;  1ATN A;  4OO1 J;  1NGI A;  2HMP A;  2CGJ A;  3VET A;  2P9I A;  1NLV A;  3F5T A;  3H45 C;  2F7T A;  5FPD A;  4BRD A;  3IDH A;  3O8M A;  4RCH A;  4ISE A;  2A41 A;  3QB0 A;  1G58 A;  3CJ1 A;  4BC5 A;  4BR5 A;  2P9B A;  3CD6 N;  1NGF A;  3FZF A;  3ZX2 A;  3EN9 A;  3TTF A;  1U6Z A;  2YHW A;  3FZH A;  3QFP A;  1VQM N;  5ELZ A;  4BRG A;  2QWO A;  3UKR B;  4BC2 A;  4WQ4 C;  4FOE A;  5AQQ A;  3VPZ A;  4IEE A;  2DPN A;  1VQL N;  4K42 A;  5CHI A;  1EO1 A;  4PKI A;  2Q31 A;  3OBY A;  3CCJ N;  1DT9 A;  4NB4 A;  5M1P A;  1YJN N;  4JHD A;  1HJO A;  3D6R A;  3SBG A;  3VER A;  4NZT M;  1XQS C;  3CCM N;  3C65 A;  4BG8 A;  2ZGY A;  1GLA G;  3CJ9 A;  4PL7 A;  1KAX A;  4C1N K;  1BU6 O;  1VQN N;  2IVN A;  1NMD A;  2P9K B;  3C0B A;  1BA0 A;  4H0Y B;  1V4S A;  4JKD A;  2NRH A;  3TPQ A;  4ISF A;  5HOO A;  4BRA A;  4ILH A;  4BRQ A;  2RHK A;  5JMV A;  3IUC A;  5AQJ A;  5H1S Q;  5C12 A;  3TTC A;  3VF2 A;  4BC3 A;  4NLC A;  4H5T A;  5GIN A;  3D2E B;  2PAV A;  2P9L B;  2CGK A;  5BR9 A;  2QTD A;  3HBT A;  4WQ5 C;  3ZEU A;  4A61 A;  1JCG A;  4H5V A;  1G99 A;  3KK7 A;  5AQS A;  1C0G A;  2ZF5 O;  4BRI A;  5GAG P;  4BRH A;  4U67 L;  1VQ4 N;  2HF3 A;  3AAP A;  2YJE A;  3ZX0 A;  2ZJR L;  5AZJ B;  3VES A;  3BP8 A;  4YOR A;  5TKW A;  4CBX A;  2YCH A;  3H1V X;  2GWJ A;  3MN5 A;  5AQR A;  2ZJP L;  3ULE B;  2ASM A;  2E20 A;  4RTF D;  3WT0 A;  4JKA A;  3CCR N;  3PIO L;  2P9N B;  3MK5 A;  5AZI B;  2A40 A;  3CET A;  2HBK A;  1VQK N;  4CBW A;  3HSC A;  3EE8 A;  4K41 A;  2NNW A;  1K8K B;  1SQK A;  3AAQ A;  3CIP A;  3ID6 A;  1X9J A;  3O9R A;  4JNE A;  5F0X A;  3A0I X;  3WXL A;  2NLX A;  3LDP A;  4WQ4 A;  3Q7C A;  3ZIG A;  4B1Y B;  4FOI A;  5EY4 A;  2JWL A;  3D2F A;  1QQO A;  1D4X A;  4JKF A;  4BQZ A;  2KHO A;  3GBT A;  4B1V A;  3VEV A;  2P9P A;  3BEX A;  4YOV A;  4KH5 A;  3TSQ A;  3FZK A;  1ILY A;  2WUS A;  3C7N A;  4MDA A;  3R9P A;  3OA9 A;  3C6H A;  4IOA L;  3DXK B;  2P9U B;  1IG8 A;  3E9L A;  5KQ8 A;  5LY3 A;  5JVH L;  3ID8 A;  3GL1 A;  3LM2 A;  4A57 A;  3UKU A;  4PKG A;  1JCU A;  3N4P A;  3P38 A;  1GLC G;  3FLC O;  4IFE A;  1IJJ A;  1XEZ A;  3WEE B;  4JKB A;  2KKZ A;  1C0F A;  2VCP A;  4P77 A;  2GWK A;  3SK3 A;  5BPN A;  4FBK A;  3AJE A;  4JEP A;  4XH4 A;  4FPA A;  1NGH A;  1PVY A;  1ZC6 A;  4OPA A;  1YJW N;  3L6Q A;  4FWS A;  2YX6 A;  4P8J A;  2ITM A;  3FZM A;  5EOY A;  3I55 N;  3K9J A;  4BRK A;  4U7B A;  3C6A A;  3JXU A;  4CD1 A;  1K8A O;  3VEN A;  4WF9 L;  4NLB A;  2OTJ N;  3QML A;  4JN4 A;  5BPM A;  4FBW A;  5EX5 A;  1TUY A;  1BOT O;  1YXQ A;  1ATS A;  4H0X B;  2E2P A;  3P04 A;  5CE3 A;  2IVP A;  3LDN A;  1HX1 A;  3ATU A;  5E84 A;  4CZE A;  3O9S A;  4I6M B;  3G71 N;  1W2B M;  3NVK A;  3OBW A;  3CXC M;  3B8A X;  3OW2 M;  3LDL A;  3E9P A;  4YDU C;  1JCF A;  1NWK A;  2QWP A;  3CJB A;  5AQK A;  5GIP A;  5AFU H;  3VEW A;  4CD3 A;  4XH1 A;  3O08 A;  4CZH A;  2GX9 A;  2BUP A;  4FWP A;  1K7J A;  4BY9 C;  5AQO A;  3R6M A;  3AGR A;  3ENB A;  3GDQ A;  4XEI A;  4P8E A;  3L0Q A;  1ATR A;  4R79 A;  3CCS N;  4WQ5 A;  4CZG A;  3A5O C;  5FPN A;  5BRD A;  2F9W A;  5E26 A;  2EWS A;  1GLB G;  4YOX A;  3NMU A;  4IJA A;  5AZJ A;  5KQD A;  4H5W A;  2E2Q A;  3CCU N;  2D0P A;  2E88 A;  3CQY A;  4K43 A;  2D0O A;  3H6E A;  3MDQ A;  1BO5 O;  5BN8 A;  1IEZ A;  2P9N A;  2I7N A;  5B8H A;  5GAD P;  4FWN A;  4E1J A;  4K25 A;  2YJF A;  3QIC A;  2QWR A;  4AF1 A;  5M1N A;  2FSJ A;  4BRL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...