3TTFA

Crystal structure of e. coli hypf with amp and carbamoyl phosphate
Total Genus 218
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
218
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 218
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttfA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttfA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttfA01
3TSUA 3TSPA 3VESA 3VERA 3VEWA 3VF2A 3VEXA 3VENA 3VF4A 3VEOA 3TTCA 3VTIA 3VTHA 3TTDA 3VETA 3TSQA 3VEZA 3TTFA
chains in the Genus database with same CATH superfamily
1T7PA 3HPHA 4DFMA 1OH6A 3CCRN 2XRIA 1YVUA 3RSEB 4OLAA 4CBWA 1S72N 4RW7A 1VQ8N 4H0TB 3EKSA 1KAXA 3OYKA 1IKYA 2G8WA 4B3OA 3T69A 3L2QA 3J80O 1NG9A 4NCXA 4OLFA 2VG5A 4FM1A 3AVNA 5JVHL 4JRPA 1G15A 1HNWK 4J2EA 5AQZA 3THYB 1VQMN 3SLCA 3H1QA 3NF6A 4A59A 4DQRA 3GE1A 4CESA 4DQSA 4U67L 1YT3A 4O0IA 4M3XA 4AM7A 1NU0A 1ZBUA 4GY2B 1HPMA 3AGRA 2IS3A 4RW4A 4KHWA 3LANA 3SJHA 3MXJA 2DTUA 2OA8A 4X66K 1VSHA 4O8KA 5AQVA 3AAQA 3THXA 2O4IA 1S9GA 1W97L 5GAGP 5HROA 4L8RB 4IXCA 3DOLA 3OYJA 2E2QA 3VQEA 5AR0A 4AM6A 5A2QO 5CY4A 3VQCA 4BDPA 4K41A 4OX9K 1BCOA 2FBVA 1ASWA 1JLQA 5AJ3K 1DGKN 3M8QA 1ATRA 3RWUA 2OZMA 4HUFA 4IFEA 2P5OA 2HMPA 2PBDA 4FW2A 3H07A 3SMSA 4FLVA 3KHYA 4XIUA 2EX3A 3B8AX 1SKWA 2CGLA 3O1WA 4DTNA 4CJFA 1KTQA 1TUUA 4FJGA 5BPLA 2QWPA 1L3VA 3C94A 3TAFA 3DI6A 3IAYA 2Q31A 4CHQA 3I33A 3K2PA 2CGJA 3VEXA 1TK0A 1U6ZA 2HVHA 3WQTA 1GLCG 2YI1A 3JSMA 3TSPA 2BE2A 4LY7A 2P1JA 4AHCA 4CJ5A 3OYDA 4B3TK 2RISA 1SUQA 5KGWA 2A3ZA 4GMJB 4M63C 3ZETB 4BRPA 2D0PA 2L8YA 1RBTA 5AZIA 5AQLA 2F8TA 4BRNA 4OGCA 3OS2A 2IFEA 2RPIA 1X3NA 3VA3A 3CCEN 1SS6A 4E7KA 2DFEA 2I7PA 3HPGA 3QKBA 4FFJA 4MLEA 4OPJA 4DR7K 3MX5A 1T8EA 4N41A 4C8NA 1LWFA 2FC0A 1OVQA 4FJ7A 1HNIA 1X9JA 5KPRA 1IV0A 3IALA 3J81O 4B1VA 4NLBA 3H3NO 3OS1A 2HHVA 3DXKA 3LDNA 1QVGM 3AA5X 4NXNK 3QESA 2A42A 2LSNA 4DS5A 3THVA 5CE3A 4FLWA 4FJKA 3A5NC 4FWSA 4I6MB 4FWMA 3HBTA 2I7NA 3PIOL 2KZZA 1JLBA 4ISEA 3T7ZA 5IWAK 2VGNA 3F9KA 4O55A 1Z25A 4Z4CA 1VQON 5AQHA 1D4XA 4FLZA 4DB3A 4E7HA 4RW8A 1HYZA 2WOMA 4BRGA 4BVPA 3L2WA 2WBNA 3VPZA 3KD1E 1UAXA 1N8RO 4YOXA 4UQGA 4E7LA 2YNIA 1T44A 3K5MA 3MEEA 4B1YB 5GIOA 4BG8A 1RDBA 3AVMA 3W0LA 4OKKA 1BQMA 2JWLA 4Z4EA 3OYEA 1S1VA 4BRFA 4KRFA 3M8SA 3EE9A 4O4GA 3HOTA 3OYNA 1NLVA 1VQPN 2FBYA 4LFAK 4JI5K 2W42A 3O9UA 3FZMA 2GTCA 4JKCA 2FSNA 3DXMA 5EVZA 4IO9L 4CEEA 5LMUK 1NGEA 5KPZA 3ZIHA 4DTSA 1Z6RA 3ISNC 1VSKA 4KO0A 1QVFM 3AO1A 1TL1A 5BR8K 3OYCA 4LF8K 2HNZA 3HYFA 3VERA 3VEWA 3DLKA 3SCXA 3DWLA 1C6VA 1SL2A 4WFBL 3E9OA 4Z9EA 1X1PA 3KK7A 3LDLA 3AVFA 1IBMK 3P39A 1TKSA 1WSEA 2VYPA 3D7EO 3TTDA 3L4IA 1R0AA 1C0TA 4PL7A 3OYHA 4FLTA 4BE2A 3HXMA 1N36K 3SQ1A 3MEDA 1WAJA 3QFUA 4A2BA 3AO5A 4DV6K 3P38A 1GLFO 4CD3A 3SPZA 3QIPA 1BGXT 4B9TA 3ZT0A 1WLJA 3L0QA 1BG3A 3LWMA 4DSEA 3L2RA 1N34K 1Q86O 2HB5A 4MQ3A 4DLGA 4M7XA 3SUPA 1NOYA 4H0VB 3UE5A 4I14A 1RQ8A 4NO7A 4CF2A 1S1WA 4BDYA 2NRTA 2XY8A 3HP9A 4DTJA 3L2VA 1PAVA 3CCUN 3CFRA 2Q0UA 2OTLN 4KHUA 4AF1A 4FBKA 4FPAA 2HHTA 3DRPA 3ENBA 3NMUA 4AHRA 4BR0A 3V9SA 1TKZA 4W5RA 3CMEN 4Y1CA 4DKWA 4X64K 4JD2A 3LVJC 4IO8A 4BR9A 1VRTA 1OH7A 4BY9C 1RTHA 3SAGA 4DF4A 4O8UA 3PX6A 1H4TA 1KC8O 4HVZA 1V4TA 3A5LC 3M1FA 3U9DA 4W5QA 2A41A 1SKRA 2P9PA 4G9ZA 3WNGA 4KB1A 4RG8A 3WEEB 3UKUB 3ULEB 3A5MC 1UOCA 2R7YA 1L3SA 5DM7L 4CEDA 1L5UA 3ZT4A 1S22A 2QEXN 3CJ9A 4YY3K 3E1YA 4IEEA 1RDDA 3TU5A 4BRQA 1VQNN 2X6SA 1YTUA 3KVGA 3PLAA 1T6DA 4DV7K 2Z1HA 3WXKA 2ZM6K 4PA1A 3U3GA 3L7VA 4ID1A 1EO1A 1VQ4N 4J2DA 2GX9A 3F9MA 3PO4A 1RDCA 3WXJA 5AQSA 3TAQA 2VGMA 4H0OA 2HNDA 3THWA 1FXXA 4Z0UA 3DYAA 4O5FA 2OTJN 3TAPA 1SQKA 3ATUA 3VGMA 4B08A 2FXUA 3QIOA 4P6PA 4FJNA 2JWKA 4FXDA 4FJ8A 2YV0X 1NGHA 1O13A 3WXMB 3V4IA 2QWQA 3U4LA 3K5LA 3SQ4A 4FK4A 1JCGA 1ASUA 1HKBA 3EN9A 3FZKA 3AAPA 5GINA 2G8VA 2X74A 4BGBA 1NGDA 4M3WA 1T03A 1JCFA 4FWKA 1NH9A 1S8EA 1VQKN 4DWIA 4EZ9A 4EHTA 4WQ4C 2KFZA 2BANA 3JYTA 3L8BA 2WC9A 1ILYA 3LQUA 1K7JA 3ZIEA 5C24A 1YXQA 3WNFA 1C1AA 3DAWA 1ZYQA 2P9LB 4B1WB 3VMFB 4CIEA 3V6DA 3CJAA 3P5JA 3KK2A 1NFJA 4K8ZA 3L2UA 3S3OA 4JYAK 5BPMA 2ITMA 4F4KA 1BL3A 3E9PA 4AHTA 4P6DA 3C0BA 3CQ8A 1YITN 1MWMA 1JL1A 1H0XA 4B9UA 4O0JA 4CFAA 4QOZB 1KCFA 2RE2A 4DV3K 3VQQA 3JXUA 3AO3A 1SKSA 2WTUA 3ZSQA 2CH5A 2D1KA 5AQXA 3DLHA 2HW3A 1S1TA 3C95A 3O3HA 4FJXA 1GLDG 4IZ9A 3S3NA 3NF9A 3L4QA 2E1ZA 4JKAA 1K8AO 2YJFA 5JVGL 2IGIA 3CCVN 4CFCA 5BPNA 3VQ6A 1VSIA 4CK1A 3EY1A 3THXB 1QHAA 4CF8A 4KH5A 2EHGA 2O8BB 3OYIA 1IBLK 4FL9A 4ZHRA 1HX1A 1VSEA 2AA4A 4LFCK 1RT3A 3CM5A 5I42A 3CC2N 3KTQA 4OVLA 2BTFA 4CHZA 3TSUA 4ID5A 1M90O 3LVKB 1C0UA 2D0AA 1WSIA 1XNRK 4DTUA 4UY8O 3NAEA 1DTQA 2ZJQL 4OKJA 4DTPA 4RW6A 1EX4A 4NXMK 3VENA 1P90A 2UUAK 3TAMA 4FWLA 3CJCA 4A62A 4KI6A 1KRPA 1WAFA 4G1QA 4YORA 3EKUA 1SNNA 3NBPA 5HLFA 3C6HA 4BR2A 3MK6A 5FROA 3CCSN 1HYSA 3QEXA 4IOAL 5F0XA 4B8CA 3TANA 4I9LA 1JLCA 1NJXA 3IABA 3SK3A 1VQLN 3CQXA 2Q0RA 1NJWA 5CZ1A 3TAGA 4BREA 1JLFA 5TKYA 3FFKB 4BC2A 5JICA 4K8XA 1VQ6N 4JK8A 3I56N 5KQ8A 1T3VA 3PSFA 3HO1A 1KAYA 3CF5L 4CEAA 1IG9A 1A5WA 2NRHA 3QETA 1BHLA 3M3ZA 1SL0A 2QM1A 1U04A 3HK2A 4B3SK 5C25A 4FYDA 3B6OA 1JKHA 4FPBA 5T7BA 1HKCA 2GWKA 3KLFA 1L3UA 2ASPA 4WYBA 4LH4A 5BN8A 1J54A 4JAXA 1OKJA 4N47A 4ILHA 3GOIA 3MCPA 1M1KO 2FF6A 2W41A 3MXIA 5FRNA 3DXKB 5LJWA 2AJQA 4DS4A 3E9LA 3VGLA 1IH7A 4C8MA 1GLJO 1IO2A 2UXBK 3K59A 4MDBA 5LL6Z 3QERA 4K88A 4C1NK 4XEIA 4B1XB 1WBBA 3C7NA 2F9WA 3MAQA 4Z94A 3HRGA 5J2NA 3LAMA 2NLXA 3OA9A 4XH1A 2V51B 3K57A 3CCMN 1K73O 3SV4A 4JHDA 3H1VX 5EX5A 4A2AA 4YNQA 1JJ2M 4ICLA 5BR9A 3KKRA 4WQ5A 1HQUA 2ETJA 3O4WA 2O8DA 4AHVA 1K8KA 1XNQK 5F1XA 3TI0A 3H46O 3AARA 3ZX2A 4WCEL 4E7JA 3NH2A 1TAUA 5KRTA 3WNEA 1RDAA 1Q82O 5IT9O 3WXIA 1H0YA 3R6MA 4CZFA 4IBNA 3VF2A 2O8EA 1ITGA 3O9TA 2GELA 3DRSA 2UU9K 5TKWA 1VAZA 4DG1A 4YKEA 5LJVA 1RCHA 3DXMB 4QAGA 4JI1K 3K5OA 2IOCA 1IJJA 4NLCA 4DQ8A 3PIPL 3F73A 3K0SA 1HUXA 4FVMA 3U9ZA 1ASVA 1Y64A 2O4GA 1VK0A 1QS4A 4MFBA 3A0IX 3ZCMA 1Y97A 3DM2A 4CHOA 2VQFK 4CIGA 1XEZA 4JKGA 3AV9A 3C6AA 3ZSRA 4BC5A 3E66A 1LAVA 3I0SA 4YHHK 1HNXK 2FF3B 3LDQA 4CHPA 4MO5A 3IFRA 4ISFA 3ZX3A 3QEIA 4A5AA 4F2RA 1HYVA 4FM2A 1KLMA 3N4QA 3J7AP 1BIZA 5BRHA 1RTJA 3HP6A 3VEZA 3ENHA 3HTVA 4BC4A 2VWJA 2Z1IA 2ZE2A 2XY7A 4N76A 4OJRA 4DSFA 4K86A 1E4GT 3BDPA 1T6CA 1QSSA 2GTDA 3RR7A 1BDGA 2HHHK 3TABA 1B92A 3LS6A 1RNHA 3CC4N 2P5GA 1UA0A 4B1UB 3RR8A 4JKDA 5HP1A 2KQ2A 4FJHA 1G58A 4DQQA 4CEQA 5I3UA 4HHTA 4RW9A 3VOVA 4Z4GA 4XH5A 3BF1A 2GUPA 1OH5A 2O8FA 2Q3VA 4EFHA 5JS2A 4Q15A 2MX1A 1ZBHA 4PKIA 2HHUA 2YX6A 3U3YA 3SUQA 4ZTJA 4LF6K 1B9DA 1PVWA 1S6PA 4P8JA 3AVHA 5LY3A 1RT4A 2HOEA 5HL7L 2D0BA 4CJSA 1RBSA 5EU7A 2HHSA 3MECA 3VA0A 2E4LA 5AQRA 1GLAG 3QFPA 1QHTA 1ZBSA 3QBXA 4FLYA 1TVRA 4HTLA 2E88A 3LL3A 3VEVA 1JLEA 3CCLN 1Q7YO 4CVNE 2FLOA 3V9ZA 1JE3A 3NH0A 1EKEA 1YTAA 3PO5A 4RTFD 4W5NA 4CERA 1HRUA 3HVTA 4I7FA 4M41A 4DR1K 2D0CA 3SI6A 4GV9A 1JDQA 1BI4B 2ZJRL 1EP4A 2P9IA 5HRPA 1EETA 2ZD1A 4M45A 3K5NA 3Q7BA 1JCEA 3MN7A 2QWRA 4FJLA 4B9SA 1LAWA 1U49A 3NHGA 1I3AA 1N32K 4CJEA 2E5LK 1U2VA 2HSTA 4I2PA 3CFPA 3OYLA 3ID6A 4AH9A 4FJ9A 1H1VA 2ZWHA 3QBWA 4EP5A 4F9OA 1GOBA 5CYQA 4CIFA 3CQYA 4GKKK 4C8OA 2D5RA 1WNSA 3VETA 4JI2K 4DSJA 1J6ZA 4X65K 2YHWA 5J1EA 4KV8A 3KD5E 4I9QA 3THWB 5M1OA 4FWQA 1N5YA 1VSDA 1ATNA 5AFUH 1VR4A 1NK4A 4F3TA 4Z4FA 5JS1A 2WONA 1JCUA 4CJ3A 4RCHA 4OO1J 2G8HA 5DK5A 2E6LA 4FOIA 3ZEUA 4JI6K 1N33K 4NB4A 4M3ZA 2P51A 3J8AA 4CF0A 3LALA 2GBZA 4FBQA 3CPWM 1TK5A 3ZIGA 4NZRM 4N5SA 2P9SB 1Y9XA 3IKMA 1W2BM 1X3MA 3H6EA 4CJVA 2V7YA 3R3LA 4MO4A 3OW2M 3LRJA 3VTHA 5AQFA 4GKJK 1QZ5A 5AQMA 3LZJA 5GIPA 4Y1DA 5HBMA 3KWGA 4JKFA 2HF4A 4EAHD 3TAEA 1NK6A 1NMDA 4IDKA 3MK5A 4GVMA 3KWIA 1NMNA 1ZC6A 3B6PA 1WOQA 1YUWA 1WSJA 2G8UA 1C1CA 3VESA 5DMRA 2OCEA 4JV5K 4L3QA 2RF2A 2QW9A 1R59O 3MEGA 1Q81O 2ZJPL 1NWKA 1VRUA 2E6MA 1GLEG 4DR6K 4U7BA 1D5AA 2RKIA 4JS4A 1CZBA 3NGIA 4QCLA 1DEJA 3AA4A 5HRNA 4BVOA 1U47A 4MDAA 1VSFA 5KRSA 3KLHA 3AO2A 1K9MO 1TAQA 1D9DA 3R9PA 4DCHA 1XHZA 1RTDA 2VQEK 3O9SA 4ILJA 1K4LA 2BGGA 3QNNA 4HUEA 3V9UA 3QEPA 1ATSA 4YOUA 3CCJN 3LDSA 2G8FA 3LDPA 1JLAA 3OYGA 4IOCL 4DFPA 3HZ7A 2P9UB 2ZGZA 4DTRA 4CHNA 3SNNA 3PX4A 1LW0A 2E2NA 4K42A 4DQPA 4LFBK 5KTQA 4EZ6A 1ZBIA 3M8RA 2IVOA 4DR5K 2NZTA 3KK3A 3BY5A 1YJNN 2E1YA 4B8AB 4A61A 1KAZA 1NGJA 4JS5A 1YJ9N 1KXPA 3RMAA 4H8KA 5CHIA 4KB0A 3RRGA 1VSJA 4E1NA 3F5TA 2HVIA 4CZMA 2F7TA 2QXLA 1Y2IA 4JI7K 3SAFA 5AQWA 1YHQN 4B9QA 1TKTA 4CI6A 1HPZA 3M8PA 2QKBA 1RT5A 2NNWA 3QDKA 1WSGA 1F21A 4AHUA 3L3UA 1G57A 2QXFA 4A57A 3FZFA 3UKRA 3VTIA 5J2PA 4F8RA 5CR4A 4JI4K 3EEQA 4H5VA 3FGUA 1REVA 1W0HA 1J9AA 1BO5O 2NRRA 3U6FA 1DT9A 3O6WA 5KQDA 4DR3K 3CJ7A 1NGGA 1QSYA 1GLLO 3ZIIA 3P04A 3SAHA 3IABB 4CGFA 1CZAN 4J2AA 3DOKA 3JS6A 1CZ9A 4CGHA 3CETA 4M3UA 4E1MA 2HF3A 3D2EA 4NZTM 3KKSA 2CH6A 4R5PA 5LMNK 3MXMA 2CRQA 1FK9A 4HVCA 3S41A 4BRDA 4DR2K 5E41A 2Y1BA 1EWRA 3KJVA 3DMJA 5B8HA 3QICA 1KQSM 1XC3A 1VQ5N 4H0PA 4BRMA 2UXDK 4HVJA 3M5RA 3CM6A 3SUOA 3CI5A 4FWRA 1IKVA 4LC9B 2PZSA 2NRZA 5KI6A 3LP2A 4CJ4A 4FZZA 4FVUA 4FJIA 4CHYA 3BUZB 4CJKA 4WFNL 2Q97A 1RT6A 1VHXA 3QMLA 2QWOA 3TTCA 1WN7A 1RILA 3U6YA 3WXLA 4C8LA 1BWFO 3HM8A 4NYNA 5K14A 2O8CA 5FDLA 1U4BA 3P1GA 3O9QA 3A8YA 4FWPA 4KTZA 3NVMA 1J53A 3C7NB 4JI0K 1XMOK 2Y1JA 3HSCA 4CJRA 5ELZA 4HCCA 1EWQA 2X78A 2NRVA 4IDHA 5E26A 1BCMA 3ZSVA 1ZXOA 3V81A 5EXWA 3NGZA 4XH4A 2FSKA 4YOWA 3CHWA 4JHDB 5M1NA 2XHBA 3D45A 1RBVA 3HM9A 5FPDA 2Q3SA 2UUBK 3DLGA 3AO4A 3PY8A 2O8DB 2OPRA 1K8KB 1JL2A 4IWVA 3HZ6A 3MDQA 4LH5A 1NGBA 3RMBA 4M3YA 3QEVA 5KGXA 2I5JA 4WF9L 4JI3K 3SQ2A 1RT7A 3O9RA 3EL2A 2UXCK 1QTMA 2KW4A 2HBLA 3VQ7A 2QWMA 3CJ1A 3FFIA 3CXCM 1HNZK 4CZIA 3LM9A 3LM2A 2RIUA 2B5JA 1HMVA 1E4FT 1NJ1A 2YKNA 4P6CA 3VQ9A 4FO0A 2KTQA 3LP0A 1S9EA 4A5BA 1BIUA 3OJUA 3QEWA 4H0YB 4CW7B 2IAJA 4ISGA 2B4JA 4DMNA 3O4NA 1I94K 1XI1A 2W6LA 2BKYX 4DTOA 4CZKA 1Z26A 3RVCA 4Q0BA 1JXBA 4BRIA 2EWSA 5J2QA 1TKXA 5AZJA 1KVAA 3LP3A 4JKGB 1JO0A 2UUCK 4BRLA 1Q9YA 1NKCA 2V7ZA 1N6QA 3ASMA 4CFBA 3HL8A 2VCPA 4JEPA 3MIOA 2G8KA 1EXQA 3GG4A 1QQCA 5FPEA 3ZT1A 1CXUA 2ZQBA 3OBWA 3CC7N 3EZWA 5AFUA 2BDPA 3U8XA 1LV5A 3NF8A 2W40A 5AZIB 1WB9A 1Q8IA 4FZXC 2KFNA 2W6KA 3IMXA 4J8FA 5SWMA 3CMAN 4OPKA 2Q36A 3OYAA 4BDZA 1RGIA 2RN2A 3SBTA 5C2DA 1QQOA 1KFDA 5C12A 2CGKA 4YOTA 3G6EN 2A1SA 3P4IA 3TSQA 5GAHP 3ALYA 1H4SA 5GAEP 3FZHA 3GBTA 2HMIA 3GL1A 2M71A 4CE9A 3KIOA 5AQPA 4DTMA 1YIJN 3VQPA 1VSMA 3TR8A 1TYQA 3C65A 1JLGA 2OPSA 3AVLA 3SZ2A 4IEIA 4KHQA 1DTTA 1UDVA 4QS8A 2D0OA 2A6AA 1Z05A 4JNEA 2F4VK 4ILGB 2QWLA 5C2FA 4DSLA 4BG9A 1IBKK 4JKHA 4GV6A 1HRHA 4DUZK 3QB0A 1KSPA 5H1SQ 1QE1A 4IFVA 3ZLJA 4PL8A 2Z1JA 3V1RA 4JKEA 4CEBA 1HNVA 2EH1A 4LF4K 4Y0WA 1NNEA 3LDOA 5EY4A 3MCAB 4YFUA 4V19S 3A5OC 1HR0K 4CJ7A 4B9NA 5AQGA 4HTUA 4DFKA 4M42A 5DM6L 2P9IB 4CK2A 3OS0A 2NUBA 1X9WA 2YNGA 4BROA 3EO3A 3J7ZO 4CBXA 1MWKA 4IOXA 4BE0A 3NGYA 2ASOA 1U2VB 4E3SA 3VN5A 3RMCA 2YHXA 1LCUA 2IVPA 1TKDA 3ZSZA 3RMDA 3VQ5A 3SBGA 3C6TA 5FPNA 4AQYK 4LF9K 3MGZA 1NJ5A 1HC7A 4DFJA 4CEZA 4PHTX 1KLNA 2IIRA 4FJMA 1II7A 4BRKA 3VQ4A 1FKPA 3NFAA 5J2MA 1WSHA 4GW6A 4CGDA 1O1WA 4JK9A 2GV9A 3D6RA 2X6NA 3MWPA 3AVGA 2O8BA 4FSVA 3OHRA 2PYLA 4KHSA 3KZBA 1NGFA 2Y1IA 1TUYA 4LD0A 4PUOA 2YCHA 3P83D 1IKXA 1YF5L 4JLHA 3AVKA 4O5BA 1S1UA 3DLEA 3ZEUB 1A5VA 1NFHA 5BRFA 1E3MA 1NJ2A 1NGAA 3I55N 4CECA 5ADXH 2P9KA 5AQNA 2LXRA 3I8BA 4WE1A 3HSTB 4AILC 4DQIA 3R8EA 4JKBA 5SZTA 2KHOA 4KKOA 2PYJA 1KK9A 1HLUA 4DV5K 4EIAA 1HJRA 1VM0A 3LPTA 5BRDA 3S9HA 4CJWA 1IKWA 4K25A 2BH1A 3WNHA 1HKGA 1RBUA 1EQYA 4MLHA 3OYMA 3NCIA 3OBYA 3MMVA 5JMVA 4DSKA 1TV6A 1TK8A 5M1FA 2YHYA 2Z1GA 3ATVA 2JGUA 1HJOA 1MA9B 4HD0A 4N56A 3BZCA 1SL1A 4JI8K 3K9JA 4CCHA 1SV5A 1C1BA 3QO9A 3D2FA 3PUFA 1K6YA 2ZGYA 2VWBA 3DSDA 5JLFA 1V4SA 3VEOA 3G10A 1MDUB 2WFBA 4YDUA 1NOZA 4JD2B 2E8AA 2P9NA 3G4SN 4BACA 4JN4A 5M1PA 4IG3A 2GUIA 4FM0A 2H9UA 2F9TA 4H5NA 5HOOA 1YVNA 3NH1A 2DFFA 2A1RA 3TARA 2QI2A 4BR7A 3O8MA 3TPQA 2A5XA 1JXEA 4FBWA 3CPEA 1YJWN 1K4IA 4O44A 3O3FA 3O4QA 3Q7CA 2JLEA 1DLOA 1DKGD 5FLXO 1C0FA 3OJSA 3O5BA 2P9PB 4CJTA 3LZIA 5CZ2A 3RSEA 3ITHA 2HHWA 1OH8A 3SPYA 2QTDA 1BQNA 1J5EK 2QKKA 1W9HA 2XY5A 3H45C 5AQYA 3MX2A 4H4MA 4PY5A 4HCBA 4E89A 4KBOA 4FW1A 2F8SA 5D3GA 5EOYA 4WQ4A 4CFDA 4OLBA 5F2RA 5C0YA 4BRHA 4F3OA 3THYA 3NVKA 4DU3A 1LOTB 4BC3A 4OPHA 5AQJA 1CXQA 4W5TA 1FW6A 4B9LA 3AJEA 3UKRB 1KVCA 5M1KA 4IJNA 4EHUA 1X9SA 2V52B 1RT1A 4OKEA 3G71N 1QZ6A 3ZT3A 3F2KA 4DU1A 5AQIA 1OVYA 3CG7A 3O80A 3SJJA 3RTVA 4BGAA 1K4OA 3V1OA 4BR4A 4EO0A 1XUPO 2UYTA 4FLUA 2ASMA 3KLIA 4KAZA 3CJBA 3G25A 1NKBA 4ZTFA 1B9FA 1PVYA 4CD1A 3OY9A 2EQAA 1LN4A 3CERA 4IJAA 3D2EB 2EK0A 4X62K 4C23A 4TSXA 4QS9A 1NJIO 4B3RK 5C10A 3G0ZA 3V9XA 4M3TA 4LSNA 1RTIA 3SQ0A 3TOEA 1WSFA 1QQMA 2A2YA 4GVEA 3WQUA 3LP1A 3AVBA 4C1NI 3DSCA 2AP1A 2QK9A 4YDQA 2HBJA 4W5OA 1YAGA 3LWLA 3VF4A 4KHNA 5MLCQ 3QINA 4WQ5C 5BREA 4KPYA 1HQEA 1SZ2A 3S3MA 3IRXA 3R1XA 3T3FA 4LF7K 1U45A 3T1AA 3OVNA 3WT0A 4KREA 5FRMA 2P9BA 1NJYA 1Q9XA 4J2BA 3QLHA 1NK7A 3ZETA 2HNYA 2OANA 3FE1A 4IFYA 3GDQA 3V1QA 3SV3A 4FK2A 2O8CB 2HBKA 4HUGA 4HWIA 3NE6A 1C0MA 1TGOA 1RT2A 5C42A 4FWOA 3ID8A 3T1YK 2HHXA 1IEZA 1VSLA 1S6QA 3DJCA 1KVBA 4DHYA 3RRHA 1NK8A 1X9MA 2KZMA 4PQUA 1LWCA 3BZKA 3N4PA 4Q5VA 3OTOK 4YOVA 2ZF5O 1QSLA 2DY4A 3L6QA 3HVRA 1XHXA 2VWKA 4AHSA 1ESVA 4BQLA 2VG6A 4KTQA 1BOTO 1BUPA 3AVAA 3VGKA 4BR5A 2D4WA 3MN9A 2J4RA 3DRRA 3E01A 4DU4A 3IDHA 1GOAA 1NJ8A 3AA2A 2NRXA 4CJUA 2FBTA 4I6MA 4ELUA 2YKMA 3HI0A 4CGGA 3K9KA 3ZSXA 4NCAA 3O08A 3LPUA 3BF3A 1XC9A 4B1ZA 2B6AA 3O3GA 5C15A 4H0XB 3T19A 3OYBA 1L3TA 4CGIA 1XMQK 1P8ZA 4E0DA 3VQBA 3SYZA 1BI4A 4CF9A 1RFQA 4FJ5A 4CJLA 3HPOA 3AVIA 4BWJA 3VQDA 3A2FA 4H5WA 1TKUA 4DV0K 2H3GX 4EP4A 4E1JA 5AZJB 3FLCO 4B9VA 4F2SA 3ENOA 3P31A 5AQKA 1WBDA 1Q18A 1UA1A 3K58A 4TWAA 4KH6A 1NK0A 3IG1A 5M1QA 5JLHA 4DF8A 4B3MK 3T1IA 3PV8A 1MU2A 2Z7CA 4R79A 2E2PA 4YDUC 5HRRA 1LWEA 4CZEA 1YI2N 4CZHA 3SUNA 3W3DA 4DR4K 2LN3A 4M7YA 3TTFA 3J7YP 4GNIA 2OYQA 1RDUA 1BA1A 3KK1A 4OPAA 1IG8A 2YNHA 2A40A 1NJ6A 3OYFA 1H4QA 3WUHA 2Q1NA 4CF1A 5ADXA 4QS7A 4DLEA 3VEYA 4BWMA 3ZYYX 3I8DA 3WBMA 4C8KA 2YHBA 4FLXA 3CYMA 2Q2RA 4Z4HA 2ITGA 1FKOA 1QQNA 4PKGA 4IG0A 5AQOA 3ZX0A 5HRSA 1A5XA 3AA3A 1TYQB 3ZSWA 1LW2A 2IVNA 1SAZA 2E2OA 2P9SA 2DFHA 2FBXA 5AQQA 3IUCA 4BQZA 1C0GA 1GLBG 5CYMA 4WFAL 4B9MA 3HOSA 2XO7A 4M3RA 2DPNA 1KD1O 3AY9A 2QWNA 1VQ7N 3H08A 4DUYK 4ELVA 4JK7A 1XQSC 1T05A 1K4PA 3O1BA 4I2QA 4H5TA 2QA4N 3MN5A 1BA0A 2YHAA 4FWNA 3KLGA 4P8EA 1RDWX 3ULDA 1NJZA 4CBUA 3PSIA 4CEOA 3DLLL 3VF6A 1RBRA 4FK0A 1W7AA 3KLEA 1I39A 1S1XA 3DLRA 3NDKA 3IS9A 1ZBLA 3CD6N 3HJFA 3BP8A 4JRQA 4IKFA 1ZBFA 5E84A 4DSIA 4FZYA 1D9FA 3VQAA 5GADP 1TIGA 1NKEA 2F96A 1FJGK 4YOYA 3FR0A 4FJJA 4DV1K 1TL3A 4KHYA 4KTWA 2KLAA 3ZT2A 2FSJA 2IC3A 2O8EB 4GV3A 1NBWA 4H4OA 4CJQA 1VQ9N 2G8IA 3ZSYA 4KH4A 3DLBA 1J5OA 4NCBA 2P9UA 4Z4IA 4CEFA 4K87A 1K49A 4KHPK 4CJPA 5FPMA 1G99A 1S5JA 3LAKA 3V9WA 4BE1A 3TWHA 3WEEA 1U48A 3UKUA 1BU6O 3ULEA 4FCYA 4KFBA 4BRAA 2OZSA 4FOEA 3C6UA 3BGRA 2XY6A 2E20A 2OPQA 4CZGA 1KFSA 3H3OB 3EYZA 3PX0A 2PAVA 3HT3A 2P9KB 4CZLA 2YNFA 3UB5A 4DV2K 2VG7A 4PWDA 3AGKA 1UWBA 3I0RA 2PY5A 2GWJA 4K43A 1CLQA 4DV4K 2HBMA 2NRWA 4NCGA 4NYFA 1BISA 3MN6A 3AVCA 4WI1A 1NGCA 1D8YA 4FCXA 4RWTA 1NK9A 4PKHA 3CIPA 3D0PA 2HHQA 3CFOA 2IDOA 3ZSOA 4E7IA 3L3VA 2O8FB 3CCQN 2RHKA 3EE8A 1GOCA 2KKZA 4LSLA 1NK5A 5KPTA 2OPPA 2ATQA 5AQTA 2WUSA 1DCJA 1NM1A 1WUAA 4DTXA 1NGIA 4K0KK 2GEMA 3D2FB 3NF7A 2PFUA 4H03B 3VQ8A 3M6GA 3EZ5A 4P77A 2P9NB 5AQUA 5BN9A 4CK3A 4E1BA 4BRCA 4H5RA 2YJEA 3FZLA 4KI4A 4E19A 4CGJA 3JAMO 3T1HK 2P9LA 1S3XA 1XWLA 3QNOA 4ELTA 5I9EB 3UIQA 4LF5K 3MWTA 2BUPA 3AVJA 4OGEA 3BEXA 4CZJA 3SMPA
chains in the Genus database with same CATH topology
4MDAA 3CPEA 1YJWN 1K4IA 1K9MO 3CCRN 3RSEB 3R9PA 4DCHA 2RE2A 4CBWA 1S72N 3JXUA 1K4LA 3O9SA 4ILJA 3Q7CA 4H0TB 1VQ8N 3EKSA 2CH5A 1DKGD 2D1KA 1KAXA 5AQXA 1C0FA 3T69A 1ATSA 3O5BA 2P9PB 4YOUA 3CCJN 3RSEA 3LDPA 4IOCL 5JVHL 2QTDA 2P9UB 2ZGZA 1GLDG 3H45C 2E2NA 3MX2A 4IZ9A 5AQYA 5AQZA 4K42A 3L4QA 1VQMN 2E1ZA 4JKAA 3SLCA 3H1QA 4A59A 4KBOA 2IVOA 3GE1A 2NZTA 1K8AO 2YJFA 5JVGL 3CCVN 4U67L 5BPNA 1YJNN 2E1YA 5EOYA 4WQ4A 4AM7A 5F2RA 4A61A 5C0YA 1KAZA 1NGJA 4GY2B 1YJ9N 4BRHA 1HPMA 1KXPA 3AGRA 1QHAA 5CHIA 4KH5A 3NVKA 1LOTB 4BC3A 3SJHA 3F5TA 4FL9A 4OPHA 5AQJA 4CZMA 3AJEA 1HX1A 2QXLA 2AA4A 2F7TA 4O8KA 5AQVA 3AAQA 3CC2N 3SAFA 3UKRB 5AQWA 5M1KA 4IJNA 4B9QA 1W97L 1YHQN 2BTFA 4EHUA 4CI6A 5GAGP 3TSUA 1M90O 2V52B 4IXCA 2NNWA 3QDKA 2E2QA 3G71N 1QZ6A 4UY8O 5AR0A 3F2KA 4AM6A 1G57A 5AQIA 1OVYA 4A57A 3FZFA 3O80A 2ZJQL 3UKRA 3VTIA 4K41A 5CR4A 4BGAA 1K4OA 4BR4A 4EO0A 4H5VA 3VENA 1DGKN 3FGUA 1ATRA 1XUPO 2UYTA 4IFEA 1BO5O 1P90A 2ASMA 1DT9A 2HMPA 2NRRA 2PBDA 3CJBA 3G25A 4FWLA 3CJCA 4A62A 3O6WA 3H07A 3SMSA 5KQDA 3CJ7A 1NGGA 1PVYA 3KHYA 1GLLO 4CD1A 3ZIIA 3P04A 2EQAA 3B8AX 4YORA 3CERA 2CGLA 3EKUA 3O1WA 1SNNA 4IJAA 3D2EB 3C6HA 3SAHA 4BR2A 1CZAN 1TUUA 3MK6A 4C23A 5BPLA 3CCSN 2QWPA 4QS9A 1NJIO 3JS6A 4IOAL 3CETA 5C10A 5F0XA 2Q31A 2HF3A 3D2EA 4NZTM 3I33A 2CH6A 2CGJA 3VEXA 1U6ZA 3SK3A 3WQTA 1VQLN 1GLCG 3CQXA 2Q0RA 2YI1A 3S41A 4BREA 1QQMA 4BRDA 3TSPA 5TKYA 4GVEA 3FFKB 3WQUA 4BC2A 3QICA 5B8HA 4C1NI 1KQSM 2AP1A 5JICA 1XC3A 1VQ5N 4H0PA 1VQ6N 2HBJA 4JK8A 2RISA 3I56N 1YAGA 4BRMA 3VF4A 5KQ8A 1T3VA 3M5RA 5MLCQ 4WQ5C 5BREA 1KAYA 2A3ZA 4M63C 3CF5L 3ZETB 1SZ2A 3CI5A 4BRPA 2D0PA 2NRHA 3R1XA 4FWRA 5AQLA 5AZIA 4LC9B 2NRZA 3M3ZA 4BRNA 3WT0A 2QM1A 2P9BA 1X3NA 4FVUA 3BUZB 4FPBA 3CCEN 1HKCA 2GWKA 2OANA 2Q97A 3FE1A 1SS6A 3GDQA 3ZETA 4WFNL 3QMLA 2HBKA 4HWIA 2I7PA 3TTCA 2ASPA 2QWOA 4WYBA 5BN8A 4FFJA 4FWOA 3ID8A 4MLEA 4JAXA 1OKJA 3WXLA 1IEZA 1BWFO 3MX5A 3HM8A 4ILHA 3DJCA 3GOIA 3MCPA 4DHYA 2FF6A 1M1KO 2W41A 3DXKB 3O9QA 3N4PA 3A8YA 4FWPA 5LJWA 3E9LA 3NVMA 3VGLA 1X9JA 5KPRA 4YOVA 2ZF5O 3C7NB 4B1VA 1GLJO 4NLBA 3H3NO 3L6QA 3HSCA 5ELZA 1ESVA 2NRVA 3DXKA 3LDNA 1QVGM 4MDBA 4BQLA 4IDHA 2A42A 4XEIA 4C1NK 5E26A 4B1XB 1BOTO 1BUPA 3C7NA 3VGKA 4BR5A 5CE3A 1ZXOA 2F9WA 2D4WA 3A5NC 4FWSA 3MN9A 4FWMA 4I6MB 3HBTA 4XH4A 2FSKA 2I7NA 2J4RA 3CHWA 4JHDB 4Z94A 5M1NA 4YOWA 3HRGA 3PIOL 4ISEA 3T7ZA 2NLXA 2VGNA 3OA9A 3IDHA 5FPDA 1VQON 3SMPA 4XH1A 2V51B 5AQHA 3CCMN 1K73O 2NRXA 1K8KB 1D4XA 3HZ6A 3MDQA 4I6MA 4IWVA 4DB3A 1NGBA 4JHDA 3H1VX 3HI0A 5EX5A 4A2AA 1JJ2M 3K9KA 4BRGA 5BR9A 4WQ5A 4BVPA 2WBNA 3O4WA 3VPZA 4WF9L 3O08A 3O9RA 3BF3A 3EL2A 1K8KA 4B1ZA 1N8RO 5F1XA 2HBLA 4YOXA 2QWMA 3H46O 4H0XB 5C15A 3CJ1A 1T44A 3AARA 3ZX2A 4WCEL 3CXCM 4B1YB 5GIOA 4BG8A 4CZIA 3LM9A 3LM2A 1P8ZA 2RIUA 1Q82O 1E4FT 3WXIA 4P6CA 3R6MA 3W0LA 4FO0A 4CZFA 1RFQA 3VF2A 2JWLA 4A5BA 3O9TA 4H0YB 2GELA 4H5WA 4ISGA 1TKUA 4BRFA 2H3GX 5TKWA 1VAZA 3EE9A 4E1JA 4YKEA 5AZJB 3FLCO 3DXMB 5LJVA 3HOTA 3ENOA 3P31A 5AQKA 1NLVA 1VQPN 1IJJA 1Q18A 4CZKA 3RVCA 5EXWA 4KH6A 4NLCA 3O9UA 4BRIA 3FZMA 5M1QA 2EWSA 4DQ8A 5JLHA 4JKCA 2FSNA 5AZJA 3PIPL 3T1IA 3DXMA 4JKGB 1HUXA 5EVZA 4IO9L 3U9ZA 4BRLA 1NGEA 4R79A 1Y64A 2E2PA 4YDUC 3ZIHA 5KPZA 2V7ZA 1Z6RA 3A0IX 4CZEA 1YI2N 1QVFM 4CZHA 2VCPA 4JEPA 1XEZA 4JKGA 3C6AA 3MIOA 3VEWA 3VERA 3GG4A 3W3DA 3DWLA 5FPEA 4BC5A 3E66A 2FF3B 3LDQA 3OBWA 3IFRA 4MO5A 2LN3A 4M7YA 3TTFA 3EZWA 4ISFA 5AFUA 4WFBL 3CC7N 4GNIA 3ZX3A 3E9OA 4A5AA 1RDUA 1BA1A 3KK7A 3U8XA 4OPAA 3LDLA 1IG8A 3N4QA 2A40A 5BRHA 3P39A 2W40A 3VEZA 3ENHA 5AZIB 3HTVA 2Q1NA 3WUHA 5ADXA 1TKSA 4BC4A 2VYPA 3D7EO 4QS7A 3TTDA 3VEYA 3IMXA 4J8FA 3CMAN 3L4IA 3ZYYX 2Q36A 4PL7A 1E4GT 1T6CA 2GTDA 1RGIA 3SBTA 5C2DA 2Q2RA 1BDGA 1QQOA 3QFUA 4A2BA 4PKGA 5C12A 1QQNA 2CGKA 5AQOA 4YOTA 3ZX0A 3G6EN 3LS6A 1TYQB 1GLFO 3P38A 4CD3A 3CC4N 3P4IA 2IVNA 4B1UB 3TSQA 1SAZA 2E2OA 2P9SA 4JKDA 5GAEP 5GAHP 3IUCA 5AQQA 4BQZA 3FZHA 1C0GA 1GLBG 3GBTA 3L0QA 1G58A 1BG3A 3GL1A 3VOVA 4WFAL 5AQPA 3HOSA 4XH5A 3BF1A 2GUPA 1YIJN 4EFHA 1TYQA 3C65A 1Q86O 2MX1A 2DPNA 4M7XA 4PKIA 3AY9A 1KD1O 2QWNA 2YX6A 4H0VB 4IEIA 3UE5A 1VQ7N 4I14A 1PVWA 4QS8A 4NO7A 2D0OA 2A6AA 1Z05A 4JK7A 1XQSC 4P8JA 2NRTA 4JNEA 2HOEA 5LY3A 4ILGB 5HL7L 2QWLA 5C2FA 4BG9A 3CCUN 4JKHA 1K4PA 3O1BA 4GV6A 2Q0UA 2OTLN 5AQRA 1GLAG 4AF1A 4H5TA 2QA4N 4FBKA 1BA0A 3MN5A 3QB0A 3QFPA 4FWNA 4FPAA 3ENBA 3NMUA 1ZBSA 3QBXA 5H1SQ 4P8EA 1RDWX 4HTLA 4CBUA 4BR0A 4PL8A 2E88A 3LL3A 3DLLL 3VF6A 3VEVA 4JKEA 3CMEN 4DKWA 3CCLN 4JD2A 4Y0WA 1Q7YO 2FLOA 3LDOA 5EY4A 3MCAB 4IO8A 4BR9A 3CD6N 3BP8A 3A5OC 4BY9C 4CJ7A 5E84A 5AQGA 3SAGA 5DM6L 2P9IB 4RTFD 1HRUA 5GADP 4O8UA 4BROA 3FR0A 4YOYA 3EO3A 1KC8O 4HVZA 1V4TA 3J7ZO 3A5LC 3M1FA 4CBXA 1MWKA 3U9DA 4GV9A 4IOXA 2ZJRL 2P9IA 2KLAA 2ASOA 1U2VB 2A41A 2FSJA 4GV3A 4CZJA 1NBWA 2YHXA 1LCUA 2IVPA 1VQ9N 3Q7BA 3SBGA 5FPNA 1JCEA 2P9PA 3MGZA 3MN7A 4G9ZA 2QWRA 4KH4A 2P9UA 3WEEB 3UKUB 3ULEB 4PHTX 3A5MC 1K49A 1U2VA 2HSTA 2IIRA 5DM7L 5FPMA 1S22A 4BRKA 2QEXN 3CJ9A 3E1YA 1G99A 3ID6A 1H1VA 4IEEA 2ZWHA 3QBWA 3TU5A 4F9OA 3WEEA 4BRQA 1VQNN 3UKUA 1BU6O 3ULEA 3KVGA 4JK9A 3CQYA 3PLAA 4BRAA 1T6DA 3D6RA 3VETA 3MWPA 4FOEA 3WXKA 4FSVA 1J6ZA 3OHRA 2E20A 4CZGA 3KZBA 3L7VA 1NGFA 3H3OB 1TUYA 2YHWA 1EO1A 2YCHA 1YF5L 5M1OA 4FWQA 2PAVA 1VQ4N 2P9KB 4CZLA 1ATNA 2GX9A 3UB5A 3ZEUB 3F9MA 5AFUH 3WXJA 5BRFA 3AGKA 5AQSA 2VGMA 4H0OA 2GWJA 1NGAA 4K43A 1JCUA 3I55N 5ADXH 4RCHA 4O5FA 2HBMA 4OO1J 2NRWA 2P9KA 1SQKA 2OTJN 3ATUA 3VGMA 4FOIA 3ZEUA 5AQNA 3I8BA 2FXUA 4NB4A 3MN6A 3J8AA 4P6PA 3R8EA 4JKBA 2JWKA 1NGCA 2KHOA 4FBQA 4FCXA 1KK9A 3CPWM 4RWTA 1HLUA 3ZIGA 4NZRM 4EIAA 5BRDA 1NGHA 1O13A 2P9SB 4PKHA 3WXMB 2QWQA 3CIPA 3IKMA 1W2BM 1X3MA 3H6EA 4K25A 3U4LA 2V7YA 3R3LA 1JCGA 1HKBA 2BH1A 3EN9A 3FZKA 3AAPA 4MO4A 5GINA 1HKGA 4BGBA 3OW2M 3LRJA 1EQYA 3CCQN 1NGDA 3VTHA 2RHKA 4MLHA 5AQFA 1QZ5A 5AQMA 3EE8A 2KKZA 3OBYA 5KPTA 3MMVA 1JCFA 5JMVA 4FWKA 5GIPA 5AQTA 2WUSA 1VQKN 4EHTA 1NM1A 1WUAA 5M1FA 1NGIA 2YHYA 3ATVA 3KWGA 2HF4A 2GEMA 3D2FB 4JKFA 4WQ4C 4EAHD 1HJOA 1MA9B 1NMDA 2PFUA 3K9JA 3MK5A 2WC9A 1ILYA 3LQUA 1K7JA 3ZIEA 4H03B 1YXQA 3KWIA 1ZC6A 3M6GA 1WOQA 1YUWA 3D2FA 4P77A 3DAWA 2P9NB 5AQUA 5BN9A 2P9LB 3TPQA 4B1WB 3VMFB 4BRCA 4E1BA 2ZGYA 2VWBA 4H5RA 3VESA 5JLFA 3CJAA 1V4SA 3VEOA 2YJEA 4L3QA 3FZLA 1MDUB 2WFBA 2QW9A 4YDUA 1R59O 1Q81O 2ZJPL 4JD2B 1NWKA 2E8AA 2P9NA 3G4SN 2P9LA 1GLEG 1S3XA 4JN4A 5M1PA 5BPMA 5I9EB 2ITMA 4U7BA 3E9PA 3MWTA 2F9TA 2BUPA 4H5NA 5HOOA 1YVNA 4P6DA 3C0BA 1YITN 3BEXA 1MWMA 1DEJA 2QI2A 4BVOA 4BR7A 3O8MA 2A5XA 4FBWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSU A;  3TSP A;  3VES A;  3VER A;  3VEW A;  3VF2 A;  3VEX A;  3VEN A;  3VF4 A;  3VEO A;  3TTC A;  3VTI A;  3VTH A;  3TTD A;  3VET A;  3TSQ A;  3VEZ A;  3TTF A; 
#chains in the Genus database with same CATH topology
 1T7P A;  3HPH A;  4DFM A;  1OH6 A;  3CCR N;  2XRI A;  1YVU A;  3RSE B;  4OLA A;  4CBW A;  1S72 N;  4RW7 A;  1VQ8 N;  4H0T B;  3EKS A;  1KAX A;  3OYK A;  1IKY A;  2G8W A;  4B3O A;  3T69 A;  3L2Q A;  3J80 O;  1NG9 A;  4NCX A;  4OLF A;  2VG5 A;  4FM1 A;  3AVN A;  5JVH L;  4JRP A;  1G15 A;  1HNW K;  4J2E A;  5AQZ A;  3THY B;  1VQM N;  3SLC A;  3H1Q A;  3NF6 A;  4A59 A;  4DQR A;  3GE1 A;  4CES A;  4DQS A;  4U67 L;  1YT3 A;  4O0I A;  4M3X A;  4AM7 A;  1NU0 A;  1ZBU A;  4GY2 B;  1HPM A;  3AGR A;  2IS3 A;  4RW4 A;  4KHW A;  3LAN A;  3SJH A;  3MXJ A;  2DTU A;  2OA8 A;  4X66 K;  1VSH A;  4O8K A;  5AQV A;  3AAQ A;  3THX A;  2O4I A;  1S9G A;  1W97 L;  5GAG P;  5HRO A;  4L8R B;  4IXC A;  3DOL A;  3OYJ A;  2E2Q A;  3VQE A;  5AR0 A;  4AM6 A;  5A2Q O;  5CY4 A;  3VQC A;  4BDP A;  4K41 A;  4OX9 K;  1BCO A;  2FBV A;  1ASW A;  1JLQ A;  5AJ3 K;  1DGK N;  3M8Q A;  1ATR A;  3RWU A;  2OZM A;  4HUF A;  4IFE A;  2P5O A;  2HMP A;  2PBD A;  4FW2 A;  3H07 A;  3SMS A;  4FLV A;  3KHY A;  4XIU A;  2EX3 A;  3B8A X;  1SKW A;  2CGL A;  3O1W A;  4DTN A;  4CJF A;  1KTQ A;  1TUU A;  4FJG A;  5BPL A;  2QWP A;  1L3V A;  3C94 A;  3TAF A;  3DI6 A;  3IAY A;  2Q31 A;  4CHQ A;  3I33 A;  3K2P A;  2CGJ A;  3VEX A;  1TK0 A;  1U6Z A;  2HVH A;  3WQT A;  1GLC G;  2YI1 A;  3JSM A;  3TSP A;  2BE2 A;  4LY7 A;  2P1J A;  4AHC A;  4CJ5 A;  3OYD A;  4B3T K;  2RIS A;  1SUQ A;  5KGW A;  2A3Z A;  4GMJ B;  4M63 C;  3ZET B;  4BRP A;  2D0P A;  2L8Y A;  1RBT A;  5AZI A;  5AQL A;  2F8T A;  4BRN A;  4OGC A;  3OS2 A;  2IFE A;  2RPI A;  1X3N A;  3VA3 A;  3CCE N;  1SS6 A;  4E7K A;  2DFE A;  2I7P A;  3HPG A;  3QKB A;  4FFJ A;  4MLE A;  4OPJ A;  4DR7 K;  3MX5 A;  1T8E A;  4N41 A;  4C8N A;  1LWF A;  2FC0 A;  1OVQ A;  4FJ7 A;  1HNI A;  1X9J A;  5KPR A;  1IV0 A;  3IAL A;  3J81 O;  4B1V A;  4NLB A;  3H3N O;  3OS1 A;  2HHV A;  3DXK A;  3LDN A;  1QVG M;  3AA5 X;  4NXN K;  3QES A;  2A42 A;  2LSN A;  4DS5 A;  3THV A;  5CE3 A;  4FLW A;  4FJK A;  3A5N C;  4FWS A;  4I6M B;  4FWM A;  3HBT A;  2I7N A;  3PIO L;  2KZZ A;  1JLB A;  4ISE A;  3T7Z A;  5IWA K;  2VGN A;  3F9K A;  4O55 A;  1Z25 A;  4Z4C A;  1VQO N;  5AQH A;  1D4X A;  4FLZ A;  4DB3 A;  4E7H A;  4RW8 A;  1HYZ A;  2WOM A;  4BRG A;  4BVP A;  3L2W A;  2WBN A;  3VPZ A;  3KD1 E;  1UAX A;  1N8R O;  4YOX A;  4UQG A;  4E7L A;  2YNI A;  1T44 A;  3K5M A;  3MEE A;  4B1Y B;  5GIO A;  4BG8 A;  1RDB A;  3AVM A;  3W0L A;  4OKK A;  1BQM A;  2JWL A;  4Z4E A;  3OYE A;  1S1V A;  4BRF A;  4KRF A;  3M8S A;  3EE9 A;  4O4G A;  3HOT A;  3OYN A;  1NLV A;  1VQP N;  2FBY A;  4LFA K;  4JI5 K;  2W42 A;  3O9U A;  3FZM A;  2GTC A;  4JKC A;  2FSN A;  3DXM A;  5EVZ A;  4IO9 L;  4CEE A;  5LMU K;  1NGE A;  5KPZ A;  3ZIH A;  4DTS A;  1Z6R A;  3ISN C;  1VSK A;  4KO0 A;  1QVF M;  3AO1 A;  1TL1 A;  5BR8 K;  3OYC A;  4LF8 K;  2HNZ A;  3HYF A;  3VER A;  3VEW A;  3DLK A;  3SCX A;  3DWL A;  1C6V A;  1SL2 A;  4WFB L;  3E9O A;  4Z9E A;  1X1P A;  3KK7 A;  3LDL A;  3AVF A;  1IBM K;  3P39 A;  1TKS A;  1WSE A;  2VYP A;  3D7E O;  3TTD A;  3L4I A;  1R0A A;  1C0T A;  4PL7 A;  3OYH A;  4FLT A;  4BE2 A;  3HXM A;  1N36 K;  3SQ1 A;  3MED A;  1WAJ A;  3QFU A;  4A2B A;  3AO5 A;  4DV6 K;  3P38 A;  1GLF O;  4CD3 A;  3SPZ A;  3QIP A;  1BGX T;  4B9T A;  3ZT0 A;  1WLJ A;  3L0Q A;  1BG3 A;  3LWM A;  4DSE A;  3L2R A;  1N34 K;  1Q86 O;  2HB5 A;  4MQ3 A;  4DLG A;  4M7X A;  3SUP A;  1NOY A;  4H0V B;  3UE5 A;  4I14 A;  1RQ8 A;  4NO7 A;  4CF2 A;  1S1W A;  4BDY A;  2NRT A;  2XY8 A;  3HP9 A;  4DTJ A;  3L2V A;  1PAV A;  3CCU N;  3CFR A;  2Q0U A;  2OTL N;  4KHU A;  4AF1 A;  4FBK A;  4FPA A;  2HHT A;  3DRP A;  3ENB A;  3NMU A;  4AHR A;  4BR0 A;  3V9S A;  1TKZ A;  4W5R A;  3CME N;  4Y1C A;  4DKW A;  4X64 K;  4JD2 A;  3LVJ C;  4IO8 A;  4BR9 A;  1VRT A;  1OH7 A;  4BY9 C;  1RTH A;  3SAG A;  4DF4 A;  4O8U A;  3PX6 A;  1H4T A;  1KC8 O;  4HVZ A;  1V4T A;  3A5L C;  3M1F A;  3U9D A;  4W5Q A;  2A41 A;  1SKR A;  2P9P A;  4G9Z A;  3WNG A;  4KB1 A;  4RG8 A;  3WEE B;  3UKU B;  3ULE B;  3A5M C;  1UOC A;  2R7Y A;  1L3S A;  5DM7 L;  4CED A;  1L5U A;  3ZT4 A;  1S22 A;  2QEX N;  3CJ9 A;  4YY3 K;  3E1Y A;  4IEE A;  1RDD A;  3TU5 A;  4BRQ A;  1VQN N;  2X6S A;  1YTU A;  3KVG A;  3PLA A;  1T6D A;  4DV7 K;  2Z1H A;  3WXK A;  2ZM6 K;  4PA1 A;  3U3G A;  3L7V A;  4ID1 A;  1EO1 A;  1VQ4 N;  4J2D A;  2GX9 A;  3F9M A;  3PO4 A;  1RDC A;  3WXJ A;  5AQS A;  3TAQ A;  2VGM A;  4H0O A;  2HND A;  3THW A;  1FXX A;  4Z0U A;  3DYA A;  4O5F A;  2OTJ N;  3TAP A;  1SQK A;  3ATU A;  3VGM A;  4B08 A;  2FXU A;  3QIO A;  4P6P A;  4FJN A;  2JWK A;  4FXD A;  4FJ8 A;  2YV0 X;  1NGH A;  1O13 A;  3WXM B;  3V4I A;  2QWQ A;  3U4L A;  3K5L A;  3SQ4 A;  4FK4 A;  1JCG A;  1ASU A;  1HKB A;  3EN9 A;  3FZK A;  3AAP A;  5GIN A;  2G8V A;  2X74 A;  4BGB A;  1NGD A;  4M3W A;  1T03 A;  1JCF A;  4FWK A;  1NH9 A;  1S8E A;  1VQK N;  4DWI A;  4EZ9 A;  4EHT A;  4WQ4 C;  2KFZ A;  2BAN A;  3JYT A;  3L8B A;  2WC9 A;  1ILY A;  3LQU A;  1K7J A;  3ZIE A;  5C24 A;  1YXQ A;  3WNF A;  1C1A A;  3DAW A;  1ZYQ A;  2P9L B;  4B1W B;  3VMF B;  4CIE A;  3V6D A;  3CJA A;  3P5J A;  3KK2 A;  1NFJ A;  4K8Z A;  3L2U A;  3S3O A;  4JYA K;  5BPM A;  2ITM A;  4F4K A;  1BL3 A;  3E9P A;  4AHT A;  4P6D A;  3C0B A;  3CQ8 A;  1YIT N;  1MWM A;  1JL1 A;  1H0X A;  4B9U A;  4O0J A;  4CFA A;  4QOZ B;  1KCF A;  2RE2 A;  4DV3 K;  3VQQ A;  3JXU A;  3AO3 A;  1SKS A;  2WTU A;  3ZSQ A;  2CH5 A;  2D1K A;  5AQX A;  3DLH A;  2HW3 A;  1S1T A;  3C95 A;  3O3H A;  4FJX A;  1GLD G;  4IZ9 A;  3S3N A;  3NF9 A;  3L4Q A;  2E1Z A;  4JKA A;  1K8A O;  2YJF A;  5JVG L;  2IGI A;  3CCV N;  4CFC A;  5BPN A;  3VQ6 A;  1VSI A;  4CK1 A;  3EY1 A;  3THX B;  1QHA A;  4CF8 A;  4KH5 A;  2EHG A;  2O8B B;  3OYI A;  1IBL K;  4FL9 A;  4ZHR A;  1HX1 A;  1VSE A;  2AA4 A;  4LFC K;  1RT3 A;  3CM5 A;  5I42 A;  3CC2 N;  3KTQ A;  4OVL A;  2BTF A;  4CHZ A;  3TSU A;  4ID5 A;  1M90 O;  3LVK B;  1C0U A;  2D0A A;  1WSI A;  1XNR K;  4DTU A;  4UY8 O;  3NAE A;  1DTQ A;  2ZJQ L;  4OKJ A;  4DTP A;  4RW6 A;  1EX4 A;  4NXM K;  3VEN A;  1P90 A;  2UUA K;  3TAM A;  4FWL A;  3CJC A;  4A62 A;  4KI6 A;  1KRP A;  1WAF A;  4G1Q A;  4YOR A;  3EKU A;  1SNN A;  3NBP A;  5HLF A;  3C6H A;  4BR2 A;  3MK6 A;  5FRO A;  3CCS N;  1HYS A;  3QEX A;  4IOA L;  5F0X A;  4B8C A;  3TAN A;  4I9L A;  1JLC A;  1NJX A;  3IAB A;  3SK3 A;  1VQL N;  3CQX A;  2Q0R A;  1NJW A;  5CZ1 A;  3TAG A;  4BRE A;  1JLF A;  5TKY A;  3FFK B;  4BC2 A;  5JIC A;  4K8X A;  1VQ6 N;  4JK8 A;  3I56 N;  5KQ8 A;  1T3V A;  3PSF A;  3HO1 A;  1KAY A;  3CF5 L;  4CEA A;  1IG9 A;  1A5W A;  2NRH A;  3QET A;  1BHL A;  3M3Z A;  1SL0 A;  2QM1 A;  1U04 A;  3HK2 A;  4B3S K;  5C25 A;  4FYD A;  3B6O A;  1JKH A;  4FPB A;  5T7B A;  1HKC A;  2GWK A;  3KLF A;  1L3U A;  2ASP A;  4WYB A;  4LH4 A;  5BN8 A;  1J54 A;  4JAX A;  1OKJ A;  4N47 A;  4ILH A;  3GOI A;  3MCP A;  1M1K O;  2FF6 A;  2W41 A;  3MXI A;  5FRN A;  3DXK B;  5LJW A;  2AJQ A;  4DS4 A;  3E9L A;  3VGL A;  1IH7 A;  4C8M A;  1GLJ O;  1IO2 A;  2UXB K;  3K59 A;  4MDB A;  5LL6 Z;  3QER A;  4K88 A;  4C1N K;  4XEI A;  4B1X B;  1WBB A;  3C7N A;  2F9W A;  3MAQ A;  4Z94 A;  3HRG A;  5J2N A;  3LAM A;  2NLX A;  3OA9 A;  4XH1 A;  2V51 B;  3K57 A;  3CCM N;  1K73 O;  3SV4 A;  4JHD A;  3H1V X;  5EX5 A;  4A2A A;  4YNQ A;  1JJ2 M;  4ICL A;  5BR9 A;  3KKR A;  4WQ5 A;  1HQU A;  2ETJ A;  3O4W A;  2O8D A;  4AHV A;  1K8K A;  1XNQ K;  5F1X A;  3TI0 A;  3H46 O;  3AAR A;  3ZX2 A;  4WCE L;  4E7J A;  3NH2 A;  1TAU A;  5KRT A;  3WNE A;  1RDA A;  1Q82 O;  5IT9 O;  3WXI A;  1H0Y A;  3R6M A;  4CZF A;  4IBN A;  3VF2 A;  2O8E A;  1ITG A;  3O9T A;  2GEL A;  3DRS A;  2UU9 K;  5TKW A;  1VAZ A;  4DG1 A;  4YKE A;  5LJV A;  1RCH A;  3DXM B;  4QAG A;  4JI1 K;  3K5O A;  2IOC A;  1IJJ A;  4NLC A;  4DQ8 A;  3PIP L;  3F73 A;  3K0S A;  1HUX A;  4FVM A;  3U9Z A;  1ASV A;  1Y64 A;  2O4G A;  1VK0 A;  1QS4 A;  4MFB A;  3A0I X;  3ZCM A;  1Y97 A;  3DM2 A;  4CHO A;  2VQF K;  4CIG A;  1XEZ A;  4JKG A;  3AV9 A;  3C6A A;  3ZSR A;  4BC5 A;  3E66 A;  1LAV A;  3I0S A;  4YHH K;  1HNX K;  2FF3 B;  3LDQ A;  4CHP A;  4MO5 A;  3IFR A;  4ISF A;  3ZX3 A;  3QEI A;  4A5A A;  4F2R A;  1HYV A;  4FM2 A;  1KLM A;  3N4Q A;  3J7A P;  1BIZ A;  5BRH A;  1RTJ A;  3HP6 A;  3VEZ A;  3ENH A;  3HTV A;  4BC4 A;  2VWJ A;  2Z1I A;  2ZE2 A;  2XY7 A;  4N76 A;  4OJR A;  4DSF A;  4K86 A;  1E4G T;  3BDP A;  1T6C A;  1QSS A;  2GTD A;  3RR7 A;  1BDG A;  2HHH K;  3TAB A;  1B92 A;  3LS6 A;  1RNH A;  3CC4 N;  2P5G A;  1UA0 A;  4B1U B;  3RR8 A;  4JKD A;  5HP1 A;  2KQ2 A;  4FJH A;  1G58 A;  4DQQ A;  4CEQ A;  5I3U A;  4HHT A;  4RW9 A;  3VOV A;  4Z4G A;  4XH5 A;  3BF1 A;  2GUP A;  1OH5 A;  2O8F A;  2Q3V A;  4EFH A;  5JS2 A;  4Q15 A;  2MX1 A;  1ZBH A;  4PKI A;  2HHU A;  2YX6 A;  3U3Y A;  3SUQ A;  4ZTJ A;  4LF6 K;  1B9D A;  1PVW A;  1S6P A;  4P8J A;  3AVH A;  5LY3 A;  1RT4 A;  2HOE A;  5HL7 L;  2D0B A;  4CJS A;  1RBS A;  5EU7 A;  2HHS A;  3MEC A;  3VA0 A;  2E4L A;  5AQR A;  1GLA G;  3QFP A;  1QHT A;  1ZBS A;  3QBX A;  4FLY A;  1TVR A;  4HTL A;  2E88 A;  3LL3 A;  3VEV A;  1JLE A;  3CCL N;  1Q7Y O;  4CVN E;  2FLO A;  3V9Z A;  1JE3 A;  3NH0 A;  1EKE A;  1YTA A;  3PO5 A;  4RTF D;  4W5N A;  4CER A;  1HRU A;  3HVT A;  4I7F A;  4M41 A;  4DR1 K;  2D0C A;  3SI6 A;  4GV9 A;  1JDQ A;  1BI4 B;  2ZJR L;  1EP4 A;  2P9I A;  5HRP A;  1EET A;  2ZD1 A;  4M45 A;  3K5N A;  3Q7B A;  1JCE A;  3MN7 A;  2QWR A;  4FJL A;  4B9S A;  1LAW A;  1U49 A;  3NHG A;  1I3A A;  1N32 K;  4CJE A;  2E5L K;  1U2V A;  2HST A;  4I2P A;  3CFP A;  3OYL A;  3ID6 A;  4AH9 A;  4FJ9 A;  1H1V A;  2ZWH A;  3QBW A;  4EP5 A;  4F9O A;  1GOB A;  5CYQ A;  4CIF A;  3CQY A;  4GKK K;  4C8O A;  2D5R A;  1WNS A;  3VET A;  4JI2 K;  4DSJ A;  1J6Z A;  4X65 K;  2YHW A;  5J1E A;  4KV8 A;  3KD5 E;  4I9Q A;  3THW B;  5M1O A;  4FWQ A;  1N5Y A;  1VSD A;  1ATN A;  5AFU H;  1VR4 A;  1NK4 A;  4F3T A;  4Z4F A;  5JS1 A;  2WON A;  1JCU A;  4CJ3 A;  4RCH A;  4OO1 J;  2G8H A;  5DK5 A;  2E6L A;  4FOI A;  3ZEU A;  4JI6 K;  1N33 K;  4NB4 A;  4M3Z A;  2P51 A;  3J8A A;  4CF0 A;  3LAL A;  2GBZ A;  4FBQ A;  3CPW M;  1TK5 A;  3ZIG A;  4NZR M;  4N5S A;  2P9S B;  1Y9X A;  3IKM A;  1W2B M;  1X3M A;  3H6E A;  4CJV A;  2V7Y A;  3R3L A;  4MO4 A;  3OW2 M;  3LRJ A;  3VTH A;  5AQF A;  4GKJ K;  1QZ5 A;  5AQM A;  3LZJ A;  5GIP A;  4Y1D A;  5HBM A;  3KWG A;  4JKF A;  2HF4 A;  4EAH D;  3TAE A;  1NK6 A;  1NMD A;  4IDK A;  3MK5 A;  4GVM A;  3KWI A;  1NMN A;  1ZC6 A;  3B6P A;  1WOQ A;  1YUW A;  1WSJ A;  2G8U A;  1C1C A;  3VES A;  5DMR A;  2OCE A;  4JV5 K;  4L3Q A;  2RF2 A;  2QW9 A;  1R59 O;  3MEG A;  1Q81 O;  2ZJP L;  1NWK A;  1VRU A;  2E6M A;  1GLE G;  4DR6 K;  4U7B A;  1D5A A;  2RKI A;  4JS4 A;  1CZB A;  3NGI A;  4QCL A;  1DEJ A;  3AA4 A;  5HRN A;  4BVO A;  1U47 A;  4MDA A;  1VSF A;  5KRS A;  3KLH A;  3AO2 A;  1K9M O;  1TAQ A;  1D9D A;  3R9P A;  4DCH A;  1XHZ A;  1RTD A;  2VQE K;  3O9S A;  4ILJ A;  1K4L A;  2BGG A;  3QNN A;  4HUE A;  3V9U A;  3QEP A;  1ATS A;  4YOU A;  3CCJ N;  3LDS A;  2G8F A;  3LDP A;  1JLA A;  3OYG A;  4IOC L;  4DFP A;  3HZ7 A;  2P9U B;  2ZGZ A;  4DTR A;  4CHN A;  3SNN A;  3PX4 A;  1LW0 A;  2E2N A;  4K42 A;  4DQP A;  4LFB K;  5KTQ A;  4EZ6 A;  1ZBI A;  3M8R A;  2IVO A;  4DR5 K;  2NZT A;  3KK3 A;  3BY5 A;  1YJN N;  2E1Y A;  4B8A B;  4A61 A;  1KAZ A;  1NGJ A;  4JS5 A;  1YJ9 N;  1KXP A;  3RMA A;  4H8K A;  5CHI A;  4KB0 A;  3RRG A;  1VSJ A;  4E1N A;  3F5T A;  2HVI A;  4CZM A;  2F7T A;  2QXL A;  1Y2I A;  4JI7 K;  3SAF A;  5AQW A;  1YHQ N;  4B9Q A;  1TKT A;  4CI6 A;  1HPZ A;  3M8P A;  2QKB A;  1RT5 A;  2NNW A;  3QDK A;  1WSG A;  1F21 A;  4AHU A;  3L3U A;  1G57 A;  2QXF A;  4A57 A;  3FZF A;  3UKR A;  3VTI A;  5J2P A;  4F8R A;  5CR4 A;  4JI4 K;  3EEQ A;  4H5V A;  3FGU A;  1REV A;  1W0H A;  1J9A A;  1BO5 O;  2NRR A;  3U6F A;  1DT9 A;  3O6W A;  5KQD A;  4DR3 K;  3CJ7 A;  1NGG A;  1QSY A;  1GLL O;  3ZII A;  3P04 A;  3SAH A;  3IAB B;  4CGF A;  1CZA N;  4J2A A;  3DOK A;  3JS6 A;  1CZ9 A;  4CGH A;  3CET A;  4M3U A;  4E1M A;  2HF3 A;  3D2E A;  4NZT M;  3KKS A;  2CH6 A;  4R5P A;  5LMN K;  3MXM A;  2CRQ A;  1FK9 A;  4HVC A;  3S41 A;  4BRD A;  4DR2 K;  5E41 A;  2Y1B A;  1EWR A;  3KJV A;  3DMJ A;  5B8H A;  3QIC A;  1KQS M;  1XC3 A;  1VQ5 N;  4H0P A;  4BRM A;  2UXD K;  4HVJ A;  3M5R A;  3CM6 A;  3SUO A;  3CI5 A;  4FWR A;  1IKV A;  4LC9 B;  2PZS A;  2NRZ A;  5KI6 A;  3LP2 A;  4CJ4 A;  4FZZ A;  4FVU A;  4FJI A;  4CHY A;  3BUZ B;  4CJK A;  4WFN L;  2Q97 A;  1RT6 A;  1VHX A;  3QML A;  2QWO A;  3TTC A;  1WN7 A;  1RIL A;  3U6Y A;  3WXL A;  4C8L A;  1BWF O;  3HM8 A;  4NYN A;  5K14 A;  2O8C A;  5FDL A;  1U4B A;  3P1G A;  3O9Q A;  3A8Y A;  4FWP A;  4KTZ A;  3NVM A;  1J53 A;  3C7N B;  4JI0 K;  1XMO K;  2Y1J A;  3HSC A;  4CJR A;  5ELZ A;  4HCC A;  1EWQ A;  2X78 A;  2NRV A;  4IDH A;  5E26 A;  1BCM A;  3ZSV A;  1ZXO A;  3V81 A;  5EXW A;  3NGZ A;  4XH4 A;  2FSK A;  4YOW A;  3CHW A;  4JHD B;  5M1N A;  2XHB A;  3D45 A;  1RBV A;  3HM9 A;  5FPD A;  2Q3S A;  2UUB K;  3DLG A;  3AO4 A;  3PY8 A;  2O8D B;  2OPR A;  1K8K B;  1JL2 A;  4IWV A;  3HZ6 A;  3MDQ A;  4LH5 A;  1NGB A;  3RMB A;  4M3Y A;  3QEV A;  5KGX A;  2I5J A;  4WF9 L;  4JI3 K;  3SQ2 A;  1RT7 A;  3O9R A;  3EL2 A;  2UXC K;  1QTM A;  2KW4 A;  2HBL A;  3VQ7 A;  2QWM A;  3CJ1 A;  3FFI A;  3CXC M;  1HNZ K;  4CZI A;  3LM9 A;  3LM2 A;  2RIU A;  2B5J A;  1HMV A;  1E4F T;  1NJ1 A;  2YKN A;  4P6C A;  3VQ9 A;  4FO0 A;  2KTQ A;  3LP0 A;  1S9E A;  4A5B A;  1BIU A;  3OJU A;  3QEW A;  4H0Y B;  4CW7 B;  2IAJ A;  4ISG A;  2B4J A;  4DMN A;  3O4N A;  1I94 K;  1XI1 A;  2W6L A;  2BKY X;  4DTO A;  4CZK A;  1Z26 A;  3RVC A;  4Q0B A;  1JXB A;  4BRI A;  2EWS A;  5J2Q A;  1TKX A;  5AZJ A;  1KVA A;  3LP3 A;  4JKG B;  1JO0 A;  2UUC K;  4BRL A;  1Q9Y A;  1NKC A;  2V7Z A;  1N6Q A;  3ASM A;  4CFB A;  3HL8 A;  2VCP A;  4JEP A;  3MIO A;  2G8K A;  1EXQ A;  3GG4 A;  1QQC A;  5FPE A;  3ZT1 A;  1CXU A;  2ZQB A;  3OBW A;  3CC7 N;  3EZW A;  5AFU A;  2BDP A;  3U8X A;  1LV5 A;  3NF8 A;  2W40 A;  5AZI B;  1WB9 A;  1Q8I A;  4FZX C;  2KFN A;  2W6K A;  3IMX A;  4J8F A;  5SWM A;  3CMA N;  4OPK A;  2Q36 A;  3OYA A;  4BDZ A;  1RGI A;  2RN2 A;  3SBT A;  5C2D A;  1QQO A;  1KFD A;  5C12 A;  2CGK A;  4YOT A;  3G6E N;  2A1S A;  3P4I A;  3TSQ A;  5GAH P;  3ALY A;  1H4S A;  5GAE P;  3FZH A;  3GBT A;  2HMI A;  3GL1 A;  2M71 A;  4CE9 A;  3KIO A;  5AQP A;  4DTM A;  1YIJ N;  3VQP A;  1VSM A;  3TR8 A;  1TYQ A;  3C65 A;  1JLG A;  2OPS A;  3AVL A;  3SZ2 A;  4IEI A;  4KHQ A;  1DTT A;  1UDV A;  4QS8 A;  2D0O A;  2A6A A;  1Z05 A;  4JNE A;  2F4V K;  4ILG B;  2QWL A;  5C2F A;  4DSL A;  4BG9 A;  1IBK K;  4JKH A;  4GV6 A;  1HRH A;  4DUZ K;  3QB0 A;  1KSP A;  5H1S Q;  1QE1 A;  4IFV A;  3ZLJ A;  4PL8 A;  2Z1J A;  3V1R A;  4JKE A;  4CEB A;  1HNV A;  2EH1 A;  4LF4 K;  4Y0W A;  1NNE A;  3LDO A;  5EY4 A;  3MCA B;  4YFU A;  4V19 S;  3A5O C;  1HR0 K;  4CJ7 A;  4B9N A;  5AQG A;  4HTU A;  4DFK A;  4M42 A;  5DM6 L;  2P9I B;  4CK2 A;  3OS0 A;  2NUB A;  1X9W A;  2YNG A;  4BRO A;  3EO3 A;  3J7Z O;  4CBX A;  1MWK A;  4IOX A;  4BE0 A;  3NGY A;  2ASO A;  1U2V B;  4E3S A;  3VN5 A;  3RMC A;  2YHX A;  1LCU A;  2IVP A;  1TKD A;  3ZSZ A;  3RMD A;  3VQ5 A;  3SBG A;  3C6T A;  5FPN A;  4AQY K;  4LF9 K;  3MGZ A;  1NJ5 A;  1HC7 A;  4DFJ A;  4CEZ A;  4PHT X;  1KLN A;  2IIR A;  4FJM A;  1II7 A;  4BRK A;  3VQ4 A;  1FKP A;  3NFA A;  5J2M A;  1WSH A;  4GW6 A;  4CGD A;  1O1W A;  4JK9 A;  2GV9 A;  3D6R A;  2X6N A;  3MWP A;  3AVG A;  2O8B A;  4FSV A;  3OHR A;  2PYL A;  4KHS A;  3KZB A;  1NGF A;  2Y1I A;  1TUY A;  4LD0 A;  4PUO A;  2YCH A;  3P83 D;  1IKX A;  1YF5 L;  4JLH A;  3AVK A;  4O5B A;  1S1U A;  3DLE A;  3ZEU B;  1A5V A;  1NFH A;  5BRF A;  1E3M A;  1NJ2 A;  1NGA A;  3I55 N;  4CEC A;  5ADX H;  2P9K A;  5AQN A;  2LXR A;  3I8B A;  4WE1 A;  3HST B;  4AIL C;  4DQI A;  3R8E A;  4JKB A;  5SZT A;  2KHO A;  4KKO A;  2PYJ A;  1KK9 A;  1HLU A;  4DV5 K;  4EIA A;  1HJR A;  1VM0 A;  3LPT A;  5BRD A;  3S9H A;  4CJW A;  1IKW A;  4K25 A;  2BH1 A;  3WNH A;  1HKG A;  1RBU A;  1EQY A;  4MLH A;  3OYM A;  3NCI A;  3OBY A;  3MMV A;  5JMV A;  4DSK A;  1TV6 A;  1TK8 A;  5M1F A;  2YHY A;  2Z1G A;  3ATV A;  2JGU A;  1HJO A;  1MA9 B;  4HD0 A;  4N56 A;  3BZC A;  1SL1 A;  4JI8 K;  3K9J A;  4CCH A;  1SV5 A;  1C1B A;  3QO9 A;  3D2F A;  3PUF A;  1K6Y A;  2ZGY A;  2VWB A;  3DSD A;  5JLF A;  1V4S A;  3VEO A;  3G10 A;  1MDU B;  2WFB A;  4YDU A;  1NOZ A;  4JD2 B;  2E8A A;  2P9N A;  3G4S N;  4BAC A;  4JN4 A;  5M1P A;  4IG3 A;  2GUI A;  4FM0 A;  2H9U A;  2F9T A;  4H5N A;  5HOO A;  1YVN A;  3NH1 A;  2DFF A;  2A1R A;  3TAR A;  2QI2 A;  4BR7 A;  3O8M A;  3TPQ A;  2A5X A;  1JXE A;  4FBW A;  3CPE A;  1YJW N;  1K4I A;  4O44 A;  3O3F A;  3O4Q A;  3Q7C A;  2JLE A;  1DLO A;  1DKG D;  5FLX O;  1C0F A;  3OJS A;  3O5B A;  2P9P B;  4CJT A;  3LZI A;  5CZ2 A;  3RSE A;  3ITH A;  2HHW A;  1OH8 A;  3SPY A;  2QTD A;  1BQN A;  1J5E K;  2QKK A;  1W9H A;  2XY5 A;  3H45 C;  5AQY A;  3MX2 A;  4H4M A;  4PY5 A;  4HCB A;  4E89 A;  4KBO A;  4FW1 A;  2F8S A;  5D3G A;  5EOY A;  4WQ4 A;  4CFD A;  4OLB A;  5F2R A;  5C0Y A;  4BRH A;  4F3O A;  3THY A;  3NVK A;  4DU3 A;  1LOT B;  4BC3 A;  4OPH A;  5AQJ A;  1CXQ A;  4W5T A;  1FW6 A;  4B9L A;  3AJE A;  3UKR B;  1KVC A;  5M1K A;  4IJN A;  4EHU A;  1X9S A;  2V52 B;  1RT1 A;  4OKE A;  3G71 N;  1QZ6 A;  3ZT3 A;  3F2K A;  4DU1 A;  5AQI A;  1OVY A;  3CG7 A;  3O80 A;  3SJJ A;  3RTV A;  4BGA A;  1K4O A;  3V1O A;  4BR4 A;  4EO0 A;  1XUP O;  2UYT A;  4FLU A;  2ASM A;  3KLI A;  4KAZ A;  3CJB A;  3G25 A;  1NKB A;  4ZTF A;  1B9F A;  1PVY A;  4CD1 A;  3OY9 A;  2EQA A;  1LN4 A;  3CER A;  4IJA A;  3D2E B;  2EK0 A;  4X62 K;  4C23 A;  4TSX A;  4QS9 A;  1NJI O;  4B3R K;  5C10 A;  3G0Z A;  3V9X A;  4M3T A;  4LSN A;  1RTI A;  3SQ0 A;  3TOE A;  1WSF A;  1QQM A;  2A2Y A;  4GVE A;  3WQU A;  3LP1 A;  3AVB A;  4C1N I;  3DSC A;  2AP1 A;  2QK9 A;  4YDQ A;  2HBJ A;  4W5O A;  1YAG A;  3LWL A;  3VF4 A;  4KHN A;  5MLC Q;  3QIN A;  4WQ5 C;  5BRE A;  4KPY A;  1HQE A;  1SZ2 A;  3S3M A;  3IRX A;  3R1X A;  3T3F A;  4LF7 K;  1U45 A;  3T1A A;  3OVN A;  3WT0 A;  4KRE A;  5FRM A;  2P9B A;  1NJY A;  1Q9X A;  4J2B A;  3QLH A;  1NK7 A;  3ZET A;  2HNY A;  2OAN A;  3FE1 A;  4IFY A;  3GDQ A;  3V1Q A;  3SV3 A;  4FK2 A;  2O8C B;  2HBK A;  4HUG A;  4HWI A;  3NE6 A;  1C0M A;  1TGO A;  1RT2 A;  5C42 A;  4FWO A;  3ID8 A;  3T1Y K;  2HHX A;  1IEZ A;  1VSL A;  1S6Q A;  3DJC A;  1KVB A;  4DHY A;  3RRH A;  1NK8 A;  1X9M A;  2KZM A;  4PQU A;  1LWC A;  3BZK A;  3N4P A;  4Q5V A;  3OTO K;  4YOV A;  2ZF5 O;  1QSL A;  2DY4 A;  3L6Q A;  3HVR A;  1XHX A;  2VWK A;  4AHS A;  1ESV A;  4BQL A;  2VG6 A;  4KTQ A;  1BOT O;  1BUP A;  3AVA A;  3VGK A;  4BR5 A;  2D4W A;  3MN9 A;  2J4R A;  3DRR A;  3E01 A;  4DU4 A;  3IDH A;  1GOA A;  1NJ8 A;  3AA2 A;  2NRX A;  4CJU A;  2FBT A;  4I6M A;  4ELU A;  2YKM A;  3HI0 A;  4CGG A;  3K9K A;  3ZSX A;  4NCA A;  3O08 A;  3LPU A;  3BF3 A;  1XC9 A;  4B1Z A;  2B6A A;  3O3G A;  5C15 A;  4H0X B;  3T19 A;  3OYB A;  1L3T A;  4CGI A;  1XMQ K;  1P8Z A;  4E0D A;  3VQB A;  3SYZ A;  1BI4 A;  4CF9 A;  1RFQ A;  4FJ5 A;  4CJL A;  3HPO A;  3AVI A;  4BWJ A;  3VQD A;  3A2F A;  4H5W A;  1TKU A;  4DV0 K;  2H3G X;  4EP4 A;  4E1J A;  5AZJ B;  3FLC O;  4B9V A;  4F2S A;  3ENO A;  3P31 A;  5AQK A;  1WBD A;  1Q18 A;  1UA1 A;  3K58 A;  4TWA A;  4KH6 A;  1NK0 A;  3IG1 A;  5M1Q A;  5JLH A;  4DF8 A;  4B3M K;  3T1I A;  3PV8 A;  1MU2 A;  2Z7C A;  4R79 A;  2E2P A;  4YDU C;  5HRR A;  1LWE A;  4CZE A;  1YI2 N;  4CZH A;  3SUN A;  3W3D A;  4DR4 K;  2LN3 A;  4M7Y A;  3TTF A;  3J7Y P;  4GNI A;  2OYQ A;  1RDU A;  1BA1 A;  3KK1 A;  4OPA A;  1IG8 A;  2YNH A;  2A40 A;  1NJ6 A;  3OYF A;  1H4Q A;  3WUH A;  2Q1N A;  4CF1 A;  5ADX A;  4QS7 A;  4DLE A;  3VEY A;  4BWM A;  3ZYY X;  3I8D A;  3WBM A;  4C8K A;  2YHB A;  4FLX A;  3CYM A;  2Q2R A;  4Z4H A;  2ITG A;  1FKO A;  1QQN A;  4PKG A;  4IG0 A;  5AQO A;  3ZX0 A;  5HRS A;  1A5X A;  3AA3 A;  1TYQ B;  3ZSW A;  1LW2 A;  2IVN A;  1SAZ A;  2E2O A;  2P9S A;  2DFH A;  2FBX A;  5AQQ A;  3IUC A;  4BQZ A;  1C0G A;  1GLB G;  5CYM A;  4WFA L;  4B9M A;  3HOS A;  2XO7 A;  4M3R A;  2DPN A;  1KD1 O;  3AY9 A;  2QWN A;  1VQ7 N;  3H08 A;  4DUY K;  4ELV A;  4JK7 A;  1XQS C;  1T05 A;  1K4P A;  3O1B A;  4I2Q A;  4H5T A;  2QA4 N;  3MN5 A;  1BA0 A;  2YHA A;  4FWN A;  3KLG A;  4P8E A;  1RDW X;  3ULD A;  1NJZ A;  4CBU A;  3PSI A;  4CEO A;  3DLL L;  3VF6 A;  1RBR A;  4FK0 A;  1W7A A;  3KLE A;  1I39 A;  1S1X A;  3DLR A;  3NDK A;  3IS9 A;  1ZBL A;  3CD6 N;  3HJF A;  3BP8 A;  4JRQ A;  4IKF A;  1ZBF A;  5E84 A;  4DSI A;  4FZY A;  1D9F A;  3VQA A;  5GAD P;  1TIG A;  1NKE A;  2F96 A;  1FJG K;  4YOY A;  3FR0 A;  4FJJ A;  4DV1 K;  1TL3 A;  4KHY A;  4KTW A;  2KLA A;  3ZT2 A;  2FSJ A;  2IC3 A;  2O8E B;  4GV3 A;  1NBW A;  4H4O A;  4CJQ A;  1VQ9 N;  2G8I A;  3ZSY A;  4KH4 A;  3DLB A;  1J5O A;  4NCB A;  2P9U A;  4Z4I A;  4CEF A;  4K87 A;  1K49 A;  4KHP K;  4CJP A;  5FPM A;  1G99 A;  1S5J A;  3LAK A;  3V9W A;  4BE1 A;  3TWH A;  3WEE A;  1U48 A;  3UKU A;  1BU6 O;  3ULE A;  4FCY A;  4KFB A;  4BRA A;  2OZS A;  4FOE A;  3C6U A;  3BGR A;  2XY6 A;  2E20 A;  2OPQ A;  4CZG A;  1KFS A;  3H3O B;  3EYZ A;  3PX0 A;  2PAV A;  3HT3 A;  2P9K B;  4CZL A;  2YNF A;  3UB5 A;  4DV2 K;  2VG7 A;  4PWD A;  3AGK A;  1UWB A;  3I0R A;  2PY5 A;  2GWJ A;  4K43 A;  1CLQ A;  4DV4 K;  2HBM A;  2NRW A;  4NCG A;  4NYF A;  1BIS A;  3MN6 A;  3AVC A;  4WI1 A;  1NGC A;  1D8Y A;  4FCX A;  4RWT A;  1NK9 A;  4PKH A;  3CIP A;  3D0P A;  2HHQ A;  3CFO A;  2IDO A;  3ZSO A;  4E7I A;  3L3V A;  2O8F B;  3CCQ N;  2RHK A;  3EE8 A;  1GOC A;  2KKZ A;  4LSL A;  1NK5 A;  5KPT A;  2OPP A;  2ATQ A;  5AQT A;  2WUS A;  1DCJ A;  1NM1 A;  1WUA A;  4DTX A;  1NGI A;  4K0K K;  2GEM A;  3D2F B;  3NF7 A;  2PFU A;  4H03 B;  3VQ8 A;  3M6G A;  3EZ5 A;  4P77 A;  2P9N B;  5AQU A;  5BN9 A;  4CK3 A;  4E1B A;  4BRC A;  4H5R A;  2YJE A;  3FZL A;  4KI4 A;  4E19 A;  4CGJ A;  3JAM O;  3T1H K;  2P9L A;  1S3X A;  1XWL A;  3QNO A;  4ELT A;  5I9E B;  3UIQ A;  4LF5 K;  3MWT A;  2BUP A;  3AVJ A;  4OGE A;  3BEX A;  4CZJ A;  3SMP A; 
#chains in the Genus database with same CATH homology
 4MDA A;  3CPE A;  1YJW N;  1K4I A;  1K9M O;  3CCR N;  3RSE B;  3R9P A;  4DCH A;  2RE2 A;  4CBW A;  1S72 N;  3JXU A;  1K4L A;  3O9S A;  4ILJ A;  3Q7C A;  4H0T B;  1VQ8 N;  3EKS A;  2CH5 A;  1DKG D;  2D1K A;  1KAX A;  5AQX A;  1C0F A;  3T69 A;  1ATS A;  3O5B A;  2P9P B;  4YOU A;  3CCJ N;  3RSE A;  3LDP A;  4IOC L;  5JVH L;  2QTD A;  2P9U B;  2ZGZ A;  1GLD G;  3H45 C;  2E2N A;  3MX2 A;  4IZ9 A;  5AQY A;  5AQZ A;  4K42 A;  3L4Q A;  1VQM N;  2E1Z A;  4JKA A;  3SLC A;  3H1Q A;  4A59 A;  4KBO A;  2IVO A;  3GE1 A;  2NZT A;  1K8A O;  2YJF A;  5JVG L;  3CCV N;  4U67 L;  5BPN A;  1YJN N;  2E1Y A;  5EOY A;  4WQ4 A;  4AM7 A;  5F2R A;  4A61 A;  5C0Y A;  1KAZ A;  1NGJ A;  4GY2 B;  1YJ9 N;  4BRH A;  1HPM A;  1KXP A;  3AGR A;  1QHA A;  5CHI A;  4KH5 A;  3NVK A;  1LOT B;  4BC3 A;  3SJH A;  3F5T A;  4FL9 A;  4OPH A;  5AQJ A;  4CZM A;  3AJE A;  1HX1 A;  2QXL A;  2AA4 A;  2F7T A;  4O8K A;  5AQV A;  3AAQ A;  3CC2 N;  3SAF A;  3UKR B;  5AQW A;  5M1K A;  4IJN A;  4B9Q A;  1W97 L;  1YHQ N;  2BTF A;  4EHU A;  4CI6 A;  5GAG P;  3TSU A;  1M90 O;  2V52 B;  4IXC A;  2NNW A;  3QDK A;  2E2Q A;  3G71 N;  1QZ6 A;  4UY8 O;  5AR0 A;  3F2K A;  4AM6 A;  1G57 A;  5AQI A;  1OVY A;  4A57 A;  3FZF A;  3O80 A;  2ZJQ L;  3UKR A;  3VTI A;  4K41 A;  5CR4 A;  4BGA A;  1K4O A;  4BR4 A;  4EO0 A;  4H5V A;  3VEN A;  1DGK N;  3FGU A;  1ATR A;  1XUP O;  2UYT A;  4IFE A;  1BO5 O;  1P90 A;  2ASM A;  1DT9 A;  2HMP A;  2NRR A;  2PBD A;  3CJB A;  3G25 A;  4FWL A;  3CJC A;  4A62 A;  3O6W A;  3H07 A;  3SMS A;  5KQD A;  3CJ7 A;  1NGG A;  1PVY A;  3KHY A;  1GLL O;  4CD1 A;  3ZII A;  3P04 A;  2EQA A;  3B8A X;  4YOR A;  3CER A;  2CGL A;  3EKU A;  3O1W A;  1SNN A;  4IJA A;  3D2E B;  3C6H A;  3SAH A;  4BR2 A;  1CZA N;  1TUU A;  3MK6 A;  4C23 A;  5BPL A;  3CCS N;  2QWP A;  4QS9 A;  1NJI O;  3JS6 A;  4IOA L;  3CET A;  5C10 A;  5F0X A;  2Q31 A;  2HF3 A;  3D2E A;  4NZT M;  3I33 A;  2CH6 A;  2CGJ A;  3VEX A;  1U6Z A;  3SK3 A;  3WQT A;  1VQL N;  1GLC G;  3CQX A;  2Q0R A;  2YI1 A;  3S41 A;  4BRE A;  1QQM A;  4BRD A;  3TSP A;  5TKY A;  4GVE A;  3FFK B;  3WQU A;  4BC2 A;  3QIC A;  5B8H A;  4C1N I;  1KQS M;  2AP1 A;  5JIC A;  1XC3 A;  1VQ5 N;  4H0P A;  1VQ6 N;  2HBJ A;  4JK8 A;  2RIS A;  3I56 N;  1YAG A;  4BRM A;  3VF4 A;  5KQ8 A;  1T3V A;  3M5R A;  5MLC Q;  4WQ5 C;  5BRE A;  1KAY A;  2A3Z A;  4M63 C;  3CF5 L;  3ZET B;  1SZ2 A;  3CI5 A;  4BRP A;  2D0P A;  2NRH A;  3R1X A;  4FWR A;  5AQL A;  5AZI A;  4LC9 B;  2NRZ A;  3M3Z A;  4BRN A;  3WT0 A;  2QM1 A;  2P9B A;  1X3N A;  4FVU A;  3BUZ B;  4FPB A;  3CCE N;  1HKC A;  2GWK A;  2OAN A;  2Q97 A;  3FE1 A;  1SS6 A;  3GDQ A;  3ZET A;  4WFN L;  3QML A;  2HBK A;  4HWI A;  2I7P A;  3TTC A;  2ASP A;  2QWO A;  4WYB A;  5BN8 A;  4FFJ A;  4FWO A;  3ID8 A;  4MLE A;  4JAX A;  1OKJ A;  3WXL A;  1IEZ A;  1BWF O;  3MX5 A;  3HM8 A;  4ILH A;  3DJC A;  3GOI A;  3MCP A;  4DHY A;  2FF6 A;  1M1K O;  2W41 A;  3DXK B;  3O9Q A;  3N4P A;  3A8Y A;  4FWP A;  5LJW A;  3E9L A;  3NVM A;  3VGL A;  1X9J A;  5KPR A;  4YOV A;  2ZF5 O;  3C7N B;  4B1V A;  1GLJ O;  4NLB A;  3H3N O;  3L6Q A;  3HSC A;  5ELZ A;  1ESV A;  2NRV A;  3DXK A;  3LDN A;  1QVG M;  4MDB A;  4BQL A;  4IDH A;  2A42 A;  4XEI A;  4C1N K;  5E26 A;  4B1X B;  1BOT O;  1BUP A;  3C7N A;  3VGK A;  4BR5 A;  5CE3 A;  1ZXO A;  2F9W A;  2D4W A;  3A5N C;  4FWS A;  3MN9 A;  4FWM A;  4I6M B;  3HBT A;  4XH4 A;  2FSK A;  2I7N A;  2J4R A;  3CHW A;  4JHD B;  4Z94 A;  5M1N A;  4YOW A;  3HRG A;  3PIO L;  4ISE A;  3T7Z A;  2NLX A;  2VGN A;  3OA9 A;  3IDH A;  5FPD A;  1VQO N;  3SMP A;  4XH1 A;  2V51 B;  5AQH A;  3CCM N;  1K73 O;  2NRX A;  1K8K B;  1D4X A;  3HZ6 A;  3MDQ A;  4I6M A;  4IWV A;  4DB3 A;  1NGB A;  4JHD A;  3H1V X;  3HI0 A;  5EX5 A;  4A2A A;  1JJ2 M;  3K9K A;  4BRG A;  5BR9 A;  4WQ5 A;  4BVP A;  2WBN A;  3O4W A;  3VPZ A;  4WF9 L;  3O08 A;  3O9R A;  3BF3 A;  3EL2 A;  1K8K A;  4B1Z A;  1N8R O;  5F1X A;  2HBL A;  4YOX A;  2QWM A;  3H46 O;  4H0X B;  5C15 A;  3CJ1 A;  1T44 A;  3AAR A;  3ZX2 A;  4WCE L;  3CXC M;  4B1Y B;  5GIO A;  4BG8 A;  4CZI A;  3LM9 A;  3LM2 A;  1P8Z A;  2RIU A;  1Q82 O;  1E4F T;  3WXI A;  4P6C A;  3R6M A;  3W0L A;  4FO0 A;  4CZF A;  1RFQ A;  3VF2 A;  2JWL A;  4A5B A;  3O9T A;  4H0Y B;  2GEL A;  4H5W A;  4ISG A;  1TKU A;  4BRF A;  2H3G X;  5TKW A;  1VAZ A;  3EE9 A;  4E1J A;  4YKE A;  5AZJ B;  3FLC O;  3DXM B;  5LJV A;  3HOT A;  3ENO A;  3P31 A;  5AQK A;  1NLV A;  1VQP N;  1IJJ A;  1Q18 A;  4CZK A;  3RVC A;  5EXW A;  4KH6 A;  4NLC A;  3O9U A;  4BRI A;  3FZM A;  5M1Q A;  2EWS A;  4DQ8 A;  5JLH A;  4JKC A;  2FSN A;  5AZJ A;  3PIP L;  3T1I A;  3DXM A;  4JKG B;  1HUX A;  5EVZ A;  4IO9 L;  3U9Z A;  4BRL A;  1NGE A;  4R79 A;  1Y64 A;  2E2P A;  4YDU C;  3ZIH A;  5KPZ A;  2V7Z A;  1Z6R A;  3A0I X;  4CZE A;  1YI2 N;  1QVF M;  4CZH A;  2VCP A;  4JEP A;  1XEZ A;  4JKG A;  3C6A A;  3MIO A;  3VEW A;  3VER A;  3GG4 A;  3W3D A;  3DWL A;  5FPE A;  4BC5 A;  3E66 A;  2FF3 B;  3LDQ A;  3OBW A;  3IFR A;  4MO5 A;  2LN3 A;  4M7Y A;  3TTF A;  3EZW A;  4ISF A;  5AFU A;  4WFB L;  3CC7 N;  4GNI A;  3ZX3 A;  3E9O A;  4A5A A;  1RDU A;  1BA1 A;  3KK7 A;  3U8X A;  4OPA A;  3LDL A;  1IG8 A;  3N4Q A;  2A40 A;  5BRH A;  3P39 A;  2W40 A;  3VEZ A;  3ENH A;  5AZI B;  3HTV A;  2Q1N A;  3WUH A;  5ADX A;  1TKS A;  4BC4 A;  2VYP A;  3D7E O;  4QS7 A;  3TTD A;  3VEY A;  3IMX A;  4J8F A;  3CMA N;  3L4I A;  3ZYY X;  2Q36 A;  4PL7 A;  1E4G T;  1T6C A;  2GTD A;  1RGI A;  3SBT A;  5C2D A;  2Q2R A;  1BDG A;  1QQO A;  3QFU A;  4A2B A;  4PKG A;  5C12 A;  1QQN A;  2CGK A;  5AQO A;  4YOT A;  3ZX0 A;  3G6E N;  3LS6 A;  1TYQ B;  1GLF O;  3P38 A;  4CD3 A;  3CC4 N;  3P4I A;  2IVN A;  4B1U B;  3TSQ A;  1SAZ A;  2E2O A;  2P9S A;  4JKD A;  5GAE P;  5GAH P;  3IUC A;  5AQQ A;  4BQZ A;  3FZH A;  1C0G A;  1GLB G;  3GBT A;  3L0Q A;  1G58 A;  1BG3 A;  3GL1 A;  3VOV A;  4WFA L;  5AQP A;  3HOS A;  4XH5 A;  3BF1 A;  2GUP A;  1YIJ N;  4EFH A;  1TYQ A;  3C65 A;  1Q86 O;  2MX1 A;  2DPN A;  4M7X A;  4PKI A;  3AY9 A;  1KD1 O;  2QWN A;  2YX6 A;  4H0V B;  4IEI A;  3UE5 A;  1VQ7 N;  4I14 A;  1PVW A;  4QS8 A;  4NO7 A;  2D0O A;  2A6A A;  1Z05 A;  4JK7 A;  1XQS C;  4P8J A;  2NRT A;  4JNE A;  2HOE A;  5LY3 A;  4ILG B;  5HL7 L;  2QWL A;  5C2F A;  4BG9 A;  3CCU N;  4JKH A;  1K4P A;  3O1B A;  4GV6 A;  2Q0U A;  2OTL N;  5AQR A;  1GLA G;  4AF1 A;  4H5T A;  2QA4 N;  4FBK A;  1BA0 A;  3MN5 A;  3QB0 A;  3QFP A;  4FWN A;  4FPA A;  3ENB A;  3NMU A;  1ZBS A;  3QBX A;  5H1S Q;  4P8E A;  1RDW X;  4HTL A;  4CBU A;  4BR0 A;  4PL8 A;  2E88 A;  3LL3 A;  3DLL L;  3VF6 A;  3VEV A;  4JKE A;  3CME N;  4DKW A;  3CCL N;  4JD2 A;  4Y0W A;  1Q7Y O;  2FLO A;  3LDO A;  5EY4 A;  3MCA B;  4IO8 A;  4BR9 A;  3CD6 N;  3BP8 A;  3A5O C;  4BY9 C;  4CJ7 A;  5E84 A;  5AQG A;  3SAG A;  5DM6 L;  2P9I B;  4RTF D;  1HRU A;  5GAD P;  4O8U A;  4BRO A;  3FR0 A;  4YOY A;  3EO3 A;  1KC8 O;  4HVZ A;  1V4T A;  3J7Z O;  3A5L C;  3M1F A;  4CBX A;  1MWK A;  3U9D A;  4GV9 A;  4IOX A;  2ZJR L;  2P9I A;  2KLA A;  2ASO A;  1U2V B;  2A41 A;  2FSJ A;  4GV3 A;  4CZJ A;  1NBW A;  2YHX A;  1LCU A;  2IVP A;  1VQ9 N;  3Q7B A;  3SBG A;  5FPN A;  1JCE A;  2P9P A;  3MGZ A;  3MN7 A;  4G9Z A;  2QWR A;  4KH4 A;  2P9U A;  3WEE B;  3UKU B;  3ULE B;  4PHT X;  3A5M C;  1K49 A;  1U2V A;  2HST A;  2IIR A;  5DM7 L;  5FPM A;  1S22 A;  4BRK A;  2QEX N;  3CJ9 A;  3E1Y A;  1G99 A;  3ID6 A;  1H1V A;  4IEE A;  2ZWH A;  3QBW A;  3TU5 A;  4F9O A;  3WEE A;  4BRQ A;  1VQN N;  3UKU A;  1BU6 O;  3ULE A;  3KVG A;  4JK9 A;  3CQY A;  3PLA A;  4BRA A;  1T6D A;  3D6R A;  3VET A;  3MWP A;  4FOE A;  3WXK A;  4FSV A;  1J6Z A;  3OHR A;  2E20 A;  4CZG A;  3KZB A;  3L7V A;  1NGF A;  3H3O B;  1TUY A;  2YHW A;  1EO1 A;  2YCH A;  1YF5 L;  5M1O A;  4FWQ A;  2PAV A;  1VQ4 N;  2P9K B;  4CZL A;  1ATN A;  2GX9 A;  3UB5 A;  3ZEU B;  3F9M A;  5AFU H;  3WXJ A;  5BRF A;  3AGK A;  5AQS A;  2VGM A;  4H0O A;  2GWJ A;  1NGA A;  4K43 A;  1JCU A;  3I55 N;  5ADX H;  4RCH A;  4O5F A;  2HBM A;  4OO1 J;  2NRW A;  2P9K A;  1SQK A;  2OTJ N;  3ATU A;  3VGM A;  4FOI A;  3ZEU A;  5AQN A;  3I8B A;  2FXU A;  4NB4 A;  3MN6 A;  3J8A A;  4P6P A;  3R8E A;  4JKB A;  2JWK A;  1NGC A;  2KHO A;  4FBQ A;  4FCX A;  1KK9 A;  3CPW M;  4RWT A;  1HLU A;  3ZIG A;  4NZR M;  4EIA A;  5BRD A;  1NGH A;  1O13 A;  2P9S B;  4PKH A;  3WXM B;  2QWQ A;  3CIP A;  3IKM A;  1W2B M;  1X3M A;  3H6E A;  4K25 A;  3U4L A;  2V7Y A;  3R3L A;  1JCG A;  1HKB A;  2BH1 A;  3EN9 A;  3FZK A;  3AAP A;  4MO4 A;  5GIN A;  1HKG A;  4BGB A;  3OW2 M;  3LRJ A;  1EQY A;  3CCQ N;  1NGD A;  3VTH A;  2RHK A;  4MLH A;  5AQF A;  1QZ5 A;  5AQM A;  3EE8 A;  2KKZ A;  3OBY A;  5KPT A;  3MMV A;  1JCF A;  5JMV A;  4FWK A;  5GIP A;  5AQT A;  2WUS A;  1VQK N;  4EHT A;  1NM1 A;  1WUA A;  5M1F A;  1NGI A;  2YHY A;  3ATV A;  3KWG A;  2HF4 A;  2GEM A;  3D2F B;  4JKF A;  4WQ4 C;  4EAH D;  1HJO A;  1MA9 B;  1NMD A;  2PFU A;  3K9J A;  3MK5 A;  2WC9 A;  1ILY A;  3LQU A;  1K7J A;  3ZIE A;  4H03 B;  1YXQ A;  3KWI A;  1ZC6 A;  3M6G A;  1WOQ A;  1YUW A;  3D2F A;  4P77 A;  3DAW A;  2P9N B;  5AQU A;  5BN9 A;  2P9L B;  3TPQ A;  4B1W B;  3VMF B;  4BRC A;  4E1B A;  2ZGY A;  2VWB A;  4H5R A;  3VES A;  5JLF A;  3CJA A;  1V4S A;  3VEO A;  2YJE A;  4L3Q A;  3FZL A;  1MDU B;  2WFB A;  2QW9 A;  4YDU A;  1R59 O;  1Q81 O;  2ZJP L;  4JD2 B;  1NWK A;  2E8A A;  2P9N A;  3G4S N;  2P9L A;  1GLE G;  1S3X A;  4JN4 A;  5M1P A;  5BPM A;  5I9E B;  2ITM A;  4U7B A;  3E9P A;  3MWT A;  2F9T A;  2BUP A;  4H5N A;  5HOO A;  1YVN A;  4P6D A;  3C0B A;  1YIT N;  3BEX A;  1MWM A;  1DEJ A;  2QI2 A;  4BVO A;  4BR7 A;  3O8M A;  2A5X A;  4FBW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...