3TSQA

Crystal structure of e. coli hypf with atp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
647
structure length
647
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 209
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsqA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsqA01
3TSQA 3VENA 3VTIA 3VF4A 3TTFA 3TTCA 3TSUA 3VEOA 3VEWA 3VEZA 3TTDA 3VESA 3VEXA 3VTHA 3VERA 3VF2A 3VETA 3TSPA
chains in the Genus database with same CATH superfamily
3CCRN 4JI0K 4PY5A 1NK4A 1S1XA 3OYBA 3FGUA 4CF8A 3HRGA 2W40A 1ESVA 4F8RA 3O80A 3G25A 3RR8A 2XY8A 4OGCA 5AQTA 2PYJA 1RBTA 2DFEA 4B3TK 3M1FA 4JN4A 1C0GA 3IUCA 2CGLA 4BRNA 4BQZA 1KRPA 4UY8O 4U7BA 4CECA 3RMDA 4FJIA 3PX6A 1U6ZA 4B1ZA 4F3OA 1VQKN 1YT3A 2HNDA 3TANA 1X9SA 3OA9A 5EX5A 4FPAA 3VGLA 1HUXA 4H0VB 3QIOA 3WBMA 4QOZB 4O8KA 2HHSA 4CEEA 2RIUA 4FPBA 4DTMA 1ATNA 1HMVA 2A40A 4YDQA 3J8AA 3P04A 3V9SA 2DFFA 4E1JA 3J7YP 4H0YB 4OKJA 1S22A 4CEOA 4CBXA 3CCSN 3GG4A 4DU4A 3MDQA 2UXDK 4OLBA 3HOTA 3THXA 4DFKA 4HHTA 2D1KA 2GWJA 4M3RA 2UUBK 1WSEA 4LFCK 3CCQN 2VGMA 2HBLA 1PVYA 4JLHA 2O4GA 4E7JA 5KRTA 1KAYA 3DLBA 4H5NA 4FBWA 1BI4B 1GOBA 2OCEA 4KH5A 4DFPA 1TYQB 4OPJA 4WE1A 3WT0A 1VSHA 4CZIA 3L2QA 2CGKA 3A5LC 1TK0A 2O8BB 3VTHA 1CXUA 1ATRA 3A2FA 1SV5A 4M3YA 3OYGA 1LW0A 4FW2A 5EVZA 3OVNA 3MN9A 4CJSA 3ID6A 5JLHA 1H0YA 1CZBA 1RCHA 2FBTA 1NFJA 4A61A 1VQ6N 1C1AA 1N33K 1RTIA 1U49A 3VF6A 1BCMA 1JCEA 1FKPA 3AVNA 1JJ2M 3DWLA 3G6EN 3HTVA 4CZGA 4B3RK 1NJ1A 4FLUA 4CJPA 2I5JA 4EHUA 3NGZA 2IVPA 2IDOA 4H5VA 2YI1A 5KI6A 2XO7A 2A3ZA 5KQDA 5AZIA 1CXQA 2O8EA 1H4QA 3O3HA 3CF5L 2QWOA 1K6YA 4H03B 1N6QA 4LFAK 5AQZA 3MWTA 1TKXA 1XWLA 1ILYA 3VQ7A 3B6PA 1NOYA 3T1IA 1GLAG 3LP2A 3KD1E 1NMNA 4N76A 3KVGA 2HBKA 4A2BA 4ZTJA 3PSIA 1NKEA 3P31A 2QW9A 3TAEA 5JLFA 3ATUA 2BANA 4HVZA 2KKZA 5CZ2A 1BCOA 2KFNA 1ZBHA 3THXB 1JCUA 3S3MA 3MEEA 3CQ8A 1VQ8N 4CEZA 3VQ6A 3RWUA 4JNEA 4NLCA 1BHLA 4K42A 1BA0A 1VRUA 2G8KA 3OYHA 3RMBA 4K0KK 1TV6A 1BWFO 4H5RA 4LH5A 2PAVA 3VMFB 4FJ5A 3HM8A 4GVEA 1H4TA 3K2PA 1N34K 3L8BA 4N5SA 1QSYA 3ZT1A 3J80O 3QB0A 2NNWA 5FPDA 5JVGL 4AHUA 2OZSA 3ATVA 4WQ5A 3QFPA 5SZTA 1HQUA 5JS2A 3V81A 5AR0A 5C24A 2UUAK 3CMAN 3WEEB 1I94K 4DS5A 3BZCA 4F4KA 4IKFA 4FFJA 2WC9A 5DMRA 3M5RA 1U47A 1QE1A 1VQ7N 3AVJA 3ISNC 4B1VA 4CGIA 3HXMA 4H0PA 1KC8O 3AV9A 1TKSA 3MN6A 5J2NA 2OZMA 3HJFA 4BRKA 3CQYA 1QZ6A 1Q7YO 4YFUA 1HKCA 1PVWA 4DR2K 2HBMA 2E1YA 4IFVA 3QESA 3R1XA 1NK9A 3HT3A 4DTUA 4KHQA 1LW2A 3LDQA 5GINA 1HYZA 2PZSA 3ZLJA 4K86A 5AZIB 4FOIA 4R5PA 4X62K 4CF2A 1VSIA 5EU7A 3A8YA 1NBWA 4FOEA 3KK1A 3AVCA 3V6DA 3K58A 1ZBUA 2I7PA 3HM9A 2HB5A 3VQQA 4E7IA 2YKNA 1VSMA 3WXMB 4O0JA 4YOYA 3QIPA 2QWMA 3NBPA 4B08A 5BN8A 4DFMA 5HROA 2D5RA 4DR6K 3NMUA 1IBKK 3W3DA 4E0DA 4Z4IA 2JGUA 3L2WA 3EYZA 5HRSA 2EK0A 2O4IA 3QO9A 2PFUA 3NF9A 4YKEA 3OTOK 4BDYA 3WXLA 1JXEA 2E8AA 4CI6A 2E2QA 3S9HA 3THWB 4BVPA 1S8EA 4ICLA 3MK5A 2G8VA 1VR4A 3CFOA 1NK6A 4YHHK 3E9OA 2QWRA 3O4NA 5M1NA 5BRHA 1A5XA 4EP4A 2KW4A 3F9MA 2GUPA 3RVCA 4DKWA 1VQ9N 1DTTA 1Q18A 4CJ3A 2I7NA 2F9TA 3ULDA 4JHDA 1QHTA 3VEYA 2KZMA 1Z6RA 5EXWA 5AQOA 4PWDA 3D0PA 4AHRA 3LWMA 1WLJA 1K4PA 5DK5A 3H07A 3EZWA 3QINA 3OJUA 2B6AA 1RBSA 5FPNA 3MX2A 2QKKA 3LRJA 3VA0A 1IEZA 4DS4A 1IG9A 2VWKA 5KPTA 2Z1JA 4DQRA 4JKEA 4KH4A 1KLMA 3C7NB 3KIOA 2ZWHA 4FLVA 1XC9A 3LP3A 1NJ8A 3U9DA 5FPMA 3DRSA 1UA0A 3HP6A 2Q97A 1CZAN 2KHOA 3EKUA 3IKMA 3VQCA 1HPZA 3VF4A 3FZFA 3ZETB 4GV6A 1ZBSA 5JICA 2RE2A 3RMCA 4BG8A 3AO1A 5AFUA 3BF1A 4GV9A 2KZZA 4RG8A 2OTJN 3C6TA 3NF8A 3R3LA 2HMIA 3C95A 1WSGA 4CHZA 3ZSZA 3SUNA 1RBVA 3CETA 1VQMN 4YOXA 3F73A 1U2VA 1NGHA 4YOWA 2VWBA 3JSMA 2YNFA 2DFHA 3HPHA 3SUQA 1NGCA 1ZBIA 2X74A 2JWKA 3TOEA 1HYSA 4DG1A 2YCHA 1YAGA 3K5OA 4FM0A 4CZHA 2KQ2A 1E3MA 3HZ6A 3TPQA 4ISFA 1BA1A 4JI5K 4M41A 1A5VA 3K9JA 4M3WA 4FLZA 2OA8A 3O9UA 4P8EA 4WYBA 3VQPA 3T3FA 4JHDB 2PY5A 4CIGA 3VETA 2XY5A 1KCFA 3A5MC 2IGIA 4OGEA 4KO0A 3WXJA 4DQSA 2D0CA 4DTRA 3AA2A 2L8YA 1YJWN 4BR7A 4YDUC 1WSFA 3DM2A 3AVIA 4CEAA 1C0TA 4FWKA 2IIRA 1M1KO 3FFKB 1OH5A 2QK9A 2UXBK 1RDUA 4C1NK 4B1WB 3DXKB 3FZHA 3DLGA 2YNIA 3WUHA 5GAHP 3BP8A 4IDHA 1RBRA 1LAWA 2D0OA 2IAJA 4H4OA 4BGAA 1S1UA 4B9UA 3AA3A 5AQMA 2PYLA 4HUGA 1NGJA 2X6NA 3ZSWA 1HJRA 4KHPK 5HLFA 4F2SA 1VQNN 4XH5A 1IO2A 2P1JA 4U67L 4OPHA 4WQ5C 2GTCA 3DMJA 3EE8A 1NG9A 3VQ8A 4HUEA 3V9XA 3U4LA 5CYMA 4BC2A 4KH6A 1L3UA 1P8ZA 1K7JA 2P9PA 1D8YA 4CHYA 3UB5A 3CJ9A 3LZJA 3TABA 1WSIA 1YJ9N 4FJHA 1S1TA 3DYAA 4Z94A 1BQNA 4OKKA 1HYVA 2F8SA 4DR5K 3AVBA 4CESA 3CYMA 1BO5O 3TTFA 3RMAA 1XUPO 1U2VB 1VRTA 4DR3K 2ZE2A 3I56N 1QS4A 1F21A 4C8KA 3ZEUA 4PL8A 3QBXA 3ZT3A 1VM0A 4Y1DA 4CHQA 2V52B 2RKIA 4F9OA 3QDKA 1TK5A 1S9EA 4CHOA 4QCLA 2QA4N 2E2PA 4FWSA 4ID5A 2IS3A 3D2EA 1SKRA 2JLEA 4K43A 3AY9A 3VQ9A 2HNYA 4BC3A 3CERA 4RW8A 1T3VA 2QWPA 3TSUA 4E89A 4ISEA 2NRVA 5HOOA 3L0QA 3EY1A 3SV3A 2O8DA 4MLEA 3VOVA 3A5NC 4JI2K 2BDPA 4Z4GA 1YTUA 2R7YA 1XHXA 3TSPA 3K5LA 1Q81O 3MN7A 5FPEA 2PBDA 5E84A 3SAGA 1YF5L 1NK7A 3DLKA 4I6MA 4GV3A 3K59A 2Q31A 4EFHA 5GIOA 4HCCA 4CJTA 5BRDA 4I2QA 1XNQK 3OYIA 1KAZA 3P39A 4FWOA 3TAMA 2P9NA 2A42A 3SCXA 3SQ1A 3VQ5A 5J1EA 4FM2A 3EO3A 1JLEA 4B9TA 1VQ4N 3LDPA 1LAVA 1KAXA 2M71A 2YHBA 2XY7A 4DSIA 1MDUB 3AO4A 1YITN 4C23A 1V4SA 4K8XA 1WNSA 2Q0UA 3H3NO 3MMVA 3NFAA 3LDOA 4YOUA 2UU9K 4BACA 1FK9A 1T03A 1TAUA 5F0XA 1RDAA 4H0OA 1NNEA 1VAZA 1SL1A 1U04A 4IBNA 1M90O 2P9PB 4CF9A 3VEVA 3RSEA 1TVRA 4JKAA 4DB3A 3ENOA 2ASPA 5H1SQ 2A5XA 4HVCA 3ZT0A 4CFBA 4FJ8A 2W41A 5LJVA 3RR7A 3C6HA 2HHHK 1DLOA 4R79A 4M3ZA 1VK0A 1E4FT 2OTLN 3QEIA 3TTDA 1G99A 5AZJA 1YIJN 4BR5A 3O9QA 1IG8A 2JWLA 1YJNN 2W6LA 2X6SA 2VG7A 1H0XA 5BN9A 4LF5K 2RHKA 3WXIA 3CCEN 4CZMA 2A1SA 5AJ3K 1VSJA 4LSNA 3D2EB 5CR4A 1EETA 2FC0A 3SQ0A 2IFEA 1LWEA 3HK2A 2E4LA 4FJMA 3PX0A 1S6PA 1X1PA 1ASUA 3CJCA 4FWQA 1OKJA 3MX5A 1JLAA 1L5UA 3ZX3A 3SBTA 3KLFA 4X65K 3AVGA 4FO0A 2P9UA 3S3OA 5C25A 2O8FA 4KBOA 4LSLA 4X66K 4NCBA 5HRNA 4K41A 3SJHA 4B9LA 2HOEA 2Z1HA 4I6MB 2RN2A 2HSTA 1RDDA 1Q82O 4K8ZA 3PO5A 4Q0BA 1IKYA 2J4RA 1GLCG 4BRGA 1Z25A 3MWPA 2GX9A 3D6RA 4DQIA 3HPGA 1NGBA 4HTUA 1K9MO 3EEQA 4N41A 2P9NB 3DSDA 2W6KA 1EX4A 1FKOA 3H6EA 1S3XA 1IV0A 3DOKA 5CYQA 1GLBG 4ILHA 4JKGA 4XH1A 5C15A 3K9KA 4BRIA 3WNFA 4HCBA 1RT3A 2IVNA 5C12A 4BE0A 4CZLA 4PQUA 2F96A 4C8NA 3AO2A 2P9SA 4BRPA 5LY3A 1UDVA 5E26A 3OS1A 4JRQA 1T6CA 5AQKA 4CJQA 1KVCA 2E1ZA 4AILC 4IJAA 3O9TA 4DHYA 2GUIA 3S41A 3RSEB 5DM6L 2DY4A 1QZ5A 4DF8A 2A41A 3N4QA 4DUZK 5BR9A 3P5JA 1U45A 4FZYA 3E01A 1UOCA 1MU2A 1GOAA 2Q3SA 3M8QA 4IEEA 4DLEA 5I3UA 2KFZA 4A2AA 4WFNL 1C1CA 3GBTA 4CJFA 3EN9A 2GTDA 3OS0A 3DJCA 3OBWA 4WFAL 4H0TB 1NU0A 5LMUK 2HHTA 1TUUA 1HRHA 3FE1A 4BRMA 1OVYA 3CHWA 4IG0A 1SKSA 4KHSA 4DV1K 1NKBA 3HBTA 1I3AA 3MN5A 4CZJA 4ELVA 3TAFA 4KTWA 1QSLA 4KB1A 2V7YA 4IDKA 4Q5VA 4DSFA 1Q9YA 1HJOA 1L3TA 2IC3A 2YX6A 3L6QA 3QICA 4BR2A 1BGXT 3CPEA 3OYFA 3TARA 2BUPA 1SUQA 3QEVA 2YHWA 4KI4A 2P9UB 3ZSQA 3UIQA 2O8FB 2DPNA 4IEIA 1SZ2A 4BREA 4IZ9A 4CJLA 1RNHA 4BE1A 4MQ3A 4BR9A 4E1BA 1IKVA 2P9IA 4BWMA 4DQPA 4JEPA 2YKMA 4GY2B 3DLRA 1BISA 3FZKA 4EHTA 1N8RO 1WSHA 3DAWA 3D2FA 1HNIA 2Q0RA 3KWIA 2OYQA 4J2EA 3BZKA 4KFBA 3LPUA 4CF1A 4BRQA 3ZIEA 3DLEA 4CD1A 5AQIA 1NGFA 4IOCL 4YORA 4M42A 1VSDA 3QMLA 1T6DA 2ASOA 2ZJRL 4OLFA 3UKUA 4K87A 3CM6A 3MEDA 4DTJA 5GAEP 4JK9A 1IBMK 4PUOA 4PKGA 4RWTA 1QQMA 1QHAA 4DFJA 1QVGM 5JS1A 1W7AA 4LC9B 3JAMO 1S72N 3UKRA 5HBMA 3O4WA 4BWJA 1K73O 4JI3K 3HO1A 1HNVA 3KHYA 3C0BA 4WI1A 1NKCA 5AQVA 4BE2A 3MGZA 3J81O 1U48A 1JLFA 2NLXA 5AQGA 2EHGA 4BROA 4BVOA 4CGJA 5AQUA 2BTFA 4CIEA 3OJSA 4RW9A 1HX1A 1MWKA 3LANA 3ZSVA 3MXIA 3NHGA 4L3QA 4M3TA 4DTXA 1ZC6A 1Z05A 4LF4K 4RCHA 3VGMA 3T19A 4DMNA 3KLEA 3CC2N 2O8EB 3BDPA 1Y64A 5M1KA 1V4TA 2NRTA 1XHZA 1YTAA 1SNNA 1DEJA 4OX9K 1II7A 1NH9A 4IG3A 4W5QA 4B3OA 4B1UB 3OYDA 3OYKA 2G8FA 3LAKA 2ETJA 4G9ZA 1OH8A 4CIFA 3CJBA 1SKWA 2YV0X 2G8WA 1TL1A 4HWIA 1NGDA 3OS2A 2ITMA 3QEWA 3SUPA 3AO5A 4FJNA 1XQSC 4GNIA 3SJJA 3A0IX 4FM1A 3KLIA 1OH6A 1JCGA 4DV5K 4FCYA 1VQPN 5BPLA 5EY4A 1JL1A 4KHWA 1ASWA 4OJRA 3SMPA 4MFBA 3B8AX 4ELTA 4OVLA 3THVA 4LF8K 2BH1A 4DU1A 3TAPA 3KWGA 1Q8IA 4CJVA 5KTQA 3GE1A 5IWAK 2A1RA 3QEPA 1T05A 3D2FB 1RT4A 3LQUA 1NGGA 4DSEA 3PX4A 4FCXA 3QEXA 1K8KA 3LALA 4H0XB 4DTNA 1QVFM 1PAVA 3AVLA 4CJEA 3AVFA 3FFIA 4HVJA 4CJRA 3CJ1A 1O1WA 3VESA 5C2DA 1J5OA 3O9RA 1X9WA 2F4VK 2Z7CA 4XH4A 4JK8A 4B3SK 2CRQA 2EH1A 4GW6A 4YNQA 3HSCA 3OYAA 5KGXA 3CPWM 5AQQA 3DLLL 3BEXA 3FR0A 2WBNA 4F3TA 4DV3K 2ZGZA 5AQNA 4H5TA 2WONA 4JKHA 3QBWA 2G8IA 1LWFA 2GV9A 2FBXA 4M63C 1S1VA 4X64K 4P6PA 1B92A 3SAHA 4Z4EA 2F8TA 1TK8A 1W0HA 4FJ7A 4CJKA 1YXQA 1S9GA 3M8PA 3MCPA 4B9VA 5C0YA 2GEMA 3JXUA 2LXRA 3KK7A 1J9AA 4OPKA 4QS7A 1Y2IA 3L7VA 4JV5K 4GKJK 3MECA 1JCFA 4E7HA 2QM1A 1MWMA 3IFRA 3ZX0A 1BUPA 1K4LA 3ALYA 1U4BA 1L3SA 4M3XA 3I0SA 4XIUA 1NJXA 3MEGA 4FW1A 1G58A 4NZTM 3L4QA 4L8RB 1B9DA 2IVOA 3AAPA 1ZBLA 2Y1JA 3IDHA 2NZTA 3O1BA 1NGAA 4OPAA 3VPZA 5I42A 3NCIA 3I8DA 1BIUA 1TKTA 1RDBA 2E5LK 3QKBA 3F2KA 1R0AA 3PV8A 1BDGA 4I9QA 1VHXA 1NK5A 4Z0UA 3ZSOA 4CJUA 4FWPA 4JS4A 1K8KB 4Y1CA 3ZT4A 2OPRA 3O3FA 3IALA 2HVHA 3CIPA 4FLXA 2HHWA 3Q7CA 3O3GA 2CH5A 4E7LA 3CCVN 1HNXK 3I8BA 4BC5A 4MDBA 1XMQK 4CZEA 1K4OA 4P6DA 1SQKA 1DCJA 1TL3A 5AQLA 4OLAA 2QXFA 3BGRA 5AQYA 4EZ6A 4FSVA 1H1VA 1W9HA 2QWNA 2MX1A 5AQRA 1JKHA 4NYFA 4CJ7A 1NFHA 3O8MA 1QQCA 3LP0A 3GOIA 3ZIHA 3R8EA 1YHQN 2VG6A 2E6MA 1SL0A 4FLWA 3PIOL 3NF7A 2G8HA 1RDCA 1N36K 4H5WA 3SBGA 4LD0A 4HD0A 4HUFA 2E2NA 5EOYA 3K5NA 3CM5A 3IS9A 4C8LA 5FROA 4N56A 4DTOA 4JI7K 1C1BA 2Q3VA 4ID1A 4CBWA 1NJ2A 1TKDA 4LF9K 4KV8A 3IG1A 4O44A 3SUOA 1HLUA 3P38A 1A5WA 1VSKA 3LS6A 3HZ7A 3ID8A 1REVA 5E41A 5J2MA 4JI1K 1D9FA 1R59O 2WTUA 3NVKA 4JKBA 2FSNA 1IJJA 1JLBA 3LDSA 3H1VX 4NYNA 3HPOA 4BRAA 3G4SN 4CGHA 1BU6O 2P9LA 4CGGA 2G8UA 5CHIA 5LL6Z 3HP9A 4DR1K 3AO3A 4KTZA 2E2OA 1KQSM 2Y1BA 3GL1A 3C6UA 2V51B 3SAFA 4LF6K 3U3GA 3ITHA 4BR0A 2WOMA 3E9LA 1NGIA 5KRSA 1P90A 3T69A 3NE6A 5HL7L 1QTMA 4AM7A 1NM1A 2GELA 2XRIA 3HVTA 5SWMA 2KTQA 3TAQA 4CEDA 3DRRA 1XC3A 3SNNA 1NK8A 5IT9O 3NGIA 3HL8A 1C6VA 1JXBA 3VQBA 1ZYQA 4FYDA 1EP4A 1QSSA 4B9SA 4FLYA 4Z4FA 2Z1GA 3SK3A 4FJ9A 5BR8K 3NH1A 5M1PA 1KD1O 5B8HA 4A59A 3LZIA 5MLCQ 1TIGA 3WNEA 2Z1IA 3NH0A 3IAYA 3CQXA 1YI2N 3QERA 1VQON 3J7AP 4CZFA 3KLGA 4YY3K 4H8KA 1EWRA 3MIOA 3VERA 4WFBL 4C8OA 3ZT2A 1QQNA 3G0ZA 1ZBFA 1RT2A 1YVUA 3B6OA 1KVAA 1BI4A 3ZCMA 1TYQA 3CJ7A 1JLQA 4ISGA 3VGKA 4YOVA 4LFBK 1S5JA 3V9ZA 4BRFA 1LOTB 4CGDA 4KREA 2XY6A 4P8JA 1HC7A 1CLQA 4NCAA 3P4IA 3R9PA 1D4XA 1T7PA 4B9NA 2O8BA 2XHBA 3TWHA 1J54A 4G1QA 1JL2A 3I55N 4FWNA 4W5NA 2YHAA 4KKOA 5AQXA 4P6CA 3ZSRA 4FK4A 4UQGA 2Y1IA 3V1OA 1UAXA 4J2BA 3GDQA 4W5OA 3RTVA 2P9LB 2EQAA 3K5MA 4NZRM 4FLTA 4EZ9A 2NRXA 2ZQBA 3ZEUB 4O0IA 1TUYA 4CE9A 4IO9L 3KKSA 3U6YA 4K25A 1BOTO 1BL3A 4LH4A 3SMSA 1K49A 4BRLA 3ENBA 5C2FA 3PO4A 2Q2RA 3U8XA 4J2DA 4AHVA 3L3UA 3THYA 4FXDA 3ZYYX 4Y0WA 4O8UA 4N47A 4JS5A 1E4GT 2YJFA 1JLCA 4FJKA 1NWKA 1JLGA 4BQLA 3M3ZA 3L3VA 1NGEA 5LMNK 3LPTA 3T7ZA 3CCJN 1LV5A 3DOLA 5AQSA 3WNGA 4WCEL 1DGKN 4B8AB 2O8DB 3A5OC 2YNHA 3H46O 2IOCA 2OANA 2V7ZA 2O8CA 1SS6A 3KK3A 4HTLA 3O4QA 3S3NA 2P5OA 3H45C 2LSNA 4B9QA 4I2PA 3CCUN 3I0RA 4WQ4A 4BRCA 5BREA 3FZMA 4CFCA 3LWLA 1DT9A 1S6QA 1K8AO 3DI6A 4DV6K 4LY7A 2LN3A 4Z4HA 1C0MA 3HOSA 4JD2A 3AGRA 3IRXA 5F1XA 3LVKB 5JVHL 3AARA 3LL3A 5ADXH 4NXNK 3FZLA 4TWAA 3CXCM 3CC7N 2QTDA 4RTFD 1KFDA 4DV7K 4CFDA 3TU5A 3VQ4A 4FJGA 1K4IA 4FVUA 1WN7A 1NJIO 1RILA 5C10A 4TSXA 5AQFA 3SV4A 2FF3B 2AJQA 4JKFA 4FL9A 2VWJA 1RQ8A 1JE3A 3NDKA 3QNOA 1FW6A 3U6FA 3VEZA 1B9FA 2E88A 4CERA 1HQEA 3WQTA 4EIAA 3J7ZO 1KFSA 4FWMA 3KTQA 2HW3A 3I33A 4KI6A 4KRFA 2QEXN 1NJ5A 4M45A 2ZJQL 4CHPA 3WEEA 2VQEK 4AM6A 5AZJB 3BY5A 1RT6A 3TSQA 3Q7BA 3WXKA 1LN4A 5ELZA 4IFYA 4O5BA 4CW7B 1RTDA 3THYB 5BPNA 4KHUA 3QFUA 1MA9B 3LM2A 5CE3A 4IFEA 4PKIA 4DSKA 5HP1A 2BGGA 3O08A 5KQ8A 3LVJC 1C0FA 3H08A 4DSJA 3SQ4A 1LCUA 3C94A 4CGFA 4FJLA 1KSPA 3OYMA 4XEIA 1H4SA 2O8CB 2P9KA 2FSJA 3M8RA 3NAEA 5CY4A 4CCHA 3LM9A 3O1WA 1NJZA 1D9DA 4ILGB 4O5FA 4PHTX 4MO5A 2VG5A 4DR4K 4YOTA 1VSLA 4FZXC 1NLVA 3ULEA 3OYJA 1EQYA 1Y9XA 4J2AA 4FBQA 4JD2B 4YDUA 3SQ2A 2A6AA 5HRRA 4EAHD 4JKGB 4F2RA 4A57A 2UUCK 4GMJB 5AQWA 4Z4CA 5AQPA 1KLNA 3T1AA 1ZXOA 3THWA 4CK2A 2P9SB 4JI8K 2P5GA 2HHXA 4RW7A 4CK1A 1BIZA 1TKZA 5K14A 4K88A 2NRHA 5A2QO 1ITGA 1W97L 3KKRA 3H1QA 3KLHA 5GIPA 3E9PA 4JI6K 2F7TA 4E7KA 3AGKA 3ZSXA 4B3MK 5FRMA 3OYLA 1RT1A 4GVMA 1WB9A 3K0SA 1LWCA 3OY9A 4AHCA 3VEOA 3V4IA 4NXMK 3OYNA 3SPYA 3AVHA 1JDQA 2HF4A 3V1QA 2QKBA 3C65A 4A5AA 4DV0K 1FXXA 3VQAA 3SYZA 3WNHA 3OYEA 5J2QA 3CG7A 1HRUA 1XMOK 4B1XB 5BPMA 5GAGP 4I9LA 4BDPA 2H9UA 4A62A 1RBUA 2W42A 3C7NA 2ZJPL 2RF2A 5KPRA 1C0UA 2QWQA 3R6MA 3IABA 2CH6A 1IKWA 2CGJA 4Q15A 2B5JA 3O5BA 4B1YB 4CJWA 4WF9L 3G71N 1KTQA 3ZETA 4MO4A 4IJNA 2P9KB 4CEQA 4JKCA 1GLLO 3BUZB 3EL2A 4CVNE 4FZZA 1W2BM 1UWBA 4I7FA 1ASVA 1EO1A 4I14A 3CCMN 4NCXA 2YJEA 2P9IB 3TTCA 2EWSA 3E1YA 4OO1J 1T8EA 4RW4A 3BF3A 4PA1A 3KD5E 4O55A 3M8SA 3ULEB 2UYTA 1EXQA 4BGBA 3AVMA 1HNWK 3HSTB 1KVBA 1IBLK 3M6GA 3L2VA 4DV2K 2F9WA 4IOAL 3VF2A 1WOQA 3D7EO 4NB4A 5FRNA 1N32K 4NCGA 2X78A 3AVKA 3PY8A 3TR8A 3UE5A 5BRFA 4CD3A 3V9WA 4DTSA 2Q36A 3SPZA 3LDNA 1TKUA 1WSJA 5LJWA 3UKUB 3EZ5A 4CJ4A 1NJ6A 1GLJO 2Q1NA 5GADP 4JAXA 4RW6A 4ILJA 3HVRA 2NRWA 3U9ZA 3UKRB 4KHYA 3EKSA 5M1FA 3VA3A 2YHYA 4WQ4C 1XI1A 4FVMA 3ZSYA 4E19A 4ZTFA 3MAQA 3G10A 3PLAA 1YVNA 1RTHA 4JKDA 2HBJA 2VCPA 1X3MA 4CJ5A 2QWLA 1EWQA 3RRGA 2KLAA 4O4GA 1NJYA 1L3VA 1VQLN 3HYFA 3MXJA 2FXUA 5AQHA 3KZBA 5TKWA 2ZGYA 2ZD1A 2FBYA 2H3GX 3DXKA 4FK0A 1RFQA 4B8CA 4AHSA 2ATQA 3V1RA 3AVAA 4BY9C 2WFBA 4BRHA 2HNZA 1Z26A 1HPMA 1OH7A 3CJAA 1IKXA 3KJVA 1WBDA 1X9JA 3ZX2A 3MCAB 3IABB 4NO7A 4P77A 1VQ5N 4EO0A 4CEFA 3JYTA 1VSEA 1SAZA 3CI5A 4AQYK 4DCHA 3L2UA 3AJEA 1CZ9A 3VN5A 3CFRA 4JI4K 2OPPA 5KPZA 1FJGK 4QAGA 1X3NA 1DKGD 4W5RA 1G15A 1KK9A 2BKYX 5FDLA 3QLHA 3SLCA 1RT5A 1EKEA 3QETA 2D0BA 1WAFA 4IOXA 1WBBA 4DQ8A 3N4PA 3O9SA 1XNRK 4DR7K 3C6AA 1VSFA 2GBZA 3NVMA 1O13A 3NF6A 1BQMA 5AQJA 3VENA 4KHNA 3ZIIA 3DXMA 1XEZA 1KXPA 3WQUA 3OBYA 4J8FA 4DWIA 3DLHA 2FBVA 5KGWA 1GOCA 2HF3A 1HNZK 3PIPL 3MK6A 2FSKA 3P1GA 3QNNA 4LF7K 4AHTA 3AAQA 3LP1A 3T1YK 4KAZA 3KK2A 3P83D 1OVQA 5JMVA 4CEBA 2E20A 3VQEA 2RPIA 3LAMA 1RGIA 2HHVA 1NOZA 3AA4A 4C8MA 3ENHA 1WUAA 1TAQA 2FLOA 1RTJA 3SZ2A 2RISA 4M7YA 1ATSA 1JO0A 2OPSA 5I9EB 2FF6A 4BG9A 2VYPA 1YUWA 4GKKK 2DTUA 4DU3A 4DUYK 1NJWA 4IWVA 3CFPA 4A5BA 3TAGA 2NUBA 1IH7A 3OHRA 4IO8A 5D3GA 4CBUA 3T1HK 3CC4N 4E3SA 1D5AA 1NK0A 4MLHA 4FBKA 1N5YA 4QS9A 4V19S 2ITGA 3NGYA 2E6LA 3VEXA 3RRHA 5TKYA 1GLDG 1Y97A 2ASMA 4KTQA 3D45A 1Q86O 4Z9EA 4DQQA 1J5EK 3F9KA 5ADXA 4DTPA 3ASMA 2AP1A 4FJJA 1I39A 3LDLA 4CHNA 3K57A 4M3UA 4EP5A 3U3YA 2WUSA 3HI0A 3O6WA 1Q9XA 5J2PA 1HR0K 3IMXA 4CK3A 4E1MA 3ZIGA 3EE9A 4BC4A 3F5TA 4FWRA 3DSCA 2QI2A 1WAJA 2ZF5O 3DXMB 4JK7A 5DM7L 2AA4A 3L2RA 2D0PA 2P9BA 3SI6A 3CD6N 4PL7A 2YNGA 4C1NI 2VQFK 4PKHA 4AH9A 4BR4A 4AF1A 4DF4A 3MXMA 2GWKA 2HVIA 1QQOA 4DSLA 4FJXA 5F2RA 4JYAK 1NMDA 2QXLA 4E1NA 2VGNA 5M1OA 3DRPA 3W0LA 4CFAA 1SL2A 4OKEA 3PUFA 2NRRA 4CF0A 1HKGA 4ELUA 3NH2A 4NLBA 4H4MA 2D0AA 4DLGA 3TI0A 3VQDA 1S1WA 1J6ZA 3VEWA 1RDWX 2B4JA 1DTQA 4DV4K 1RT7A 5AFUH 3CMEN 1GLEG 5CZ1A 2UXCK 3OW2M 4QS8A 4CZKA 2HMPA 1G57A 3H3OB 4KPYA 1T44A 1X9MA 5T7BA 2YHXA 4IXCA 4KB0A 2D4WA 5FLXO 2NRZA 3L4IA 3VTIA 2ZM6K 5HRPA 3OYCA 3PSFA 3CCLN 4B9MA 4M7XA 2BE2A 4JRPA 3AA5X 2P51A 4ZHRA 3V9UA 1UA1A 2HHUA 1GLFO 1J53A 3JS6A 1BG3A 4BDZA 2A2YA 4FK2A 3E66A 4MDAA 1HKBA 2HHQA 5C42A 1TGOA 4BRDA 2EX3A 3FLCO 4FWLA 4W5TA 2OPQA 5M1QA
chains in the Genus database with same CATH topology
3CCRN 3WUHA 2P9KA 2FSJA 5GAHP 3CJ1A 3BP8A 4IDHA 3VESA 2D0OA 5C2DA 4BGAA 3LM9A 3O1WA 3O9RA 3FGUA 5AQMA 3HRGA 4XH4A 4JK8A 2W40A 1ESVA 1NGJA 4ILGB 3HSCA 3O80A 4MO5A 4O5FA 3G25A 4PHTX 3CPWM 4YOTA 5AQTA 5AQQA 3DLLL 3BEXA 3FR0A 2WBNA 1VQNN 1NLVA 2ZGZA 3ULEA 4XH5A 3M1FA 4JN4A 5AQNA 4H5TA 4JKHA 1EQYA 4U67L 1C0GA 3IUCA 4FBQA 2CGLA 4JD2B 4OPHA 4WQ5C 4YDUA 4BRNA 3EE8A 4BQZA 4U7BA 2A6AA 4UY8O 3QBWA 4EAHD 3U4LA 4JKGB 4BC2A 4KH6A 4A57A 1P8ZA 1K7JA 4M63C 2P9PA 5AQWA 1U6ZA 4B1ZA 3UB5A 3CJ9A 1VQKN 5AQPA 1YJ9N 4P6PA 4Z94A 3OA9A 1ZXOA 5EX5A 3SAHA 4FPAA 3VGLA 1HUXA 4H0VB 2P9SB 4O8KA 2RIUA 4FPBA 1BO5O 3TTFA 1ATNA 1XUPO 2NRHA 1U2VB 2A40A 3I56N 1W97L 1YXQA 3H1QA 3J8AA 3P04A 3MCPA 5GIPA 3E9PA 3ZEUA 4E1JA 4PL8A 4H0YB 1S22A 3QBXA 4CBXA 5C0YA 3CCSN 2GEMA 3GG4A 2F7TA 2V52B 3JXUA 4F9OA 3QDKA 3KK7A 3AGKA 3MDQA 4QS7A 3HOTA 2QA4N 2E2PA 4FWSA 3L7VA 2D1KA 2GWJA 3D2EA 4K43A 3VEOA 3AY9A 3CCQN 1JCFA 2VGMA 2HBLA 4BC3A 1PVYA 3CERA 2QM1A 1KAYA 1T3VA 1MWMA 4FBWA 2QWPA 3IFRA 1BUPA 4H5NA 3ZX0A 3TSUA 1K4LA 4ISEA 2HF4A 2NRVA 4KH5A 5HOOA 3C65A 4A5AA 1TYQB 3L0QA 4MLEA 1G58A 4NZTM 3VOVA 3A5NC 3WT0A 4CZIA 3L4QA 2CGKA 3TSPA 1Q81O 3MN7A 5FPEA 1HRUA 3A5LC 2IVOA 4B1XB 2PBDA 3AAPA 5GAGP 5BPMA 5E84A 3SAGA 3VTHA 1YF5L 1ATRA 3IDHA 2NZTA 4A62A 3O1BA 1NGAA 4I6MA 4OPAA 3VPZA 4GV3A 5EVZA 3C7NA 2Q31A 2ZJPL 3MN9A 4EFHA 5KPRA 5GIOA 2QWQA 3R6MA 2CH6A 2CGJA 5BRDA 3ID6A 3F2KA 5JLHA 3O5BA 1BDGA 1KAZA 4B1YB 3P39A 4A61A 4FWOA 1VQ6N 2P9NA 2A42A 4FWPA 4WF9L 1K8KB 3G71N 3VF6A 1JJ2M 1JCEA 3ZETA 4MO4A 3DWLA 4IJNA 3EO3A 3CIPA 3G6EN 2P9KB 4JKCA 3HTVA 1VQ4N 4CZGA 3Q7CA 1GLLO 3BUZB 3EL2A 3LDPA 1W2BM 2CH5A 3CCVN 1KAXA 3I8BA 1EO1A 4I14A 4BC5A 3CCMN 4MDBA 4CZEA 2YJEA 2P9IB 3TTCA 2EWSA 3E1YA 4OO1J 1MDUB 1K4OA 1SQKA 4P6DA 1YITN 3BF3A 4C23A 4EHUA 1V4SA 2IVPA 2Q0UA 4H5VA 5AQLA 2YI1A 3ULEB 3H3NO 2UYTA 3MMVA 2A3ZA 4BGBA 5AQYA 3LDOA 4YOUA 4FSVA 1H1VA 5F0XA 3M6GA 5AZIA 5KQDA 2QWNA 4H0OA 2MX1A 1VAZA 2F9WA 5AQRA 4IOAL 3CF5L 3VF2A 4CJ7A 1WOQA 2QWOA 3D7EO 4NB4A 1M90O 2P9PB 4H03B 3O8MA 3VEVA 3RSEA 5AQZA 4JKAA 3MWTA 3GOIA 4DB3A 3ZIHA 3UE5A 5BRFA 1ILYA 3ENOA 3R8EA 1YHQN 4CD3A 2ASPA 5H1SQ 2Q36A 3T1IA 2A5XA 1GLAG 3PIOL 3LDNA 2W41A 5LJVA 3KVGA 5LJWA 1TKUA 2HBKA 3C6HA 4H5WA 3UKUB 4R79A 3SBGA 4A2BA 1E4FT 2OTLN 3TTDA 2E2NA 1G99A 1GLJO 2Q1NA 5EOYA 4JAXA 5AZJA 5GADP 3P31A 2QW9A 3O9QA 4BR5A 1YIJN 1IG8A 5JLFA 2JWLA 3ATUA 4ILJA 1YJNN 2NRWA 3U9ZA 3UKRB 4HVZA 2KKZA 5BN9A 3EKSA 5M1FA 4CBWA 2YHYA 2RHKA 3WXIA 3CCEN 4WQ4C 4CZMA 1JCUA 1VQ8N 1HLUA 3P38A 3LS6A 3D2EB 4JNEA 4NLCA 5CR4A 3PLAA 1YVNA 3ID8A 4JKDA 4K42A 2HBJA 2VCPA 1BA0A 1X3MA 1R59O 3NVKA 2QWLA 4JKBA 2FSNA 2KLAA 1IJJA 1BWFO 1VQLN 3CJCA 4H5RA 2PAVA 2FXUA 3H1VX 5AQHA 3KZBA 4FWQA 5TKWA 3VMFB 3HM8A 4BRAA 3G4SN 1OKJA 2ZGYA 3MX5A 4GVEA 1BU6O 2P9LA 2H3GX 3ZX3A 3SBTA 5CHIA 4FO0A 3QB0A 2NNWA 2P9UA 3DXKA 5FPDA 1RFQA 4KBOA 4BY9C 2E2OA 2WFBA 5JVGL 1KQSM 3ATVA 4BRHA 3GL1A 3QFPA 4K41A 2V51B 4WQ5A 3SJHA 3SAFA 2HOEA 4I6MB 1HPMA 3CJAA 2HSTA 5AR0A 1Q82O 1X9JA 4BR0A 2J4RA 3E9LA 1NGIA 3ZX2A 3MCAB 1P90A 1GLCG 3T69A 4BRGA 3MWPA 2GX9A 3D6RA 4NO7A 3CMAN 3WEEB 1NGBA 1VQ5N 4P77A 5HL7L 4EO0A 4AM7A 1NM1A 1SAZA 2GELA 3CI5A 4FFJA 1K9MO 2WC9A 2P9NB 4DCHA 3AJEA 3M5RA 3H6EA 1S3XA 1XC3A 1VQ7N 5KPZA 1GLBG 1X3NA 4ILHA 4B1VA 1DKGD 4JKGA 4H0PA 4XH1A 1KC8O 1KK9A 1TKSA 3MN6A 5C15A 3K9KA 4BRIA 3SLCA 2IVNA 3SK3A 4BRKA 3CQYA 1KD1O 5M1PA 1QZ6A 5C12A 4IOXA 5B8HA 4DQ8A 1HKCA 3N4PA 3O9SA 4A59A 4CZLA 5MLCQ 1PVWA 2HBMA 3C6AA 2E1YA 3NVMA 2P9SA 1O13A 4BRPA 5LY3A 3R1XA 5AQJA 5E26A 3VENA 3ZIIA 3DXMA 1XEZA 3LDQA 1KXPA 3WQUA 3CQXA 5GINA 1YI2N 3OBYA 5AZIB 1T6CA 4FOIA 5AQKA 4J8FA 1VQON 2E1ZA 4CZFA 4IJAA 3O9TA 4DHYA 3A8YA 1NBWA 4FOEA 3S41A 3RSEB 2HF3A 5DM6L 1QZ5A 3PIPL 3MK6A 2FSKA 2A41A 3N4QA 2I7PA 5BR9A 3MIOA 3VERA 3AAQA 4IEEA 4WFBL 3WXMB 1QQNA 4A2AA 4WFNL 4YOYA 3GBTA 3EN9A 5JMVA 2GTDA 2QWMA 5BN8A 3DJCA 3OBWA 4WFAL 2E20A 4H0TB 1RGIA 3NMUA 1TUUA 3FE1A 3ENHA 3W3DA 1WUAA 4BRMA 1TYQA 1OVYA 2FLOA 3CHWA 2RISA 3CJ7A 4ISGA 3VGKA 4M7YA 4YOVA 1ATSA 4BRFA 1LOTB 4P8JA 2PFUA 4YKEA 3P4IA 3R9PA 5I9EB 3WXLA 3HBTA 1D4XA 2FF6A 4BG9A 2VYPA 1YUWA 2E8AA 3MN5A 4CI6A 4CZJA 2E2QA 3I55N 4FWNA 5AQXA 4BVPA 4P6CA 2V7YA 4IWVA 3MK5A 1HJOA 4A5BA 3OHRA 4IO8A 3GDQA 2YX6A 3L6QA 4CBUA 3QICA 2P9LB 4BR2A 2EQAA 3CPEA 2BUPA 3E9OA 4NZRM 3CC4N 2QWRA 2YHWA 5M1NA 2NRXA 3ZEUB 2P9UB 4MLHA 5BRHA 4FBKA 1TUYA 2DPNA 4IO9L 4QS9A 4IEIA 3F9MA 4K25A 1SZ2A 1BOTO 2GUPA 3RVCA 4IZ9A 1Q18A 4BREA 4DKWA 3SMSA 1VQ9N 2I7NA 4BRLA 3ENBA 5C2FA 2F9TA 2Q2RA 3U8XA 1K49A 4JHDA 3VEXA 4BR9A 4E1BA 3ZYYX 4Y0WA 5TKYA 3VEYA 1Z6RA 2P9IA 5EXWA 1GLDG 4O8UA 2ASMA 1E4GT 4JEPA 2YJFA 5AQOA 4GY2B 1NWKA 4BQLA 3M3ZA 1Q86O 1NGEA 3FZKA 3T7ZA 4EHTA 3CCJN 1N8RO 5AQSA 5ADXA 3DAWA 1DGKN 2Q0RA 3D2FA 3KWIA 4WCEL 1K4PA 2AP1A 3H07A 3A5OC 3EZWA 3LDLA 3LRJA 5FPNA 3MX2A 3H46O 4BRQA 3ZIEA 4CD1A 2WUSA 2V7ZA 2OANA 5AQIA 1IEZA 3HI0A 3O6WA 1SS6A 4HTLA 5KPTA 1NGFA 3IMXA 4IOCL 4JKEA 4YORA 3H45C 3ZIGA 3EE9A 4BC4A 3F5TA 4FWRA 3C7NB 4KH4A 4B9QA 3CCUN 4WQ4A 4BRCA 5BREA 3QMLA 1T6DA 2ASOA 2QI2A 2ZWHA 3FZMA 2ZJRL 2ZF5O 3DXMB 3UKUA 1DT9A 3U9DA 5GAEP 4JK9A 1K8AO 4PKGA 4JK7A 5FPMA 5DM7L 2AA4A 2Q97A 1CZAN 2LN3A 2D0PA 2KHOA 2P9BA 1QQMA 3EKUA 1QHAA 3IKMA 4RWTA 1QVGM 3VF4A 3HOSA 3FZFA 4JD2A 3AGRA 3ZETB 4LC9B 1S72N 5F1XA 4PL7A 3CD6N 3UKRA 4GV6A 3O4WA 5JVHL 4C1NI 1ZBSA 3AARA 1K73O 3KHYA 3C0BA 3LL3A 4PKHA 5ADXH 3FZLA 4AF1A 5AQVA 4BR4A 2RE2A 5JICA 3MGZA 3CXCM 3CC7N 2NLXA 4BG8A 2QTDA 4RTFD 5AQGA 5AFUA 2GWKA 4BROA 4BVOA 3BF1A 4GV9A 5AQUA 3TU5A 2OTJN 2BTFA 1HX1A 1MWKA 1QQOA 1K4IA 4FVUA 3R3LA 1NJIO 4L3QA 5C10A 1VQMN 1ZC6A 3CETA 1Z05A 5F2RA 1NMDA 2QXLA 4RCHA 3VGMA 5AQFA 4YOXA 1U2VA 2VGNA 1NGHA 5M1OA 4YOWA 3CC2N 2FF3B 2VWBA 3W0LA 4JKFA 4FL9A 1Y64A 5M1KA 2NRRA 1V4TA 2NRTA 1HKGA 1SNNA 1NGCA 1DEJA 4NLBA 2E88A 3VEZA 2JWKA 3WQTA 4EIAA 4B1UB 3J7ZO 4FWMA 3I33A 1J6ZA 3VEWA 2YCHA 1RDWX 1YAGA 4G9ZA 2QEXN 2ZJQL 3CJBA 3WEEA 4AM6A 5AFUH 4CZHA 4HWIA 1NGDA 3CMEN 1GLEG 5AZJB 3HZ6A 3TPQA 4ISFA 3OW2M 2ITMA 1BA1A 4QS8A 4CZKA 2HMPA 1G57A 3H3OB 3TSQA 3K9JA 1T44A 3Q7BA 2YHXA 3O9UA 1XQSC 4GNIA 4IXCA 4WYBA 4P8EA 3WXKA 2D4WA 3A0IX 2NRZA 3L4IA 5ELZA 3VTIA 1JCGA 4JHDB 3CCLN 1VQPN 5BPLA 5EY4A 3VETA 5BPNA 3SMPA 3B8AX 3A5MC 3QFUA 2BH1A 1MA9B 3KWGA 3LM2A 4M7XA 3WXJA 3GE1A 5CE3A 4IFEA 4PKIA 1Q7YO 1GLFO 4BR7A 1YJWN 3O08A 3JS6A 5KQ8A 4YDUC 1C0FA 1BG3A 3D2FB 4FWKA 1LCUA 2IIRA 1M1KO 3FFKB 3LQUA 1NGGA 3E66A 4XEIA 1RDUA 1HKBA 4MDAA 4C1NK 4B1WB 4FCXA 4BRDA 1K8KA 4H0XB 1QVFM 3FLCO 3DXKB 4FWLA 3FZHA 5M1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSQ A;  3VEN A;  3VTI A;  3VF4 A;  3TTF A;  3TTC A;  3TSU A;  3VEO A;  3VEW A;  3VEZ A;  3TTD A;  3VES A;  3VEX A;  3VTH A;  3VER A;  3VF2 A;  3VET A;  3TSP A; 
#chains in the Genus database with same CATH topology
 3CCR N;  4JI0 K;  4PY5 A;  1NK4 A;  1S1X A;  3OYB A;  3FGU A;  4CF8 A;  3HRG A;  2W40 A;  1ESV A;  4F8R A;  3O80 A;  3G25 A;  3RR8 A;  2XY8 A;  4OGC A;  5AQT A;  2PYJ A;  1RBT A;  2DFE A;  4B3T K;  3M1F A;  4JN4 A;  1C0G A;  3IUC A;  2CGL A;  4BRN A;  4BQZ A;  1KRP A;  4UY8 O;  4U7B A;  4CEC A;  3RMD A;  4FJI A;  3PX6 A;  1U6Z A;  4B1Z A;  4F3O A;  1VQK N;  1YT3 A;  2HND A;  3TAN A;  1X9S A;  3OA9 A;  5EX5 A;  4FPA A;  3VGL A;  1HUX A;  4H0V B;  3QIO A;  3WBM A;  4QOZ B;  4O8K A;  2HHS A;  4CEE A;  2RIU A;  4FPB A;  4DTM A;  1ATN A;  1HMV A;  2A40 A;  4YDQ A;  3J8A A;  3P04 A;  3V9S A;  2DFF A;  4E1J A;  3J7Y P;  4H0Y B;  4OKJ A;  1S22 A;  4CEO A;  4CBX A;  3CCS N;  3GG4 A;  4DU4 A;  3MDQ A;  2UXD K;  4OLB A;  3HOT A;  3THX A;  4DFK A;  4HHT A;  2D1K A;  2GWJ A;  4M3R A;  2UUB K;  1WSE A;  4LFC K;  3CCQ N;  2VGM A;  2HBL A;  1PVY A;  4JLH A;  2O4G A;  4E7J A;  5KRT A;  1KAY A;  3DLB A;  4H5N A;  4FBW A;  1BI4 B;  1GOB A;  2OCE A;  4KH5 A;  4DFP A;  1TYQ B;  4OPJ A;  4WE1 A;  3WT0 A;  1VSH A;  4CZI A;  3L2Q A;  2CGK A;  3A5L C;  1TK0 A;  2O8B B;  3VTH A;  1CXU A;  1ATR A;  3A2F A;  1SV5 A;  4M3Y A;  3OYG A;  1LW0 A;  4FW2 A;  5EVZ A;  3OVN A;  3MN9 A;  4CJS A;  3ID6 A;  5JLH A;  1H0Y A;  1CZB A;  1RCH A;  2FBT A;  1NFJ A;  4A61 A;  1VQ6 N;  1C1A A;  1N33 K;  1RTI A;  1U49 A;  3VF6 A;  1BCM A;  1JCE A;  1FKP A;  3AVN A;  1JJ2 M;  3DWL A;  3G6E N;  3HTV A;  4CZG A;  4B3R K;  1NJ1 A;  4FLU A;  4CJP A;  2I5J A;  4EHU A;  3NGZ A;  2IVP A;  2IDO A;  4H5V A;  2YI1 A;  5KI6 A;  2XO7 A;  2A3Z A;  5KQD A;  5AZI A;  1CXQ A;  2O8E A;  1H4Q A;  3O3H A;  3CF5 L;  2QWO A;  1K6Y A;  4H03 B;  1N6Q A;  4LFA K;  5AQZ A;  3MWT A;  1TKX A;  1XWL A;  1ILY A;  3VQ7 A;  3B6P A;  1NOY A;  3T1I A;  1GLA G;  3LP2 A;  3KD1 E;  1NMN A;  4N76 A;  3KVG A;  2HBK A;  4A2B A;  4ZTJ A;  3PSI A;  1NKE A;  3P31 A;  2QW9 A;  3TAE A;  5JLF A;  3ATU A;  2BAN A;  4HVZ A;  2KKZ A;  5CZ2 A;  1BCO A;  2KFN A;  1ZBH A;  3THX B;  1JCU A;  3S3M A;  3MEE A;  3CQ8 A;  1VQ8 N;  4CEZ A;  3VQ6 A;  3RWU A;  4JNE A;  4NLC A;  1BHL A;  4K42 A;  1BA0 A;  1VRU A;  2G8K A;  3OYH A;  3RMB A;  4K0K K;  1TV6 A;  1BWF O;  4H5R A;  4LH5 A;  2PAV A;  3VMF B;  4FJ5 A;  3HM8 A;  4GVE A;  1H4T A;  3K2P A;  1N34 K;  3L8B A;  4N5S A;  1QSY A;  3ZT1 A;  3J80 O;  3QB0 A;  2NNW A;  5FPD A;  5JVG L;  4AHU A;  2OZS A;  3ATV A;  4WQ5 A;  3QFP A;  5SZT A;  1HQU A;  5JS2 A;  3V81 A;  5AR0 A;  5C24 A;  2UUA K;  3CMA N;  3WEE B;  1I94 K;  4DS5 A;  3BZC A;  4F4K A;  4IKF A;  4FFJ A;  2WC9 A;  5DMR A;  3M5R A;  1U47 A;  1QE1 A;  1VQ7 N;  3AVJ A;  3ISN C;  4B1V A;  4CGI A;  3HXM A;  4H0P A;  1KC8 O;  3AV9 A;  1TKS A;  3MN6 A;  5J2N A;  2OZM A;  3HJF A;  4BRK A;  3CQY A;  1QZ6 A;  1Q7Y O;  4YFU A;  1HKC A;  1PVW A;  4DR2 K;  2HBM A;  2E1Y A;  4IFV A;  3QES A;  3R1X A;  1NK9 A;  3HT3 A;  4DTU A;  4KHQ A;  1LW2 A;  3LDQ A;  5GIN A;  1HYZ A;  2PZS A;  3ZLJ A;  4K86 A;  5AZI B;  4FOI A;  4R5P A;  4X62 K;  4CF2 A;  1VSI A;  5EU7 A;  3A8Y A;  1NBW A;  4FOE A;  3KK1 A;  3AVC A;  3V6D A;  3K58 A;  1ZBU A;  2I7P A;  3HM9 A;  2HB5 A;  3VQQ A;  4E7I A;  2YKN A;  1VSM A;  3WXM B;  4O0J A;  4YOY A;  3QIP A;  2QWM A;  3NBP A;  4B08 A;  5BN8 A;  4DFM A;  5HRO A;  2D5R A;  4DR6 K;  3NMU A;  1IBK K;  3W3D A;  4E0D A;  4Z4I A;  2JGU A;  3L2W A;  3EYZ A;  5HRS A;  2EK0 A;  2O4I A;  3QO9 A;  2PFU A;  3NF9 A;  4YKE A;  3OTO K;  4BDY A;  3WXL A;  1JXE A;  2E8A A;  4CI6 A;  2E2Q A;  3S9H A;  3THW B;  4BVP A;  1S8E A;  4ICL A;  3MK5 A;  2G8V A;  1VR4 A;  3CFO A;  1NK6 A;  4YHH K;  3E9O A;  2QWR A;  3O4N A;  5M1N A;  5BRH A;  1A5X A;  4EP4 A;  2KW4 A;  3F9M A;  2GUP A;  3RVC A;  4DKW A;  1VQ9 N;  1DTT A;  1Q18 A;  4CJ3 A;  2I7N A;  2F9T A;  3ULD A;  4JHD A;  1QHT A;  3VEY A;  2KZM A;  1Z6R A;  5EXW A;  5AQO A;  4PWD A;  3D0P A;  4AHR A;  3LWM A;  1WLJ A;  1K4P A;  5DK5 A;  3H07 A;  3EZW A;  3QIN A;  3OJU A;  2B6A A;  1RBS A;  5FPN A;  3MX2 A;  2QKK A;  3LRJ A;  3VA0 A;  1IEZ A;  4DS4 A;  1IG9 A;  2VWK A;  5KPT A;  2Z1J A;  4DQR A;  4JKE A;  4KH4 A;  1KLM A;  3C7N B;  3KIO A;  2ZWH A;  4FLV A;  1XC9 A;  3LP3 A;  1NJ8 A;  3U9D A;  5FPM A;  3DRS A;  1UA0 A;  3HP6 A;  2Q97 A;  1CZA N;  2KHO A;  3EKU A;  3IKM A;  3VQC A;  1HPZ A;  3VF4 A;  3FZF A;  3ZET B;  4GV6 A;  1ZBS A;  5JIC A;  2RE2 A;  3RMC A;  4BG8 A;  3AO1 A;  5AFU A;  3BF1 A;  4GV9 A;  2KZZ A;  4RG8 A;  2OTJ N;  3C6T A;  3NF8 A;  3R3L A;  2HMI A;  3C95 A;  1WSG A;  4CHZ A;  3ZSZ A;  3SUN A;  1RBV A;  3CET A;  1VQM N;  4YOX A;  3F73 A;  1U2V A;  1NGH A;  4YOW A;  2VWB A;  3JSM A;  2YNF A;  2DFH A;  3HPH A;  3SUQ A;  1NGC A;  1ZBI A;  2X74 A;  2JWK A;  3TOE A;  1HYS A;  4DG1 A;  2YCH A;  1YAG A;  3K5O A;  4FM0 A;  4CZH A;  2KQ2 A;  1E3M A;  3HZ6 A;  3TPQ A;  4ISF A;  1BA1 A;  4JI5 K;  4M41 A;  1A5V A;  3K9J A;  4M3W A;  4FLZ A;  2OA8 A;  3O9U A;  4P8E A;  4WYB A;  3VQP A;  3T3F A;  4JHD B;  2PY5 A;  4CIG A;  3VET A;  2XY5 A;  1KCF A;  3A5M C;  2IGI A;  4OGE A;  4KO0 A;  3WXJ A;  4DQS A;  2D0C A;  4DTR A;  3AA2 A;  2L8Y A;  1YJW N;  4BR7 A;  4YDU C;  1WSF A;  3DM2 A;  3AVI A;  4CEA A;  1C0T A;  4FWK A;  2IIR A;  1M1K O;  3FFK B;  1OH5 A;  2QK9 A;  2UXB K;  1RDU A;  4C1N K;  4B1W B;  3DXK B;  3FZH A;  3DLG A;  2YNI A;  3WUH A;  5GAH P;  3BP8 A;  4IDH A;  1RBR A;  1LAW A;  2D0O A;  2IAJ A;  4H4O A;  4BGA A;  1S1U A;  4B9U A;  3AA3 A;  5AQM A;  2PYL A;  4HUG A;  1NGJ A;  2X6N A;  3ZSW A;  1HJR A;  4KHP K;  5HLF A;  4F2S A;  1VQN N;  4XH5 A;  1IO2 A;  2P1J A;  4U67 L;  4OPH A;  4WQ5 C;  2GTC A;  3DMJ A;  3EE8 A;  1NG9 A;  3VQ8 A;  4HUE A;  3V9X A;  3U4L A;  5CYM A;  4BC2 A;  4KH6 A;  1L3U A;  1P8Z A;  1K7J A;  2P9P A;  1D8Y A;  4CHY A;  3UB5 A;  3CJ9 A;  3LZJ A;  3TAB A;  1WSI A;  1YJ9 N;  4FJH A;  1S1T A;  3DYA A;  4Z94 A;  1BQN A;  4OKK A;  1HYV A;  2F8S A;  4DR5 K;  3AVB A;  4CES A;  3CYM A;  1BO5 O;  3TTF A;  3RMA A;  1XUP O;  1U2V B;  1VRT A;  4DR3 K;  2ZE2 A;  3I56 N;  1QS4 A;  1F21 A;  4C8K A;  3ZEU A;  4PL8 A;  3QBX A;  3ZT3 A;  1VM0 A;  4Y1D A;  4CHQ A;  2V52 B;  2RKI A;  4F9O A;  3QDK A;  1TK5 A;  1S9E A;  4CHO A;  4QCL A;  2QA4 N;  2E2P A;  4FWS A;  4ID5 A;  2IS3 A;  3D2E A;  1SKR A;  2JLE A;  4K43 A;  3AY9 A;  3VQ9 A;  2HNY A;  4BC3 A;  3CER A;  4RW8 A;  1T3V A;  2QWP A;  3TSU A;  4E89 A;  4ISE A;  2NRV A;  5HOO A;  3L0Q A;  3EY1 A;  3SV3 A;  2O8D A;  4MLE A;  3VOV A;  3A5N C;  4JI2 K;  2BDP A;  4Z4G A;  1YTU A;  2R7Y A;  1XHX A;  3TSP A;  3K5L A;  1Q81 O;  3MN7 A;  5FPE A;  2PBD A;  5E84 A;  3SAG A;  1YF5 L;  1NK7 A;  3DLK A;  4I6M A;  4GV3 A;  3K59 A;  2Q31 A;  4EFH A;  5GIO A;  4HCC A;  4CJT A;  5BRD A;  4I2Q A;  1XNQ K;  3OYI A;  1KAZ A;  3P39 A;  4FWO A;  3TAM A;  2P9N A;  2A42 A;  3SCX A;  3SQ1 A;  3VQ5 A;  5J1E A;  4FM2 A;  3EO3 A;  1JLE A;  4B9T A;  1VQ4 N;  3LDP A;  1LAV A;  1KAX A;  2M71 A;  2YHB A;  2XY7 A;  4DSI A;  1MDU B;  3AO4 A;  1YIT N;  4C23 A;  1V4S A;  4K8X A;  1WNS A;  2Q0U A;  3H3N O;  3MMV A;  3NFA A;  3LDO A;  4YOU A;  2UU9 K;  4BAC A;  1FK9 A;  1T03 A;  1TAU A;  5F0X A;  1RDA A;  4H0O A;  1NNE A;  1VAZ A;  1SL1 A;  1U04 A;  4IBN A;  1M90 O;  2P9P B;  4CF9 A;  3VEV A;  3RSE A;  1TVR A;  4JKA A;  4DB3 A;  3ENO A;  2ASP A;  5H1S Q;  2A5X A;  4HVC A;  3ZT0 A;  4CFB A;  4FJ8 A;  2W41 A;  5LJV A;  3RR7 A;  3C6H A;  2HHH K;  1DLO A;  4R79 A;  4M3Z A;  1VK0 A;  1E4F T;  2OTL N;  3QEI A;  3TTD A;  1G99 A;  5AZJ A;  1YIJ N;  4BR5 A;  3O9Q A;  1IG8 A;  2JWL A;  1YJN N;  2W6L A;  2X6S A;  2VG7 A;  1H0X A;  5BN9 A;  4LF5 K;  2RHK A;  3WXI A;  3CCE N;  4CZM A;  2A1S A;  5AJ3 K;  1VSJ A;  4LSN A;  3D2E B;  5CR4 A;  1EET A;  2FC0 A;  3SQ0 A;  2IFE A;  1LWE A;  3HK2 A;  2E4L A;  4FJM A;  3PX0 A;  1S6P A;  1X1P A;  1ASU A;  3CJC A;  4FWQ A;  1OKJ A;  3MX5 A;  1JLA A;  1L5U A;  3ZX3 A;  3SBT A;  3KLF A;  4X65 K;  3AVG A;  4FO0 A;  2P9U A;  3S3O A;  5C25 A;  2O8F A;  4KBO A;  4LSL A;  4X66 K;  4NCB A;  5HRN A;  4K41 A;  3SJH A;  4B9L A;  2HOE A;  2Z1H A;  4I6M B;  2RN2 A;  2HST A;  1RDD A;  1Q82 O;  4K8Z A;  3PO5 A;  4Q0B A;  1IKY A;  2J4R A;  1GLC G;  4BRG A;  1Z25 A;  3MWP A;  2GX9 A;  3D6R A;  4DQI A;  3HPG A;  1NGB A;  4HTU A;  1K9M O;  3EEQ A;  4N41 A;  2P9N B;  3DSD A;  2W6K A;  1EX4 A;  1FKO A;  3H6E A;  1S3X A;  1IV0 A;  3DOK A;  5CYQ A;  1GLB G;  4ILH A;  4JKG A;  4XH1 A;  5C15 A;  3K9K A;  4BRI A;  3WNF A;  4HCB A;  1RT3 A;  2IVN A;  5C12 A;  4BE0 A;  4CZL A;  4PQU A;  2F96 A;  4C8N A;  3AO2 A;  2P9S A;  4BRP A;  5LY3 A;  1UDV A;  5E26 A;  3OS1 A;  4JRQ A;  1T6C A;  5AQK A;  4CJQ A;  1KVC A;  2E1Z A;  4AIL C;  4IJA A;  3O9T A;  4DHY A;  2GUI A;  3S41 A;  3RSE B;  5DM6 L;  2DY4 A;  1QZ5 A;  4DF8 A;  2A41 A;  3N4Q A;  4DUZ K;  5BR9 A;  3P5J A;  1U45 A;  4FZY A;  3E01 A;  1UOC A;  1MU2 A;  1GOA A;  2Q3S A;  3M8Q A;  4IEE A;  4DLE A;  5I3U A;  2KFZ A;  4A2A A;  4WFN L;  1C1C A;  3GBT A;  4CJF A;  3EN9 A;  2GTD A;  3OS0 A;  3DJC A;  3OBW A;  4WFA L;  4H0T B;  1NU0 A;  5LMU K;  2HHT A;  1TUU A;  1HRH A;  3FE1 A;  4BRM A;  1OVY A;  3CHW A;  4IG0 A;  1SKS A;  4KHS A;  4DV1 K;  1NKB A;  3HBT A;  1I3A A;  3MN5 A;  4CZJ A;  4ELV A;  3TAF A;  4KTW A;  1QSL A;  4KB1 A;  2V7Y A;  4IDK A;  4Q5V A;  4DSF A;  1Q9Y A;  1HJO A;  1L3T A;  2IC3 A;  2YX6 A;  3L6Q A;  3QIC A;  4BR2 A;  1BGX T;  3CPE A;  3OYF A;  3TAR A;  2BUP A;  1SUQ A;  3QEV A;  2YHW A;  4KI4 A;  2P9U B;  3ZSQ A;  3UIQ A;  2O8F B;  2DPN A;  4IEI A;  1SZ2 A;  4BRE A;  4IZ9 A;  4CJL A;  1RNH A;  4BE1 A;  4MQ3 A;  4BR9 A;  4E1B A;  1IKV A;  2P9I A;  4BWM A;  4DQP A;  4JEP A;  2YKM A;  4GY2 B;  3DLR A;  1BIS A;  3FZK A;  4EHT A;  1N8R O;  1WSH A;  3DAW A;  3D2F A;  1HNI A;  2Q0R A;  3KWI A;  2OYQ A;  4J2E A;  3BZK A;  4KFB A;  3LPU A;  4CF1 A;  4BRQ A;  3ZIE A;  3DLE A;  4CD1 A;  5AQI A;  1NGF A;  4IOC L;  4YOR A;  4M42 A;  1VSD A;  3QML A;  1T6D A;  2ASO A;  2ZJR L;  4OLF A;  3UKU A;  4K87 A;  3CM6 A;  3MED A;  4DTJ A;  5GAE P;  4JK9 A;  1IBM K;  4PUO A;  4PKG A;  4RWT A;  1QQM A;  1QHA A;  4DFJ A;  1QVG M;  5JS1 A;  1W7A A;  4LC9 B;  3JAM O;  1S72 N;  3UKR A;  5HBM A;  3O4W A;  4BWJ A;  1K73 O;  4JI3 K;  3HO1 A;  1HNV A;  3KHY A;  3C0B A;  4WI1 A;  1NKC A;  5AQV A;  4BE2 A;  3MGZ A;  3J81 O;  1U48 A;  1JLF A;  2NLX A;  5AQG A;  2EHG A;  4BRO A;  4BVO A;  4CGJ A;  5AQU A;  2BTF A;  4CIE A;  3OJS A;  4RW9 A;  1HX1 A;  1MWK A;  3LAN A;  3ZSV A;  3MXI A;  3NHG A;  4L3Q A;  4M3T A;  4DTX A;  1ZC6 A;  1Z05 A;  4LF4 K;  4RCH A;  3VGM A;  3T19 A;  4DMN A;  3KLE A;  3CC2 N;  2O8E B;  3BDP A;  1Y64 A;  5M1K A;  1V4T A;  2NRT A;  1XHZ A;  1YTA A;  1SNN A;  1DEJ A;  4OX9 K;  1II7 A;  1NH9 A;  4IG3 A;  4W5Q A;  4B3O A;  4B1U B;  3OYD A;  3OYK A;  2G8F A;  3LAK A;  2ETJ A;  4G9Z A;  1OH8 A;  4CIF A;  3CJB A;  1SKW A;  2YV0 X;  2G8W A;  1TL1 A;  4HWI A;  1NGD A;  3OS2 A;  2ITM A;  3QEW A;  3SUP A;  3AO5 A;  4FJN A;  1XQS C;  4GNI A;  3SJJ A;  3A0I X;  4FM1 A;  3KLI A;  1OH6 A;  1JCG A;  4DV5 K;  4FCY A;  1VQP N;  5BPL A;  5EY4 A;  1JL1 A;  4KHW A;  1ASW A;  4OJR A;  3SMP A;  4MFB A;  3B8A X;  4ELT A;  4OVL A;  3THV A;  4LF8 K;  2BH1 A;  4DU1 A;  3TAP A;  3KWG A;  1Q8I A;  4CJV A;  5KTQ A;  3GE1 A;  5IWA K;  2A1R A;  3QEP A;  1T05 A;  3D2F B;  1RT4 A;  3LQU A;  1NGG A;  4DSE A;  3PX4 A;  4FCX A;  3QEX A;  1K8K A;  3LAL A;  4H0X B;  4DTN A;  1QVF M;  1PAV A;  3AVL A;  4CJE A;  3AVF A;  3FFI A;  4HVJ A;  4CJR A;  3CJ1 A;  1O1W A;  3VES A;  5C2D A;  1J5O A;  3O9R A;  1X9W A;  2F4V K;  2Z7C A;  4XH4 A;  4JK8 A;  4B3S K;  2CRQ A;  2EH1 A;  4GW6 A;  4YNQ A;  3HSC A;  3OYA A;  5KGX A;  3CPW M;  5AQQ A;  3DLL L;  3BEX A;  3FR0 A;  2WBN A;  4F3T A;  4DV3 K;  2ZGZ A;  5AQN A;  4H5T A;  2WON A;  4JKH A;  3QBW A;  2G8I A;  1LWF A;  2GV9 A;  2FBX A;  4M63 C;  1S1V A;  4X64 K;  4P6P A;  1B92 A;  3SAH A;  4Z4E A;  2F8T A;  1TK8 A;  1W0H A;  4FJ7 A;  4CJK A;  1YXQ A;  1S9G A;  3M8P A;  3MCP A;  4B9V A;  5C0Y A;  2GEM A;  3JXU A;  2LXR A;  3KK7 A;  1J9A A;  4OPK A;  4QS7 A;  1Y2I A;  3L7V A;  4JV5 K;  4GKJ K;  3MEC A;  1JCF A;  4E7H A;  2QM1 A;  1MWM A;  3IFR A;  3ZX0 A;  1BUP A;  1K4L A;  3ALY A;  1U4B A;  1L3S A;  4M3X A;  3I0S A;  4XIU A;  1NJX A;  3MEG A;  4FW1 A;  1G58 A;  4NZT M;  3L4Q A;  4L8R B;  1B9D A;  2IVO A;  3AAP A;  1ZBL A;  2Y1J A;  3IDH A;  2NZT A;  3O1B A;  1NGA A;  4OPA A;  3VPZ A;  5I42 A;  3NCI A;  3I8D A;  1BIU A;  1TKT A;  1RDB A;  2E5L K;  3QKB A;  3F2K A;  1R0A A;  3PV8 A;  1BDG A;  4I9Q A;  1VHX A;  1NK5 A;  4Z0U A;  3ZSO A;  4CJU A;  4FWP A;  4JS4 A;  1K8K B;  4Y1C A;  3ZT4 A;  2OPR A;  3O3F A;  3IAL A;  2HVH A;  3CIP A;  4FLX A;  2HHW A;  3Q7C A;  3O3G A;  2CH5 A;  4E7L A;  3CCV N;  1HNX K;  3I8B A;  4BC5 A;  4MDB A;  1XMQ K;  4CZE A;  1K4O A;  4P6D A;  1SQK A;  1DCJ A;  1TL3 A;  5AQL A;  4OLA A;  2QXF A;  3BGR A;  5AQY A;  4EZ6 A;  4FSV A;  1H1V A;  1W9H A;  2QWN A;  2MX1 A;  5AQR A;  1JKH A;  4NYF A;  4CJ7 A;  1NFH A;  3O8M A;  1QQC A;  3LP0 A;  3GOI A;  3ZIH A;  3R8E A;  1YHQ N;  2VG6 A;  2E6M A;  1SL0 A;  4FLW A;  3PIO L;  3NF7 A;  2G8H A;  1RDC A;  1N36 K;  4H5W A;  3SBG A;  4LD0 A;  4HD0 A;  4HUF A;  2E2N A;  5EOY A;  3K5N A;  3CM5 A;  3IS9 A;  4C8L A;  5FRO A;  4N56 A;  4DTO A;  4JI7 K;  1C1B A;  2Q3V A;  4ID1 A;  4CBW A;  1NJ2 A;  1TKD A;  4LF9 K;  4KV8 A;  3IG1 A;  4O44 A;  3SUO A;  1HLU A;  3P38 A;  1A5W A;  1VSK A;  3LS6 A;  3HZ7 A;  3ID8 A;  1REV A;  5E41 A;  5J2M A;  4JI1 K;  1D9F A;  1R59 O;  2WTU A;  3NVK A;  4JKB A;  2FSN A;  1IJJ A;  1JLB A;  3LDS A;  3H1V X;  4NYN A;  3HPO A;  4BRA A;  3G4S N;  4CGH A;  1BU6 O;  2P9L A;  4CGG A;  2G8U A;  5CHI A;  5LL6 Z;  3HP9 A;  4DR1 K;  3AO3 A;  4KTZ A;  2E2O A;  1KQS M;  2Y1B A;  3GL1 A;  3C6U A;  2V51 B;  3SAF A;  4LF6 K;  3U3G A;  3ITH A;  4BR0 A;  2WOM A;  3E9L A;  1NGI A;  5KRS A;  1P90 A;  3T69 A;  3NE6 A;  5HL7 L;  1QTM A;  4AM7 A;  1NM1 A;  2GEL A;  2XRI A;  3HVT A;  5SWM A;  2KTQ A;  3TAQ A;  4CED A;  3DRR A;  1XC3 A;  3SNN A;  1NK8 A;  5IT9 O;  3NGI A;  3HL8 A;  1C6V A;  1JXB A;  3VQB A;  1ZYQ A;  4FYD A;  1EP4 A;  1QSS A;  4B9S A;  4FLY A;  4Z4F A;  2Z1G A;  3SK3 A;  4FJ9 A;  5BR8 K;  3NH1 A;  5M1P A;  1KD1 O;  5B8H A;  4A59 A;  3LZI A;  5MLC Q;  1TIG A;  3WNE A;  2Z1I A;  3NH0 A;  3IAY A;  3CQX A;  1YI2 N;  3QER A;  1VQO N;  3J7A P;  4CZF A;  3KLG A;  4YY3 K;  4H8K A;  1EWR A;  3MIO A;  3VER A;  4WFB L;  4C8O A;  3ZT2 A;  1QQN A;  3G0Z A;  1ZBF A;  1RT2 A;  1YVU A;  3B6O A;  1KVA A;  1BI4 A;  3ZCM A;  1TYQ A;  3CJ7 A;  1JLQ A;  4ISG A;  3VGK A;  4YOV A;  4LFB K;  1S5J A;  3V9Z A;  4BRF A;  1LOT B;  4CGD A;  4KRE A;  2XY6 A;  4P8J A;  1HC7 A;  1CLQ A;  4NCA A;  3P4I A;  3R9P A;  1D4X A;  1T7P A;  4B9N A;  2O8B A;  2XHB A;  3TWH A;  1J54 A;  4G1Q A;  1JL2 A;  3I55 N;  4FWN A;  4W5N A;  2YHA A;  4KKO A;  5AQX A;  4P6C A;  3ZSR A;  4FK4 A;  4UQG A;  2Y1I A;  3V1O A;  1UAX A;  4J2B A;  3GDQ A;  4W5O A;  3RTV A;  2P9L B;  2EQA A;  3K5M A;  4NZR M;  4FLT A;  4EZ9 A;  2NRX A;  2ZQB A;  3ZEU B;  4O0I A;  1TUY A;  4CE9 A;  4IO9 L;  3KKS A;  3U6Y A;  4K25 A;  1BOT O;  1BL3 A;  4LH4 A;  3SMS A;  1K49 A;  4BRL A;  3ENB A;  5C2F A;  3PO4 A;  2Q2R A;  3U8X A;  4J2D A;  4AHV A;  3L3U A;  3THY A;  4FXD A;  3ZYY X;  4Y0W A;  4O8U A;  4N47 A;  4JS5 A;  1E4G T;  2YJF A;  1JLC A;  4FJK A;  1NWK A;  1JLG A;  4BQL A;  3M3Z A;  3L3V A;  1NGE A;  5LMN K;  3LPT A;  3T7Z A;  3CCJ N;  1LV5 A;  3DOL A;  5AQS A;  3WNG A;  4WCE L;  1DGK N;  4B8A B;  2O8D B;  3A5O C;  2YNH A;  3H46 O;  2IOC A;  2OAN A;  2V7Z A;  2O8C A;  1SS6 A;  3KK3 A;  4HTL A;  3O4Q A;  3S3N A;  2P5O A;  3H45 C;  2LSN A;  4B9Q A;  4I2P A;  3CCU N;  3I0R A;  4WQ4 A;  4BRC A;  5BRE A;  3FZM A;  4CFC A;  3LWL A;  1DT9 A;  1S6Q A;  1K8A O;  3DI6 A;  4DV6 K;  4LY7 A;  2LN3 A;  4Z4H A;  1C0M A;  3HOS A;  4JD2 A;  3AGR A;  3IRX A;  5F1X A;  3LVK B;  5JVH L;  3AAR A;  3LL3 A;  5ADX H;  4NXN K;  3FZL A;  4TWA A;  3CXC M;  3CC7 N;  2QTD A;  4RTF D;  1KFD A;  4DV7 K;  4CFD A;  3TU5 A;  3VQ4 A;  4FJG A;  1K4I A;  4FVU A;  1WN7 A;  1NJI O;  1RIL A;  5C10 A;  4TSX A;  5AQF A;  3SV4 A;  2FF3 B;  2AJQ A;  4JKF A;  4FL9 A;  2VWJ A;  1RQ8 A;  1JE3 A;  3NDK A;  3QNO A;  1FW6 A;  3U6F A;  3VEZ A;  1B9F A;  2E88 A;  4CER A;  1HQE A;  3WQT A;  4EIA A;  3J7Z O;  1KFS A;  4FWM A;  3KTQ A;  2HW3 A;  3I33 A;  4KI6 A;  4KRF A;  2QEX N;  1NJ5 A;  4M45 A;  2ZJQ L;  4CHP A;  3WEE A;  2VQE K;  4AM6 A;  5AZJ B;  3BY5 A;  1RT6 A;  3TSQ A;  3Q7B A;  3WXK A;  1LN4 A;  5ELZ A;  4IFY A;  4O5B A;  4CW7 B;  1RTD A;  3THY B;  5BPN A;  4KHU A;  3QFU A;  1MA9 B;  3LM2 A;  5CE3 A;  4IFE A;  4PKI A;  4DSK A;  5HP1 A;  2BGG A;  3O08 A;  5KQ8 A;  3LVJ C;  1C0F A;  3H08 A;  4DSJ A;  3SQ4 A;  1LCU A;  3C94 A;  4CGF A;  4FJL A;  1KSP A;  3OYM A;  4XEI A;  1H4S A;  2O8C B;  2P9K A;  2FSJ A;  3M8R A;  3NAE A;  5CY4 A;  4CCH A;  3LM9 A;  3O1W A;  1NJZ A;  1D9D A;  4ILG B;  4O5F A;  4PHT X;  4MO5 A;  2VG5 A;  4DR4 K;  4YOT A;  1VSL A;  4FZX C;  1NLV A;  3ULE A;  3OYJ A;  1EQY A;  1Y9X A;  4J2A A;  4FBQ A;  4JD2 B;  4YDU A;  3SQ2 A;  2A6A A;  5HRR A;  4EAH D;  4JKG B;  4F2R A;  4A57 A;  2UUC K;  4GMJ B;  5AQW A;  4Z4C A;  5AQP A;  1KLN A;  3T1A A;  1ZXO A;  3THW A;  4CK2 A;  2P9S B;  4JI8 K;  2P5G A;  2HHX A;  4RW7 A;  4CK1 A;  1BIZ A;  1TKZ A;  5K14 A;  4K88 A;  2NRH A;  5A2Q O;  1ITG A;  1W97 L;  3KKR A;  3H1Q A;  3KLH A;  5GIP A;  3E9P A;  4JI6 K;  2F7T A;  4E7K A;  3AGK A;  3ZSX A;  4B3M K;  5FRM A;  3OYL A;  1RT1 A;  4GVM A;  1WB9 A;  3K0S A;  1LWC A;  3OY9 A;  4AHC A;  3VEO A;  3V4I A;  4NXM K;  3OYN A;  3SPY A;  3AVH A;  1JDQ A;  2HF4 A;  3V1Q A;  2QKB A;  3C65 A;  4A5A A;  4DV0 K;  1FXX A;  3VQA A;  3SYZ A;  3WNH A;  3OYE A;  5J2Q A;  3CG7 A;  1HRU A;  1XMO K;  4B1X B;  5BPM A;  5GAG P;  4I9L A;  4BDP A;  2H9U A;  4A62 A;  1RBU A;  2W42 A;  3C7N A;  2ZJP L;  2RF2 A;  5KPR A;  1C0U A;  2QWQ A;  3R6M A;  3IAB A;  2CH6 A;  1IKW A;  2CGJ A;  4Q15 A;  2B5J A;  3O5B A;  4B1Y B;  4CJW A;  4WF9 L;  3G71 N;  1KTQ A;  3ZET A;  4MO4 A;  4IJN A;  2P9K B;  4CEQ A;  4JKC A;  1GLL O;  3BUZ B;  3EL2 A;  4CVN E;  4FZZ A;  1W2B M;  1UWB A;  4I7F A;  1ASV A;  1EO1 A;  4I14 A;  3CCM N;  4NCX A;  2YJE A;  2P9I B;  3TTC A;  2EWS A;  3E1Y A;  4OO1 J;  1T8E A;  4RW4 A;  3BF3 A;  4PA1 A;  3KD5 E;  4O55 A;  3M8S A;  3ULE B;  2UYT A;  1EXQ A;  4BGB A;  3AVM A;  1HNW K;  3HST B;  1KVB A;  1IBL K;  3M6G A;  3L2V A;  4DV2 K;  2F9W A;  4IOA L;  3VF2 A;  1WOQ A;  3D7E O;  4NB4 A;  5FRN A;  1N32 K;  4NCG A;  2X78 A;  3AVK A;  3PY8 A;  3TR8 A;  3UE5 A;  5BRF A;  4CD3 A;  3V9W A;  4DTS A;  2Q36 A;  3SPZ A;  3LDN A;  1TKU A;  1WSJ A;  5LJW A;  3UKU B;  3EZ5 A;  4CJ4 A;  1NJ6 A;  1GLJ O;  2Q1N A;  5GAD P;  4JAX A;  4RW6 A;  4ILJ A;  3HVR A;  2NRW A;  3U9Z A;  3UKR B;  4KHY A;  3EKS A;  5M1F A;  3VA3 A;  2YHY A;  4WQ4 C;  1XI1 A;  4FVM A;  3ZSY A;  4E19 A;  4ZTF A;  3MAQ A;  3G10 A;  3PLA A;  1YVN A;  1RTH A;  4JKD A;  2HBJ A;  2VCP A;  1X3M A;  4CJ5 A;  2QWL A;  1EWQ A;  3RRG A;  2KLA A;  4O4G A;  1NJY A;  1L3V A;  1VQL N;  3HYF A;  3MXJ A;  2FXU A;  5AQH A;  3KZB A;  5TKW A;  2ZGY A;  2ZD1 A;  2FBY A;  2H3G X;  3DXK A;  4FK0 A;  1RFQ A;  4B8C A;  4AHS A;  2ATQ A;  3V1R A;  3AVA A;  4BY9 C;  2WFB A;  4BRH A;  2HNZ A;  1Z26 A;  1HPM A;  1OH7 A;  3CJA A;  1IKX A;  3KJV A;  1WBD A;  1X9J A;  3ZX2 A;  3MCA B;  3IAB B;  4NO7 A;  4P77 A;  1VQ5 N;  4EO0 A;  4CEF A;  3JYT A;  1VSE A;  1SAZ A;  3CI5 A;  4AQY K;  4DCH A;  3L2U A;  3AJE A;  1CZ9 A;  3VN5 A;  3CFR A;  4JI4 K;  2OPP A;  5KPZ A;  1FJG K;  4QAG A;  1X3N A;  1DKG D;  4W5R A;  1G15 A;  1KK9 A;  2BKY X;  5FDL A;  3QLH A;  3SLC A;  1RT5 A;  1EKE A;  3QET A;  2D0B A;  1WAF A;  4IOX A;  1WBB A;  4DQ8 A;  3N4P A;  3O9S A;  1XNR K;  4DR7 K;  3C6A A;  1VSF A;  2GBZ A;  3NVM A;  1O13 A;  3NF6 A;  1BQM A;  5AQJ A;  3VEN A;  4KHN A;  3ZII A;  3DXM A;  1XEZ A;  1KXP A;  3WQU A;  3OBY A;  4J8F A;  4DWI A;  3DLH A;  2FBV A;  5KGW A;  1GOC A;  2HF3 A;  1HNZ K;  3PIP L;  3MK6 A;  2FSK A;  3P1G A;  3QNN A;  4LF7 K;  4AHT A;  3AAQ A;  3LP1 A;  3T1Y K;  4KAZ A;  3KK2 A;  3P83 D;  1OVQ A;  5JMV A;  4CEB A;  2E20 A;  3VQE A;  2RPI A;  3LAM A;  1RGI A;  2HHV A;  1NOZ A;  3AA4 A;  4C8M A;  3ENH A;  1WUA A;  1TAQ A;  2FLO A;  1RTJ A;  3SZ2 A;  2RIS A;  4M7Y A;  1ATS A;  1JO0 A;  2OPS A;  5I9E B;  2FF6 A;  4BG9 A;  2VYP A;  1YUW A;  4GKK K;  2DTU A;  4DU3 A;  4DUY K;  1NJW A;  4IWV A;  3CFP A;  4A5B A;  3TAG A;  2NUB A;  1IH7 A;  3OHR A;  4IO8 A;  5D3G A;  4CBU A;  3T1H K;  3CC4 N;  4E3S A;  1D5A A;  1NK0 A;  4MLH A;  4FBK A;  1N5Y A;  4QS9 A;  4V19 S;  2ITG A;  3NGY A;  2E6L A;  3VEX A;  3RRH A;  5TKY A;  1GLD G;  1Y97 A;  2ASM A;  4KTQ A;  3D45 A;  1Q86 O;  4Z9E A;  4DQQ A;  1J5E K;  3F9K A;  5ADX A;  4DTP A;  3ASM A;  2AP1 A;  4FJJ A;  1I39 A;  3LDL A;  4CHN A;  3K57 A;  4M3U A;  4EP5 A;  3U3Y A;  2WUS A;  3HI0 A;  3O6W A;  1Q9X A;  5J2P A;  1HR0 K;  3IMX A;  4CK3 A;  4E1M A;  3ZIG A;  3EE9 A;  4BC4 A;  3F5T A;  4FWR A;  3DSC A;  2QI2 A;  1WAJ A;  2ZF5 O;  3DXM B;  4JK7 A;  5DM7 L;  2AA4 A;  3L2R A;  2D0P A;  2P9B A;  3SI6 A;  3CD6 N;  4PL7 A;  2YNG A;  4C1N I;  2VQF K;  4PKH A;  4AH9 A;  4BR4 A;  4AF1 A;  4DF4 A;  3MXM A;  2GWK A;  2HVI A;  1QQO A;  4DSL A;  4FJX A;  5F2R A;  4JYA K;  1NMD A;  2QXL A;  4E1N A;  2VGN A;  5M1O A;  3DRP A;  3W0L A;  4CFA A;  1SL2 A;  4OKE A;  3PUF A;  2NRR A;  4CF0 A;  1HKG A;  4ELU A;  3NH2 A;  4NLB A;  4H4M A;  2D0A A;  4DLG A;  3TI0 A;  3VQD A;  1S1W A;  1J6Z A;  3VEW A;  1RDW X;  2B4J A;  1DTQ A;  4DV4 K;  1RT7 A;  5AFU H;  3CME N;  1GLE G;  5CZ1 A;  2UXC K;  3OW2 M;  4QS8 A;  4CZK A;  2HMP A;  1G57 A;  3H3O B;  4KPY A;  1T44 A;  1X9M A;  5T7B A;  2YHX A;  4IXC A;  4KB0 A;  2D4W A;  5FLX O;  2NRZ A;  3L4I A;  3VTI A;  2ZM6 K;  5HRP A;  3OYC A;  3PSF A;  3CCL N;  4B9M A;  4M7X A;  2BE2 A;  4JRP A;  3AA5 X;  2P51 A;  4ZHR A;  3V9U A;  1UA1 A;  2HHU A;  1GLF O;  1J53 A;  3JS6 A;  1BG3 A;  4BDZ A;  2A2Y A;  4FK2 A;  3E66 A;  4MDA A;  1HKB A;  2HHQ A;  5C42 A;  1TGO A;  4BRD A;  2EX3 A;  3FLC O;  4FWL A;  4W5T A;  2OPQ A;  5M1Q A; 
#chains in the Genus database with same CATH homology
 3CCR N;  3WUH A;  2P9K A;  2FSJ A;  5GAH P;  3CJ1 A;  3BP8 A;  4IDH A;  3VES A;  2D0O A;  5C2D A;  4BGA A;  3LM9 A;  3O1W A;  3O9R A;  3FGU A;  5AQM A;  3HRG A;  4XH4 A;  4JK8 A;  2W40 A;  1ESV A;  1NGJ A;  4ILG B;  3HSC A;  3O80 A;  4MO5 A;  4O5F A;  3G25 A;  4PHT X;  3CPW M;  4YOT A;  5AQT A;  5AQQ A;  3DLL L;  3BEX A;  3FR0 A;  2WBN A;  1VQN N;  1NLV A;  2ZGZ A;  3ULE A;  4XH5 A;  3M1F A;  4JN4 A;  5AQN A;  4H5T A;  4JKH A;  1EQY A;  4U67 L;  1C0G A;  3IUC A;  4FBQ A;  2CGL A;  4JD2 B;  4OPH A;  4WQ5 C;  4YDU A;  4BRN A;  3EE8 A;  4BQZ A;  4U7B A;  2A6A A;  4UY8 O;  3QBW A;  4EAH D;  3U4L A;  4JKG B;  4BC2 A;  4KH6 A;  4A57 A;  1P8Z A;  1K7J A;  4M63 C;  2P9P A;  5AQW A;  1U6Z A;  4B1Z A;  3UB5 A;  3CJ9 A;  1VQK N;  5AQP A;  1YJ9 N;  4P6P A;  4Z94 A;  3OA9 A;  1ZXO A;  5EX5 A;  3SAH A;  4FPA A;  3VGL A;  1HUX A;  4H0V B;  2P9S B;  4O8K A;  2RIU A;  4FPB A;  1BO5 O;  3TTF A;  1ATN A;  1XUP O;  2NRH A;  1U2V B;  2A40 A;  3I56 N;  1W97 L;  1YXQ A;  3H1Q A;  3J8A A;  3P04 A;  3MCP A;  5GIP A;  3E9P A;  3ZEU A;  4E1J A;  4PL8 A;  4H0Y B;  1S22 A;  3QBX A;  4CBX A;  5C0Y A;  3CCS N;  2GEM A;  3GG4 A;  2F7T A;  2V52 B;  3JXU A;  4F9O A;  3QDK A;  3KK7 A;  3AGK A;  3MDQ A;  4QS7 A;  3HOT A;  2QA4 N;  2E2P A;  4FWS A;  3L7V A;  2D1K A;  2GWJ A;  3D2E A;  4K43 A;  3VEO A;  3AY9 A;  3CCQ N;  1JCF A;  2VGM A;  2HBL A;  4BC3 A;  1PVY A;  3CER A;  2QM1 A;  1KAY A;  1T3V A;  1MWM A;  4FBW A;  2QWP A;  3IFR A;  1BUP A;  4H5N A;  3ZX0 A;  3TSU A;  1K4L A;  4ISE A;  2HF4 A;  2NRV A;  4KH5 A;  5HOO A;  3C65 A;  4A5A A;  1TYQ B;  3L0Q A;  4MLE A;  1G58 A;  4NZT M;  3VOV A;  3A5N C;  3WT0 A;  4CZI A;  3L4Q A;  2CGK A;  3TSP A;  1Q81 O;  3MN7 A;  5FPE A;  1HRU A;  3A5L C;  2IVO A;  4B1X B;  2PBD A;  3AAP A;  5GAG P;  5BPM A;  5E84 A;  3SAG A;  3VTH A;  1YF5 L;  1ATR A;  3IDH A;  2NZT A;  4A62 A;  3O1B A;  1NGA A;  4I6M A;  4OPA A;  3VPZ A;  4GV3 A;  5EVZ A;  3C7N A;  2Q31 A;  2ZJP L;  3MN9 A;  4EFH A;  5KPR A;  5GIO A;  2QWQ A;  3R6M A;  2CH6 A;  2CGJ A;  5BRD A;  3ID6 A;  3F2K A;  5JLH A;  3O5B A;  1BDG A;  1KAZ A;  4B1Y B;  3P39 A;  4A61 A;  4FWO A;  1VQ6 N;  2P9N A;  2A42 A;  4FWP A;  4WF9 L;  1K8K B;  3G71 N;  3VF6 A;  1JJ2 M;  1JCE A;  3ZET A;  4MO4 A;  3DWL A;  4IJN A;  3EO3 A;  3CIP A;  3G6E N;  2P9K B;  4JKC A;  3HTV A;  1VQ4 N;  4CZG A;  3Q7C A;  1GLL O;  3BUZ B;  3EL2 A;  3LDP A;  1W2B M;  2CH5 A;  3CCV N;  1KAX A;  3I8B A;  1EO1 A;  4I14 A;  4BC5 A;  3CCM N;  4MDB A;  4CZE A;  2YJE A;  2P9I B;  3TTC A;  2EWS A;  3E1Y A;  4OO1 J;  1MDU B;  1K4O A;  1SQK A;  4P6D A;  1YIT N;  3BF3 A;  4C23 A;  4EHU A;  1V4S A;  2IVP A;  2Q0U A;  4H5V A;  5AQL A;  2YI1 A;  3ULE B;  3H3N O;  2UYT A;  3MMV A;  2A3Z A;  4BGB A;  5AQY A;  3LDO A;  4YOU A;  4FSV A;  1H1V A;  5F0X A;  3M6G A;  5AZI A;  5KQD A;  2QWN A;  4H0O A;  2MX1 A;  1VAZ A;  2F9W A;  5AQR A;  4IOA L;  3CF5 L;  3VF2 A;  4CJ7 A;  1WOQ A;  2QWO A;  3D7E O;  4NB4 A;  1M90 O;  2P9P B;  4H03 B;  3O8M A;  3VEV A;  3RSE A;  5AQZ A;  4JKA A;  3MWT A;  3GOI A;  4DB3 A;  3ZIH A;  3UE5 A;  5BRF A;  1ILY A;  3ENO A;  3R8E A;  1YHQ N;  4CD3 A;  2ASP A;  5H1S Q;  2Q36 A;  3T1I A;  2A5X A;  1GLA G;  3PIO L;  3LDN A;  2W41 A;  5LJV A;  3KVG A;  5LJW A;  1TKU A;  2HBK A;  3C6H A;  4H5W A;  3UKU B;  4R79 A;  3SBG A;  4A2B A;  1E4F T;  2OTL N;  3TTD A;  2E2N A;  1G99 A;  1GLJ O;  2Q1N A;  5EOY A;  4JAX A;  5AZJ A;  5GAD P;  3P31 A;  2QW9 A;  3O9Q A;  4BR5 A;  1YIJ N;  1IG8 A;  5JLF A;  2JWL A;  3ATU A;  4ILJ A;  1YJN N;  2NRW A;  3U9Z A;  3UKR B;  4HVZ A;  2KKZ A;  5BN9 A;  3EKS A;  5M1F A;  4CBW A;  2YHY A;  2RHK A;  3WXI A;  3CCE N;  4WQ4 C;  4CZM A;  1JCU A;  1VQ8 N;  1HLU A;  3P38 A;  3LS6 A;  3D2E B;  4JNE A;  4NLC A;  5CR4 A;  3PLA A;  1YVN A;  3ID8 A;  4JKD A;  4K42 A;  2HBJ A;  2VCP A;  1BA0 A;  1X3M A;  1R59 O;  3NVK A;  2QWL A;  4JKB A;  2FSN A;  2KLA A;  1IJJ A;  1BWF O;  1VQL N;  3CJC A;  4H5R A;  2PAV A;  2FXU A;  3H1V X;  5AQH A;  3KZB A;  4FWQ A;  5TKW A;  3VMF B;  3HM8 A;  4BRA A;  3G4S N;  1OKJ A;  2ZGY A;  3MX5 A;  4GVE A;  1BU6 O;  2P9L A;  2H3G X;  3ZX3 A;  3SBT A;  5CHI A;  4FO0 A;  3QB0 A;  2NNW A;  2P9U A;  3DXK A;  5FPD A;  1RFQ A;  4KBO A;  4BY9 C;  2E2O A;  2WFB A;  5JVG L;  1KQS M;  3ATV A;  4BRH A;  3GL1 A;  3QFP A;  4K41 A;  2V51 B;  4WQ5 A;  3SJH A;  3SAF A;  2HOE A;  4I6M B;  1HPM A;  3CJA A;  2HST A;  5AR0 A;  1Q82 O;  1X9J A;  4BR0 A;  2J4R A;  3E9L A;  1NGI A;  3ZX2 A;  3MCA B;  1P90 A;  1GLC G;  3T69 A;  4BRG A;  3MWP A;  2GX9 A;  3D6R A;  4NO7 A;  3CMA N;  3WEE B;  1NGB A;  1VQ5 N;  4P77 A;  5HL7 L;  4EO0 A;  4AM7 A;  1NM1 A;  1SAZ A;  2GEL A;  3CI5 A;  4FFJ A;  1K9M O;  2WC9 A;  2P9N B;  4DCH A;  3AJE A;  3M5R A;  3H6E A;  1S3X A;  1XC3 A;  1VQ7 N;  5KPZ A;  1GLB G;  1X3N A;  4ILH A;  4B1V A;  1DKG D;  4JKG A;  4H0P A;  4XH1 A;  1KC8 O;  1KK9 A;  1TKS A;  3MN6 A;  5C15 A;  3K9K A;  4BRI A;  3SLC A;  2IVN A;  3SK3 A;  4BRK A;  3CQY A;  1KD1 O;  5M1P A;  1QZ6 A;  5C12 A;  4IOX A;  5B8H A;  4DQ8 A;  1HKC A;  3N4P A;  3O9S A;  4A59 A;  4CZL A;  5MLC Q;  1PVW A;  2HBM A;  3C6A A;  2E1Y A;  3NVM A;  2P9S A;  1O13 A;  4BRP A;  5LY3 A;  3R1X A;  5AQJ A;  5E26 A;  3VEN A;  3ZII A;  3DXM A;  1XEZ A;  3LDQ A;  1KXP A;  3WQU A;  3CQX A;  5GIN A;  1YI2 N;  3OBY A;  5AZI B;  1T6C A;  4FOI A;  5AQK A;  4J8F A;  1VQO N;  2E1Z A;  4CZF A;  4IJA A;  3O9T A;  4DHY A;  3A8Y A;  1NBW A;  4FOE A;  3S41 A;  3RSE B;  2HF3 A;  5DM6 L;  1QZ5 A;  3PIP L;  3MK6 A;  2FSK A;  2A41 A;  3N4Q A;  2I7P A;  5BR9 A;  3MIO A;  3VER A;  3AAQ A;  4IEE A;  4WFB L;  3WXM B;  1QQN A;  4A2A A;  4WFN L;  4YOY A;  3GBT A;  3EN9 A;  5JMV A;  2GTD A;  2QWM A;  5BN8 A;  3DJC A;  3OBW A;  4WFA L;  2E20 A;  4H0T B;  1RGI A;  3NMU A;  1TUU A;  3FE1 A;  3ENH A;  3W3D A;  1WUA A;  4BRM A;  1TYQ A;  1OVY A;  2FLO A;  3CHW A;  2RIS A;  3CJ7 A;  4ISG A;  3VGK A;  4M7Y A;  4YOV A;  1ATS A;  4BRF A;  1LOT B;  4P8J A;  2PFU A;  4YKE A;  3P4I A;  3R9P A;  5I9E B;  3WXL A;  3HBT A;  1D4X A;  2FF6 A;  4BG9 A;  2VYP A;  1YUW A;  2E8A A;  3MN5 A;  4CI6 A;  4CZJ A;  2E2Q A;  3I55 N;  4FWN A;  5AQX A;  4BVP A;  4P6C A;  2V7Y A;  4IWV A;  3MK5 A;  1HJO A;  4A5B A;  3OHR A;  4IO8 A;  3GDQ A;  2YX6 A;  3L6Q A;  4CBU A;  3QIC A;  2P9L B;  4BR2 A;  2EQA A;  3CPE A;  2BUP A;  3E9O A;  4NZR M;  3CC4 N;  2QWR A;  2YHW A;  5M1N A;  2NRX A;  3ZEU B;  2P9U B;  4MLH A;  5BRH A;  4FBK A;  1TUY A;  2DPN A;  4IO9 L;  4QS9 A;  4IEI A;  3F9M A;  4K25 A;  1SZ2 A;  1BOT O;  2GUP A;  3RVC A;  4IZ9 A;  1Q18 A;  4BRE A;  4DKW A;  3SMS A;  1VQ9 N;  2I7N A;  4BRL A;  3ENB A;  5C2F A;  2F9T A;  2Q2R A;  3U8X A;  1K49 A;  4JHD A;  3VEX A;  4BR9 A;  4E1B A;  3ZYY X;  4Y0W A;  5TKY A;  3VEY A;  1Z6R A;  2P9I A;  5EXW A;  1GLD G;  4O8U A;  2ASM A;  1E4G T;  4JEP A;  2YJF A;  5AQO A;  4GY2 B;  1NWK A;  4BQL A;  3M3Z A;  1Q86 O;  1NGE A;  3FZK A;  3T7Z A;  4EHT A;  3CCJ N;  1N8R O;  5AQS A;  5ADX A;  3DAW A;  1DGK N;  2Q0R A;  3D2F A;  3KWI A;  4WCE L;  1K4P A;  2AP1 A;  3H07 A;  3A5O C;  3EZW A;  3LDL A;  3LRJ A;  5FPN A;  3MX2 A;  3H46 O;  4BRQ A;  3ZIE A;  4CD1 A;  2WUS A;  2V7Z A;  2OAN A;  5AQI A;  1IEZ A;  3HI0 A;  3O6W A;  1SS6 A;  4HTL A;  5KPT A;  1NGF A;  3IMX A;  4IOC L;  4JKE A;  4YOR A;  3H45 C;  3ZIG A;  3EE9 A;  4BC4 A;  3F5T A;  4FWR A;  3C7N B;  4KH4 A;  4B9Q A;  3CCU N;  4WQ4 A;  4BRC A;  5BRE A;  3QML A;  1T6D A;  2ASO A;  2QI2 A;  2ZWH A;  3FZM A;  2ZJR L;  2ZF5 O;  3DXM B;  3UKU A;  1DT9 A;  3U9D A;  5GAE P;  4JK9 A;  1K8A O;  4PKG A;  4JK7 A;  5FPM A;  5DM7 L;  2AA4 A;  2Q97 A;  1CZA N;  2LN3 A;  2D0P A;  2KHO A;  2P9B A;  1QQM A;  3EKU A;  1QHA A;  3IKM A;  4RWT A;  1QVG M;  3VF4 A;  3HOS A;  3FZF A;  4JD2 A;  3AGR A;  3ZET B;  4LC9 B;  1S72 N;  5F1X A;  4PL7 A;  3CD6 N;  3UKR A;  4GV6 A;  3O4W A;  5JVH L;  4C1N I;  1ZBS A;  3AAR A;  1K73 O;  3KHY A;  3C0B A;  3LL3 A;  4PKH A;  5ADX H;  3FZL A;  4AF1 A;  5AQV A;  4BR4 A;  2RE2 A;  5JIC A;  3MGZ A;  3CXC M;  3CC7 N;  2NLX A;  4BG8 A;  2QTD A;  4RTF D;  5AQG A;  5AFU A;  2GWK A;  4BRO A;  4BVO A;  3BF1 A;  4GV9 A;  5AQU A;  3TU5 A;  2OTJ N;  2BTF A;  1HX1 A;  1MWK A;  1QQO A;  1K4I A;  4FVU A;  3R3L A;  1NJI O;  4L3Q A;  5C10 A;  1VQM N;  1ZC6 A;  3CET A;  1Z05 A;  5F2R A;  1NMD A;  2QXL A;  4RCH A;  3VGM A;  5AQF A;  4YOX A;  1U2V A;  2VGN A;  1NGH A;  5M1O A;  4YOW A;  3CC2 N;  2FF3 B;  2VWB A;  3W0L A;  4JKF A;  4FL9 A;  1Y64 A;  5M1K A;  2NRR A;  1V4T A;  2NRT A;  1HKG A;  1SNN A;  1NGC A;  1DEJ A;  4NLB A;  2E88 A;  3VEZ A;  2JWK A;  3WQT A;  4EIA A;  4B1U B;  3J7Z O;  4FWM A;  3I33 A;  1J6Z A;  3VEW A;  2YCH A;  1RDW X;  1YAG A;  4G9Z A;  2QEX N;  2ZJQ L;  3CJB A;  3WEE A;  4AM6 A;  5AFU H;  4CZH A;  4HWI A;  1NGD A;  3CME N;  1GLE G;  5AZJ B;  3HZ6 A;  3TPQ A;  4ISF A;  3OW2 M;  2ITM A;  1BA1 A;  4QS8 A;  4CZK A;  2HMP A;  1G57 A;  3H3O B;  3TSQ A;  3K9J A;  1T44 A;  3Q7B A;  2YHX A;  3O9U A;  1XQS C;  4GNI A;  4IXC A;  4WYB A;  4P8E A;  3WXK A;  2D4W A;  3A0I X;  2NRZ A;  3L4I A;  5ELZ A;  3VTI A;  1JCG A;  4JHD B;  3CCL N;  1VQP N;  5BPL A;  5EY4 A;  3VET A;  5BPN A;  3SMP A;  3B8A X;  3A5M C;  3QFU A;  2BH1 A;  1MA9 B;  3KWG A;  3LM2 A;  4M7X A;  3WXJ A;  3GE1 A;  5CE3 A;  4IFE A;  4PKI A;  1Q7Y O;  1GLF O;  4BR7 A;  1YJW N;  3O08 A;  3JS6 A;  5KQ8 A;  4YDU C;  1C0F A;  1BG3 A;  3D2F B;  4FWK A;  1LCU A;  2IIR A;  1M1K O;  3FFK B;  3LQU A;  1NGG A;  3E66 A;  4XEI A;  1RDU A;  1HKB A;  4MDA A;  4C1N K;  4B1W B;  4FCX A;  4BRD A;  1K8K A;  4H0X B;  1QVF M;  3FLC O;  3DXK B;  4FWL A;  3FZH A;  5M1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...