3TSQA

Crystal structure of e. coli hypf with atp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
647
structure length
647
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 209
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsqA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsqA01
3TTDA 3VEZA 3VESA 3VTHA 3VF2A 3TSPA 3TTFA 3VTIA 3VERA 3VETA 3VEXA 3TSUA 3VEWA 3VF4A 3TSQA 3VENA 3VEOA 3TTCA
chains in the Genus database with same CATH superfamily
1LAWA 1KLMA 3BEXA 3JS6A 3SUPA 2VWJA 3VF2A 5M1NA 1JL1A 1M90O 1EO1A 1HQUA 3VGMA 3OHRA 4CJ5A 5KGWA 1IKXA 3ZIGA 2P9IA 1OKJA 1TK8A 2BDPA 5E41A 3IALA 1H0XA 1RBTA 2FC0A 1UWBA 3ZT1A 1XHXA 4B9MA 3OJSA 1QVGM 5C24A 3S3NA 1TUYA 3ID8A 3ZIEA 4FJGA 2QW9A 3RMDA 4F3OA 5AZJB 5AQOA 5CZ1A 4DV4K 2HBLA 4DTNA 2QWMA 4DTMA 3WEEA 4JRQA 3SZ2A 1NGHA 4H5NA 3QEVA 3CFOA 1IV0A 2X78A 3D45A 2VQEK 4IZ9A 4MFBA 2HMPA 2V52B 3KK3A 2P9LB 4ZHRA 4PA1A 2H3GX 3MXMA 1VQ7N 3AAQA 4OPKA 3B8AX 4DS4A 1HNIA 2IGIA 2XY7A 4FSVA 2DPNA 1G58A 2DTUA 3O9RA 2G8VA 1SS6A 3QNOA 1U6ZA 1R59O 4CF0A 4OLBA 4NXNK 4AQYK 1KD1O 4RWTA 4IDHA 3G71N 2D1KA 4NZRM 3QFPA 5CE3A 1S1TA 1VSMA 4LFBK 4QCLA 1NGCA 2UYTA 2UXDK 3SV4A 5AJ3K 1N6QA 1JCEA 2J4RA 2RPIA 1YT3A 3UKUA 3O3HA 4FJLA 3QNNA 2KQ2A 2GWJA 5F0XA 4M3ZA 3LVJC 1GLLO 3S9HA 1IKYA 1NKBA 5FPMA 4B8AB 2QI2A 4NO7A 1ZC6A 1K73O 5AQXA 4H4OA 4PKGA 1LWFA 4TSXA 2VG5A 3AARA 4I7FA 3O5BA 3A2FA 4CJKA 5C2DA 3VOVA 4XH1A 4AF1A 5KTQA 4F2RA 4NCXA 4CGJA 4DUYK 3LVKB 4J2BA 3WQUA 2KKZA 3WT0A 1Z25A 2ZGZA 1JJ2M 3R1XA 2G8HA 1WSFA 4CJ7A 3I8DA 4HD0A 4JHDA 3SBTA 3L3VA 3P1GA 4E7LA 3LS6A 3K5NA 4DR5K 3THYA 1P90A 4ID5A 3ALYA 4CHYA 1HNXK 2ZD1A 4JI8K 1JLFA 3AA3A 3ZT2A 4JI3K 5I9EB 4LF6K 2WC9A 1KFDA 3ENHA 3HT3A 3SJJA 4H0XB 4Y1CA 4KB1A 3SLCA 4BGAA 5AQUA 4DSIA 5F2RA 4FL9A 2YNGA 3WNEA 2ASOA 4JN4A 4IEEA 3FZFA 3CHWA 3PX4A 3RTVA 4H03B 5GIPA 4Y1DA 4JI2K 4CEEA 1NLVA 1RGIA 1SZ2A 5J2MA 1NBWA 2FF6A 1RILA 1ZYQA 4IWVA 2HHWA 5C2FA 4DTPA 1IKWA 5AQJA 3T7ZA 2HHTA 5BRHA 2YKNA 1YITN 5JS1A 4CIGA 3P31A 3OJUA 3IDHA 3MXJA 3E9PA 4CJLA 2UU9K 3BP8A 3DSCA 1U4BA 4ILHA 4DKWA 4CJPA 1V4SA 4JYAK 3MK6A 3HVRA 4ISFA 1C0FA 2FLOA 3NGYA 3SUNA 4DF4A 2A2YA 5IWAK 4B3RK 1W2BM 1QTMA 1A5VA 1WUAA 1KK9A 4CJVA 4B1XB 4JS4A 5ELZA 3MDQA 3LZJA 3F9KA 1KAZA 1K8KA 4W5OA 1Z05A 4XH5A 2IVOA 3DMJA 1ATSA 1L5UA 1BG3A 1N34K 4B9SA 2E88A 4CEDA 1TUUA 4EP4A 5FPEA 2CH6A 1VQ5N 5AQVA 2G8UA 1T05A 1RT5A 1DKGD 4BRAA 1N33K 3OYJA 1NJ1A 1W7AA 1QQNA 4O0JA 1YAGA 2BKYX 5C0YA 2OANA 2YV0X 3SAGA 1H4SA 1HRUA 3A5NC 3J7AP 1TKDA 2Q36A 3TR8A 4DTUA 1IEZA 4A5AA 4CK1A 1BA0A 1SL0A 3FFIA 3LM9A 5FPNA 2AJQA 1Z26A 5AZJA 1LW2A 4V19S 3K9KA 3MCAB 1YJWN 2ZF5O 2CH5A 3ZIIA 3CG7A 5EXWA 5CY4A 1BCMA 1OVYA 3G25A 3TAMA 4CJUA 2P9LA 1U45A 2ZQBA 1QHAA 3M8SA 4GMJB 3G10A 1WB9A 1MWKA 1X3MA 4FO0A 1NKCA 4CECA 5HRRA 1Y97A 1W9HA 2HNYA 4A59A 1VSDA 4DSLA 1VQ4N 3HZ7A 4BR5A 4CJ4A 1KAXA 1S1WA 3S3MA 1YTUA 1S9GA 2P9KB 1T7PA 4AHTA 3CCSN 1V4TA 3Q7BA 1C0MA 3MEGA 1X9SA 1HNVA 3ZETA 3C7NB 3MN6A 4CESA 1JKHA 2D5RA 5BREA 2QWLA 3FR0A 3OYIA 5AQKA 4WQ4C 4E1NA 4LSLA 4JLHA 4RW7A 4CHQA 1W0HA 3CMAN 1FXXA 4DU3A 1YUWA 4AILC 1UDVA 3CPWM 5BR9A 2Q31A 4JK9A 1VSLA 2QK9A 4IOAL 1DTQA 1BWFO 4L3QA 4DV7K 4JKDA 3P04A 3GG4A 4CGDA 3VENA 4F8RA 3MK5A 1RDAA 1Q18A 4R5PA 3TARA 5EVZA 2XRIA 1BQMA 3M8RA 1ILYA 4YDUA 4DQ8A 1WSGA 1TYQB 3WNGA 1TL1A 1SL2A 3CF5L 2RIUA 4N47A 4BE2A 1K9MO 2HNZA 3AO3A 2A3ZA 3V1OA 4ICLA 2FSKA 3Q7CA 3THWB 2IDOA 2WTUA 2Z1JA 4EZ9A 4FJ7A 4BRKA 2ZJRL 3L4IA 5C15A 4JKFA 3O3FA 3CCQN 2HBMA 1VQ8N 1IBLK 3L8BA 1HYSA 4FZZA 4O5BA 4G9ZA 3WBMA 4KTWA 4DR3K 3C6UA 1NMNA 5SWMA 4CK3A 1TKZA 2FXUA 4B1UB 4C23A 3F73A 3UIQA 1IJJA 3K5OA 1S1XA 1HNWK 1NH9A 3U3YA 4K87A 3T1IA 2O8CB 3V1QA 1DCJA 1D8YA 4B3OA 3HYFA 3CCJN 1B9DA 1KQSM 3MN7A 4DMNA 1QQMA 1D4XA 4F3TA 1NK6A 1VQON 1VSEA 1ASWA 2DY4A 4LF7K 1BA1A 4BRDA 4IG0A 1WN7A 4EFHA 1RTJA 4BE0A 2EK0A 3R6MA 3ZT3A 3ATVA 4NZTM 3TAEA 5LY3A 4Z4IA 2YNFA 4DQRA 4FWLA 2ATQA 2DFFA 5FLXO 2F4VK 2KHOA 4FOEA 2Z7CA 3CI5A 4GV6A 1SQKA 1FKOA 3ZSVA 2YHWA 3D2FB 4NCAA 5FRMA 5ADXA 1A5XA 5JVHL 4DTSA 1NOYA 1EX4A 4FPAA 3LP1A 5CYQA 4PHTX 2H9UA 4A61A 1VSKA 3LZIA 3ENOA 3HI0A 2YNHA 3DOLA 3JXUA 2GWKA 2HW3A 4BR7A 5AQSA 3DLGA 1JCUA 1K4PA 1KVBA 3HVTA 4M7XA 3CM5A 2OPSA 2JGUA 4HCBA 3ZT0A 1VR4A 2E2OA 3OYGA 4FJKA 1LAVA 4RG8A 2RHKA 4KREA 2ITMA 4J2EA 3SV3A 3N4QA 3RRHA 1L3TA 4EHTA 3L2WA 3J8AA 3D7EO 4DG1A 1GLDG 2QA4N 1NK4A 4KBOA 5J1EA 3VTHA 1IKVA 3SQ2A 2HHSA 4LY7A 4CEAA 1KXPA 1C1AA 2ZWHA 1KVAA 4N56A 3MAQA 3CFPA 2E2PA 3DOKA 2IOCA 3GOIA 3H3OB 5AQMA 2P9NB 3U6FA 2HSTA 3O4NA 1NFJA 3KLGA 3CJ1A 4CFCA 5BR8K 3THVA 2P9SB 4CZHA 3KTQA 4KHSA 5AQHA 4FJXA 3CC2N 1CZBA 1RDBA 1MWMA 4K42A 5LJVA 4LC9B 4CZGA 2P9KA 2LN3A 3NF7A 3RRGA 3GDQA 4RW6A 4DWIA 5BPMA 4O55A 3O8MA 5AQFA 3C7NA 2OA8A 2IIRA 1CXQA 2UUAK 4BVPA 3TSUA 5T7BA 4FBQA 3PUFA 3OYBA 4AHUA 3C6AA 3P5JA 4RW8A 2HHUA 1RDDA 3CJ9A 2WUSA 1HKCA 3W3DA 5JICA 3VERA 4DR6K 2QWQA 4N5SA 3VQQA 3CCUN 2X6SA 1J54A 4FBKA 4CF2A 2OCEA 1XMQK 1RBRA 4PL8A 3VPZA 4E3SA 2QM1A 1VQKN 4B9VA 1O1WA 4LH4A 3CFRA 2GTDA 2KZZA 3WQTA 3IFRA 5KGXA 3AA2A 1TIGA 1TYQA 3WXKA 2L8YA 3SAHA 2GUPA 4GV3A 3SQ0A 4CEFA 3ULDA 4CJQA 3M8QA 1SKWA 3OYEA 5FDLA 3IABB 2GV9A 2VGMA 2ASPA 4KFBA 4ZTFA 3THWA 2JLEA 3CM6A 1NK8A 3EKSA 2ASMA 4YNQA 2XY5A 3PX0A 2A5XA 5FRNA 2BE2A 2W40A 4BRCA 3U4LA 2XY8A 4DTOA 3EL2A 2HMIA 4YOWA 3NGZA 3IS9A 4YOXA 1CXUA 3HL8A 1YXQA 4FCXA 1JLGA 4CEZA 1KC8O 2NRXA 4M7YA 4IG3A 4YDQA 4BACA 3RSEB 3V9ZA 3DLKA 4I14A 4CVNE 5J2PA 3RWUA 3C0BA 4KH5A 2O8CA 4YOTA 1T6DA 1VK0A 4CJFA 2Q2RA 5KPZA 5HLFA 3NH2A 4DB3A 4DR7K 3L6QA 4KTZA 1NM1A 4G1QA 4FZYA 3PSIA 4PKIA 3OYLA 3WXLA 4CERA 1NJ6A 1TL3A 2GX9A 3R8EA 3O6WA 3BGRA 4K8ZA 4W5TA 4WI1A 1K49A 5GINA 4F9OA 3DXMB 3H45C 3OS0A 2VCPA 1HC7A 1H4TA 1JXEA 3CJAA 1VRUA 3HO1A 1D9FA 1VSFA 4R79A 4KHWA 1H0YA 1KTQA 2YJFA 3C6TA 1NJZA 4O5FA 4JKAA 2PZSA 1BO5O 3AGRA 4YKEA 1GLAG 1RDCA 2EQAA 2YJEA 3D2FA 1L3SA 1BU6O 1ESVA 2V51B 4WFBL 2G8IA 1C1BA 1WSHA 4P77A 1XHZA 4BGBA 3LDSA 4DUZK 4XEIA 4CHPA 3JYTA 4E0DA 2E1YA 4HUFA 1SV5A 3AVBA 3MWPA 4KH6A 1DTTA 4KHYA 5DMRA 4DFMA 3AO1A 2LSNA 4GV9A 1MA9B 1KAYA 1C0TA 3AVHA 4CZMA 1RT6A 3HPHA 4JRPA 4CEBA 4FM2A 2I5JA 1H4QA 4EZ6A 1SUQA 3DSDA 4CBWA 3O9UA 4KO0A 2OTJN 3MWTA 4IBNA 4Z9EA 3O4WA 4ILJA 4NLCA 2Y1IA 5BRDA 3ZCMA 1UA0A 3VEXA 3A0IX 3EY1A 1LCUA 4CJEA 4FW2A 2IFEA 1K8AO 3AVAA 4CW7B 3I56N 4ZTJA 5EU7A 4WQ5C 4IJNA 2G8KA 1VQPN 2Q3SA 2A42A 2F9WA 5DM6L 2HBKA 4H0TB 2QWPA 2BTFA 2P9SA 2BANA 1BOTO 4GY2B 4KHNA 2GTCA 3BZKA 3HPOA 4EHUA 3NHGA 1MU2A 3VQBA 3SCXA 3PIOL 1IG9A 3EYZA 4JI0K 5EX5A 4E19A 4WFNL 1NJIO 1JLAA 2P5GA 1ITGA 3SPYA 3AGKA 1TKTA 2VWBA 4B9LA 2EHGA 4DV5K 3O9QA 3ZSQA 3EE9A 2NRVA 5AZIB 3OS2A 1NKEA 1WSJA 3ISNC 1HJOA 3FZHA 3BF1A 2KLAA 3DLBA 2RKIA 4BR0A 4X62K 5LMUK 1NJWA 2OYQA 1U48A 5HL7L 2QWRA 1Y9XA 4CJSA 4DR1K 2ETJA 3TSQA 2DFHA 3NH0A 2OZMA 4CEQA 4Z4CA 1Q9XA 4KB0A 3VGLA 4OO1J 2ZJQL 4FLXA 3K9JA 5M1FA 3WUHA 3TWHA 1K4LA 3ULEB 3SJHA 4BC5A 3AAPA 4OKJA 4KI4A 3ZSYA 1GOBA 2IS3A 4FVUA 4CK2A 3WXMB 4CEOA 5J2NA 1Q9YA 1HR0K 1U04A 4CIEA 1RDWX 2HNDA 4DSEA 3O1WA 1NJ5A 3PIPL 4YDUC 3IABA 1S9EA 3TTCA 2PBDA 4BRGA 2HF4A 3AO5A 5AQPA 5JS2A 4JI5K 2YX6A 4OGCA 1LW0A 3NF9A 4RCHA 5JLHA 1TK0A 1A5WA 1WSEA 4M3UA 2F96A 5HRNA 3MCPA 1TK5A 4OKKA 3HXMA 3QICA 4DV6K 4FBWA 1Q86O 5C42A 1S1UA 4LF4K 3QIOA 1OH5A 4FWOA 5K14A 3VN5A 3P4IA 1X9WA 2X6NA 2UXBK 2FSJA 4A57A 3QBXA 3K59A 3ZSOA 3T1YK 1QVFM 1PAVA 3LDOA 3HSTB 4JI7K 3RSEA 3KJVA 4CBXA 2VG7A 3BF3A 2YCHA 4JD2B 1HUXA 5AFUH 2QKBA 1NJYA 4LF9K 4WQ5A 5KRTA 2VQFK 3AVMA 1BGXT 3V1RA 3VA3A 4CZEA 3VQ4A 4IFVA 1SKSA 2A41A 3DXMA 1LWCA 2VG6A 1BUPA 4B3MK 3QESA 1X9JA 3TSPA 4A5BA 4LFAK 1FKPA 3DAWA 4OPHA 2I7PA 2G8FA 1YI2N 3VQ6A 3BUZB 1WAFA 2UUBK 4Z0UA 1C1CA 4BR9A 2XO7A 3HBTA 3VMFB 4BREA 3QEPA 5M1QA 2OPQA 3OA9A 4DTJA 3NFAA 4DR2K 2EH1A 5HOOA 1C0UA 4Q5VA 1OH7A 4CF8A 1XQSC 4A2BA 3HK2A 3QEIA 4AHSA 3A5LC 4HHTA 5I42A 1REVA 3NH1A 1GOAA 1S5JA 3HJFA 4FLTA 2XY6A 3LALA 4Z94A 3VGKA 4UY8O 4ILGB 1RDUA 4P6DA 4BVOA 2QTDA 1NG9A 3HZ6A 1K6YA 1HRHA 4JI1K 4DQSA 4ELUA 3VQ9A 4LH5A 4OKEA 5JLFA 4IO8A 3SUQA 1LN4A 3CCEN 1QZ6A 1WSIA 3H46O 4FLZA 3LQUA 4BRQA 4ELTA 4GKKK 4I6MB 4BQLA 4M45A 4PQUA 3DI6A 4QAGA 1G99A 5LL6Z 3MN5A 1Q82O 4DHYA 1TAUA 2Q3VA 1TKUA 4LF5K 2WOMA 3L2RA 3AVNA 4YFUA 3S41A 3QINA 5AR0A 4A2AA 4IXCA 1ASUA 2MX1A 1XC9A 4M42A 4NYNA 3CYMA 1VQ6N 3TAGA 4C8LA 1OH8A 4WE1A 4JV5K 3L0QA 4MDAA 4Y0WA 3GBTA 1QE1A 4Q15A 2WFBA 4LF8K 2FBTA 3ZLJA 4K25A 1OH6A 3KWIA 4C8NA 4HVCA 2KFNA 4YHHK 3QETA 5AZIA 3QMLA 1QHTA 1NGGA 1OVQA 1WOQA 4CHZA 3LP0A 2NRRA 5AQIA 3U9DA 1Z6RA 1HMVA 5A2QO 1SAZA 4MO4A 3ZX0A 4J8FA 3LDNA 4NCBA 3I33A 4FWMA 4CGFA 3RR7A 5GAEP 3ZT4A 1RT1A 4IOCL 5KRSA 1H1VA 2P9IB 5AQWA 3LPTA 4P8JA 1ZXOA 4KV8A 2X74A 2A1RA 1HLUA 2P9PB 1S22A 5EY4A 4U7BA 5HRPA 1KCFA 3HPGA 1JDQA 4FWSA 4H8KA 3ULEA 1RTDA 1QSSA 4KAZA 1JLBA 2VWKA 5AQLA 4K43A 3LDLA 4EP5A 2KZMA 3CIPA 1BIZA 4ELVA 3L3UA 3VQ8A 3LL3A 3CC4N 4CJ3A 1N36K 4CF1A 5BN9A 3KK2A 3IAYA 2E8AA 3OYKA 3E9OA 4CFBA 1E4FT 4C1NK 3NCIA 1NK5A 5BPNA 5LJWA 3M5RA 3BDPA 5HBMA 1ZBSA 4FOIA 4M3WA 4TWAA 1SL1A 2FF3B 1UA1A 2O4IA 2Q0UA 3ATUA 3R9PA 1SNNA 4NCGA 1DT9A 1IH7A 4CBUA 1TV6A 4JKBA 4DSKA 1L3UA 4KHPK 3UB5A 1PVWA 3QFUA 3FZLA 4CGHA 4CFDA 1NMDA 1N8RO 3LDPA 1JXBA 3VEWA 2D0CA 3N4PA 4J2AA 4WCEL 3TOEA 1T44A 4CZLA 4IEIA 1J5EK 1RFQA 3LAMA 3J7ZO 1DGKN 5AQQA 4OVLA 5CHIA 5TKYA 4IO9L 4Q0BA 2O4GA 4FWNA 4QS9A 3IMXA 4B8CA 3TTDA 4CF9A 2Z1HA 2W6LA 4JD2A 4AHRA 2IVNA 4I9QA 4H5TA 4UQGA 2ZJPL 3AVGA 4CE9A 1UOCA 4ID1A 3V6DA 3F2KA 1VAZA 4B9NA 3KLIA 3LAKA 4BWMA 1E3MA 4BDPA 5GADP 4FM0A 1RT2A 1JE3A 4B3TK 5E84A 2D0OA 4BDZA 4K88A 4XIUA 3WNHA 2Z1IA 3TTFA 1EQYA 3MN9A 4DTXA 4DF8A 1NGJA 1NK7A 3VQ7A 3QERA 3NVKA 2HHQA 4OLFA 3KKRA 2HF3A 2W41A 4E1MA 3KLEA 3I8BA 4JKHA 3OYHA 4IJAA 2ZE2A 3PO5A 2E2NA 4BG8A 3A5MC 4E89A 4KTQA 2HBJA 3ZYYX 1VQMN 1QQCA 2HB5A 1SKRA 3QDKA 3CQ8A 3NF6A 1G57A 1S3XA 3A5OC 3F9MA 4RW9A 4BRLA 4PWDA 2HHVA 3UKRB 2NRZA 3DRPA 1WAJA 1U47A 4WYBA 1KSPA 5C12A 5AQTA 3AVCA 3TAPA 3L4QA 5KQDA 1S8EA 4JK7A 4OGEA 3RMAA 3SBGA 2HOEA 4W5RA 3J7YP 1KRPA 2O8EB 1VRTA 2XHBA 3E66A 1VSIA 3LWLA 4DR4K 2B5JA 2WBNA 3E9LA 5KI6A 2P5OA 4BRNA 3T3FA 4I6MA 4BC4A 1QZ5A 1XUPO 4P6PA 3H1VX 2CGKA 2HVHA 3U8XA 1VHXA 3M8PA 4BY9C 4H5RA 4BQZA 1VQLN 4PY5A 2BH1A 3V9WA 2OPPA 4GW6A 3K5MA 2E6MA 2Y1BA 3M1FA 3VEVA 3B6OA 5GAHP 1YVUA 1XEZA 1NK0A 1S72N 1JLQA 4DS5A 3O80A 4DFKA 3HOTA 1LV5A 5AQRA 1O13A 3CERA 4JK8A 4CJWA 4DQIA 1IBKK 1HNZK 3U6YA 1ATRA 3L7VA 3NDKA 2NNWA 3MIOA 3O9SA 1LWEA 1IBMK 2NLXA 4LD0A 3O08A 1NWKA 3HOSA 4QS7A 4DQQA 2CGLA 1HQEA 3L2VA 2FBYA 4E1JA 3CPEA 3THXB 3KLHA 4E7HA 3LWMA 4P8EA 2IC3A 4FLVA 2FBXA 1RT7A 1Q7YO 3NF8A 4OPJA 2GBZA 3C65A 3HTVA 4B1WB 3OYNA 2JWKA 1M1KO 3IKMA 2W42A 3EN9A 4H4MA 1RCHA 3I55N 4FJJA 1K4OA 1NJ2A 4BR4A 2RE2A 4GVMA 3DYAA 2P9PA 5JVGL 2HVIA 3ZEUB 1Y2IA 3H1QA 1GLJO 3KKSA 3LDQA 4RTFD 3DXKB 4IFEA 2CRQA 1ZBUA 1S6PA 1EP4A 1CLQA 4CGIA 5M1OA 3TI0A 4Z4GA 4RW4A 4BC3A 1VQNN 4CZJA 4K0KK 4B9QA 4DCHA 1Q81O 4JKCA 3VESA 2YNIA 3C6HA 3C94A 3SMSA 3PLAA 5F1XA 5AQGA 4Z4HA 3E1YA 4FLYA 4FW1A 2M71A 1D9DA 4M3TA 3OVNA 3KZBA 5AQZA 3AV9A 4KHQA 3AA5X 4HTUA 1VM0A 1WNSA 3ZETB 3H3NO 3D2EB 1T3VA 3KVGA 3VTIA 3SMPA 1YJ9N 3P39A 4DSFA 3ZSXA 3HP6A 5HP1A 5SZTA 4DV3K 2PYLA 5HROA 2F7TA 4MDBA 2B4JA 1JLCA 4PUOA 3EZ5A 2YHAA 1XI1A 3CC7N 4K41A 4W5NA 1C0GA 2E2QA 5B8HA 1LOTB 2B6AA 4YOYA 1J6ZA 3ENBA 3MEDA 4CZIA 4O0IA 1JCGA 3AO4A 4IDKA 5LMNK 2P9NA 3J81O 3KK7A 3PX6A 1W97L 1D5AA 3F5TA 3AO2A 3NBPA 3W0LA 4HWIA 4O44A 4YOVA 4FLWA 4KPYA 1NU0A 3MEEA 2IVPA 4A62A 3DM2A 3OYMA 3ASMA 2NRTA 3RMBA 1S6QA 4K8XA 4DV1K 2P9UB 4JEPA 2NZTA 3O9TA 3V9XA 4L8RB 5J2QA 2VGNA 3DLRA 3QKBA 1HYVA 2BGGA 4C8MA 3HRGA 3EE8A 3QO9A 3VEOA 4DV0K 4JKGB 4OJRA 3UKRA 2QWOA 3CCMN 4KI6A 1FJGK 4DFPA 5I3UA 4AM7A 4BE1A 4FZXC 2FSNA 4FFJA 2Q0RA 1RT3A 1VSHA 1CZ9A 1ATNA 1NGBA 3K57A 3KD5E 2UXCK 2QXFA 4OPAA 1P8ZA 4AHVA 3OTOK 4DTRA 2O8EA 3OYCA 5CYMA 4GVEA 4HUEA 5DK5A 4EAHD 2QEXN 4ISEA 2FBVA 3DJCA 4CZKA 2F8TA 1DEJA 4B08A 4Z4EA 1NNEA 2O8DB 4FPBA 3IRXA 1BDGA 3LRJA 3BZCA 2F9TA 3EZWA 4FWPA 2RF2A 3I0SA 2NRHA 4WFAL 3D0PA 1HPZA 1CZAN 3DRRA 3AY9A 4YOUA 1BI4B 5CR4A 1KLNA 3LP3A 1NFHA 1KVCA 4IFYA 2HHHK 4F2SA 4PKHA 2JWLA 1WBDA 1HX1A 1TKXA 3K0SA 2LXRA 4M3XA 3PY8A 3CQYA 3KWGA 1C6VA 2KFZA 1EWRA 3ZSRA 1TGOA 2QXLA 3AA4A 3K58A 3OYAA 3R3LA 5AFUA 3VQ5A 1U2VB 5E26A 5KPTA 2V7YA 3THXA 3CQXA 1K4IA 1EETA 3RR8A 4FXDA 4X65K 4CJTA 2YHYA 4E1BA 3SPZA 3VQCA 3CCVN 3HM8A 3SI6A 1VQ9N 2OPRA 3U9ZA 1EWQA 3JAMO 4KHUA 5BPLA 1Y64A 4DLEA 4GKJK 1RBVA 1J9AA 2Q1NA 3ZSZA 2IAJA 2GEMA 3IG1A 4DV2K 1B9FA 4E7JA 1XWLA 3ZEUA 3FZKA 1JLEA 1BISA 4C8KA 3SYZA 3CJBA 3VETA 1JL2A 3DXKA 4JKEA 2KTQA 3EKUA 1YHQN 4JS5A 4H0VB 2NUBA 3KIOA 1TVRA 1S1VA 3SUOA 4H5VA 1ZBHA 4F4KA 4J2DA 2E20A 3ID6A 3P38A 3TAQA 4B1YB 1GLEG 3KHYA 3M6GA 3FGUA 2A40A 2EWSA 2CGJA 3VQAA 4BRIA 3I0RA 2VYPA 3V9SA 4H0YB 3MXIA 3FE1A 4FWKA 3WNFA 4NLBA 4FJ5A 1XNRK 4W5QA 3T1AA 3FLCO 4CD1A 4H5WA 2YHXA 1TAQA 3QEXA 2WONA 2YI1A 4O8KA 2YKMA 4HUGA 1Q8IA 5HRSA 2I7NA 1RNHA 3G0ZA 3GE1A 1X3NA 3TU5A 4FWRA 3D2EA 3TPQA 3O4QA 1NGEA 4BRPA 3V81A 3LANA 5M1PA 2NRWA 1EXQA 4I2QA 3E01A 3DRSA 3S3OA 3GL1A 3RMCA 3WXJA 4KKOA 3OYDA 4BC2A 1HKGA 3HP9A 1RQ8A 3MMVA 4FJ9A 3BY5A 4OLAA 3VQPA 2O8FB 3VF6A 4OX9K 4M41A 4DQPA 3TABA 4JI6K 1WLJA 2R7YA 1U49A 4N76A 4WF9L 2O8BB 1XMOK 2AP1A 4XH4A 3H6EA 1BHLA 4MO5A 4B3SK 5GAGP 1QSLA 4N41A 3CCRN 1FK9A 2D0AA 4CIFA 4O8UA 5FROA 4FLUA 1VSJA 1ZBFA 1YIJN 2GUIA 3VQEA 4K86A 4E7IA 4DU1A 3OBYA 4KRFA 1HJRA 2AA4A 3PO4A 3HSCA 2P9UA 3DLLL 4P6CA 2GELA 4BRHA 1GLFO 4GNIA 5BRFA 3SK3A 2RN2A 3M3ZA 3L2QA 4FJIA 1MDUB 1NJ8A 3EEQA 4FJHA 3TAFA 4CGGA 3VA0A 4JKGA 2KW4A 2P1JA 2Q97A 1N5YA 3OBWA 4BWJA 1N32K 4FWQA 4CI6A 3NGIA 2Z1GA 4JI4K 3H07A 3V4IA 3AVLA 2OZSA 4AH9A 1ZBIA 3DWLA 2A6AA 1BQNA 2OTLN 4H0OA 1HPMA 5KPRA 3RVCA 2D4WA 4BROA 4NB4A 2PYJA 5MLCQ 3T19A 3AVIA 4Z4FA 2O8DA 4BG9A 3SQ1A 1PVYA 4B1VA 2W6KA 4HTLA 2Y1JA 3WEEB 1E4GT 4CZFA 1IO2A 4QOZB 3MX2A 3VEYA 4IOXA 1RT4A 4BR2A 3OY9A 4DFJA 2PFUA 1JCFA 3B6PA 3MECA 5DM7L 4B9TA 4FCYA 3NAEA 1ZBLA 1BI4A 2ITGA 1NGIA 2DFEA 2P9BA 1NOZA 3LM2A 3DLHA 1HKBA 1RBSA 2G8WA 3OYFA 3L2UA 3TANA 3QB0A 1IG8A 3OS1A 4C8OA 4WQ4A 4NXMK 2E1ZA 4M63C 4B1ZA 3CJCA 1YTAA 3CJ7A 3QLHA 1T03A 3KLFA 4IKFA 3WXIA 3PV8A 5BN8A 1RTIA 3VF4A 4FK0A 3UKUB 1U2VA 4O4GA 3SAFA 4NYFA 1QSYA 3UE5A 5ADXH 3AVFA 3QBWA 3J80O 2A1SA 3LP2A 1GLBG 1JO0A 1DLOA 3P83D 3PSFA 2PAVA 1NGAA 1I39A 3CETA 4M3YA 2UUCK 2PY5A 5AQYA 2EX3A 3JSMA 5D3GA 3VEZA 1ASVA 2D0BA 3U3GA 1FW6A 3ZSWA 4C1NI 1GOCA 3CCLN 4BRMA 1BCOA 2QWNA 3QIPA 3ITHA 5FPDA 2V7ZA 5TKWA 3FFKB 4JHDB 4JNEA 4FJ8A 3K2PA 3CXCM 2E4LA 4EO0A 2BUPA 1NK9A 1II7A 1J53A 1NJXA 1J5OA 4FJNA 1TKSA 3THYB 3AJEA 3K5LA 5GIOA 4AHCA 1NGDA 4YY3K 4FM1A 5H1SQ 4AM6A 5C25A 1YF5L 4LSNA 1XNQK 4BRFA 1GLCG 3SQ4A 2E5LK 3MGZA 4HCCA 3NE6A 3V9UA 4CCHA 5EOYA 3DLEA 2QKKA 1HYZA 3H08A 3T1HK 1YVNA 3ZX2A 1T8EA 4FYDA 3G4SN 5CZ2A 2D0PA 2ZM6K 4YORA 4CD3A 3CD6N 4FK4A 4MQ3A 4DSJA 5C10A 1X9MA 4E7KA 3O3GA 2P51A 4HVZA 1EKEA 4H0PA 3MX5A 4LFCK 2F8SA 4EIAA 5AQNA 1KFSA 5KQ8A 4JAXA 3D6RA 3KD1E 4MLEA 3ZX3A 4U67L 5JMVA 4FK2A 3VQDA 4DU4A 1RBUA 3KK1A 4FVMA 3HM9A 1I3AA 2RISA 1K7JA 1G15A 3O1BA 2O8FA 4QS8A 3G6EN 3ZIHA 3C95A 3FZMA 4DLGA 2ZGYA 1BL3A 4KH4A 3OW2M 4PL7A 1YJNN 4BDYA 2O8BA 5IT9O 1R0AA 1QS4A 3A8YA 4CHNA 4ISGA 3IUCA 3AVKA 2HHXA 3NVMA 4I9LA 4MLHA 4HVJA 1QQOA 4I2PA 3EO3A 1UAXA 1B92A 1T6CA 4X64K 2E6LA 3CMEN 4B9UA 3SNNA 3QEWA 1F21A 1L3VA 3T69A 5M1KA 1K8KB 3AVJA 4FJMA 2YHBA 3LPUA 1I94K 1WBBA 4CJRA 1BIUA 4CHOA 1XC3A 4M3RA 4X66K 3NMUA 1RTHA 1X1PA 4CFAA 1NGFA
chains in the Genus database with same CATH topology
3HI0A 3BEXA 3JS6A 1XQSC 3JXUA 4JKGB 3VF2A 2GWKA 3UKRA 4A2BA 5M1NA 4BR7A 1M90O 1EO1A 2QWOA 3CCMN 3VGMA 3OHRA 3A5LC 5AQSA 4AM7A 1JCUA 1K4PA 2FSNA 4M7XA 4FFJA 2Q0RA 3ZIGA 2P9IA 1OKJA 4Z94A 3VGKA 1NGBA 1ATNA 4UY8O 4ILGB 1RDUA 4P6DA 4BVOA 2QTDA 4OPAA 1P8ZA 2E2OA 3HZ6A 2RHKA 2ITMA 4GVEA 1QVGM 3N4QA 4EAHD 5JLFA 2QEXN 4ISEA 3DJCA 4CZKA 4EHTA 1TUYA 3ID8A 4IO8A 3J8AA 3ZIEA 3D7EO 2QW9A 1DEJA 5AZJB 4FPBA 5AQOA 1QZ6A 3H46O 3CCEN 3LQUA 2HBLA 4BRQA 1GLDG 4I6MB 2QWMA 4BQLA 1BDGA 2QA4N 4KBOA 3WEEA 3LRJA 3VTHA 1NGHA 4H5NA 2F9TA 3EZWA 1G99A 4FWPA 4IZ9A 4YOYA 2HMPA 3MN5A 2V52B 1KXPA 1Q82O 2P9LB 2H3GX 4DHYA 1TKUA 2ZWHA 2NRHA 4WFAL 4P6CA 1VQ7N 3AAQA 2E2PA 1CZAN 3B8AX 4FSVA 2DPNA 3AY9A 3S41A 3GOIA 3H3OB 1G58A 5AQMA 2P9NB 3O9RA 4YOUA 5AR0A 2HSTA 4A2AA 4IXCA 5CR4A 1SS6A 3CJ1A 2MX1A 1U6ZA 1R59O 2P9SB 4CZHA 1KD1O 5AQHA 4RWTA 4PKHA 2JWLA 4IDHA 3G71N 1VQ6N 3CC2N 1HX1A 1MWMA 4K42A 5LJVA 2D1KA 4NZRM 3QFPA 4LC9B 4CZGA 3L0QA 2P9KA 3CQYA 4MDAA 5CE3A 3KWGA 2LN3A 4Y0WA 3GDQA 1NGCA 3GBTA 5BPMA 2UYTA 2QXLA 2WFBA 3O8MA 4K25A 5AQFA 3C7NA 3KWIA 1JCEA 3R3LA 2IIRA 2J4RA 4BVPA 5AFUA 3UKUA 5AZIA 3TSUA 3QMLA 1U2VB 1NGGA 5E26A 1WOQA 2GWJA 2V7YA 5F0XA 4FBQA 3CQXA 5KPTA 1K4IA 1GLLO 2NRRA 3C6AA 5AQIA 3U9DA 1Z6RA 5FPMA 2QI2A 4NO7A 1SAZA 4MO4A 1ZC6A 3ZX0A 4J8FA 3LDNA 5AQXA 2YHYA 3I33A 4FWMA 1K73O 3CJ9A 2WUSA 4PKGA 1HKCA 5GAEP 4E1BA 3AARA 3W3DA 4IOCL 3CCVN 3O5BA 3VERA 5JICA 5C2DA 3HM8A 4XH1A 3VOVA 4AF1A 1VQ9N 1H1VA 2QWQA 2P9IB 5AQWA 3U9ZA 3CCUN 4P8JA 4FBKA 5BPLA 1Y64A 1ZXOA 4PL8A 3VPZA 3WQUA 2KKZA 3WT0A 2QM1A 2ZGZA 2Q1NA 1VQKN 1JJ2M 3R1XA 1HLUA 2GEMA 2P9PB 1S22A 5EY4A 4CJ7A 4U7BA 3ZEUA 3FZKA 3ULEA 4FWSA 4JHDA 3SBTA 5BRFA 2GTDA 3WQTA 3CJBA 3VETA 3DXKA 4JKEA 5AQLA 4K43A 3EKUA 3LDLA 3IFRA 1YHQN 3CIPA 3LS6A 4H0VB 4H5VA 3LL3A 1TYQA 1P90A 3CC4N 3WXKA 2E20A 3ID6A 3P38A 5BN9A 4B1YB 1GLEG 2E8AA 3KHYA 3SAHA 3M6GA 2GUPA 3E9OA 1E4FT 3FGUA 4C1NK 4GV3A 2A40A 2EWSA 2CGJA 5BPNA 5LJWA 3M5RA 4BRIA 1ZBSA 2VGMA 2VYPA 4FOIA 2ASPA 4H0YB 3FE1A 5I9EB 2FF3B 2WC9A 3ENHA 2Q0UA 3ATUA 3EKSA 2ASMA 4FWKA 3R9PA 2A5XA 4H0XB 1SNNA 3SLCA 2W40A 4BGAA 1DT9A 5AQUA 4BRCA 4CBUA 4NLBA 4JKBA 3U4LA 5F2RA 3UB5A 1PVWA 3FLCO 4FL9A 4CD1A 3EL2A 3FZLA 2YHXA 3QFUA 1NMDA 2ASOA 4H5WA 4YOWA 4JN4A 4IEEA 3LDPA 2YI1A 3VEWA 4O8KA 3N4PA 4YOXA 3FZFA 4WCEL 3CHWA 2I7NA 1T44A 3GE1A 4CZLA 1YXQA 1X3NA 4H03B 4IEIA 1RFQA 3J7ZO 4FCXA 1DGKN 3TU5A 5GIPA 4FWRA 3D2EA 1KC8O 5AQQA 3TPQA 5CHIA 1NGEA 2NRXA 4M7YA 4BRPA 5M1PA 5TKYA 2NRWA 3RSEB 4IO9L 4FWNA 1NLVA 1RGIA 4QS9A 3IMXA 1SZ2A 1PVYA 4I14A 3TTDA 3GL1A 3WXJA 1NBWA 2FF6A 4BC2A 3C0BA 4JD2A 4KH5A 1HKGA 4IWVA 4YOTA 1T6DA 3MMVA 2Q2RA 5C2FA 5AQJA 5KPZA 2IVNA 3T7ZA 4DB3A 3L6QA 4H5TA 5BRHA 2ZJPL 1YITN 1NM1A 3P31A 3VF6A 3IDHA 3E9PA 4PKIA 3WXLA 4BRDA 3BP8A 2GX9A 4ILHA 4DKWA 3R8EA 4WF9L 3F2KA 3O6WA 1V4SA 1VAZA 2AP1A 3MK6A 5GINA 1K49A 4ISFA 1C0FA 3H6EA 3DXMB 3H45C 4XH4A 4F9OA 5GADP 5E84A 2D0OA 2FLOA 2VCPA 4MO5A 3CJAA 5GAGP 4R79A 3CCRN 1W2BM 3MN9A 3TTFA 1EQYA 4O8UA 1KK9A 1WUAA 1YIJN 1NGJA 4B1XB 2YJFA 5ELZA 3NVKA 3MDQA 3OBYA 4O5FA 2AA4A 1KAZA 1K8KA 2HF3A 2W41A 4JKAA 1BO5O 3AGRA 3HSCA 2P9UA 3DLLL 3I8BA 2GELA 4YKEA 4JKHA 1GLFO 1GLAG 4IJAA 4BRHA 2YJEA 1Z05A 3D2FA 2E2NA 2IVOA 1BU6O 3A5MC 1ESVA 4GNIA 4XH5A 4BG8A 3SK3A 2V51B 1ATSA 4WFBL 2HBJA 1BG3A 3M3ZA 2E88A 3ZYYX 1VQMN 4P77A 1TUUA 1MDUB 3QDKA 4BGBA 5FPEA 4XEIA 2CH6A 1VQ5N 1S3XA 5AQVA 1G57A 3A5OC 3F9MA 4JKGA 4BRLA 1DKGD 3UKRB 4BRAA 2NRZA 2Q97A 2E1YA 4WYBA 3OBWA 3MWPA 1QQNA 4KH6A 1YAGA 5C12A 4FWQA 4CI6A 5AQTA 2OANA 3SAGA 5C0YA 3L4QA 5KQDA 4GV9A 1MA9B 1HRUA 4JK7A 1KAYA 3H07A 3A5NC 4CZMA 2Q36A 3DWLA 3SBGA 2A6AA 1IEZA 2HOEA 2OTLN 4H0OA 4A5AA 1HPMA 5KPRA 3RVCA 1BA0A 2D4WA 4BROA 4NB4A 3E66A 5MLCQ 4CBWA 3O9UA 2OTJN 3LM9A 2WBNA 3MWTA 5FPNA 5AZJA 3E9LA 3O4WA 4BG9A 4BRNA 4I6MA 4ILJA 4B1VA 4NLCA 1QZ5A 3K9KA 3MCAB 1XUPO 4HTLA 4BC4A 3WEEB 1YJWN 1E4GT 4CZFA 2ZF5O 5BRDA 2CH5A 3MX2A 3A0IX 3ZIIA 4IOXA 3VEYA 5EXWA 3H1VX 3VEXA 4P6PA 2CGKA 1LCUA 1OVYA 3G25A 4BR2A 3U8XA 4BY9C 1K8AO 2P9LA 4H5RA 2PFUA 4BQZA 1VQLN 2BH1A 1QHAA 1JCFA 3I56N 1MWKA 1X3MA 4FO0A 4WQ5C 5DM7L 4IJNA 3M1FA 3VEVA 1VQPN 5GAHP 2A42A 2F9WA 5DM6L 1XEZA 1NGIA 2P9BA 2HBKA 4H0TB 2QWPA 2BTFA 2P9SA 4A59A 3LM2A 1S72N 3O80A 1BOTO 4GY2B 3HOTA 1HKBA 4BR5A 1VQ4N 1KAXA 5AQRA 4EHUA 1O13A 3CERA 3QB0A 4JK8A 1IG8A 3L7VA 2P9KB 1ATRA 4WQ4A 3PIOL 2E1ZA 4M63C 5EX5A 4B1ZA 4WFNL 1V4TA 3Q7BA 2NNWA 3CCSN 3CJCA 1NJIO 3CJ7A 3MIOA 3O9SA 2NLXA 3AGKA 3WXIA 3O08A 1NWKA 3ZETA 3HOSA 3C7NB 4QS7A 3MN6A 2VWBA 2CGLA 5BN8A 3O9QA 5BREA 2QWLA 3EE9A 2NRVA 3VF4A 3FR0A 1U2VA 5AZIB 3UKUB 5AQKA 4WQ4C 4E1JA 3SAFA 3CPEA 1HJOA 3FZHA 3BF1A 2KLAA 3UE5A 5ADXH 3QBWA 4P8EA 1GLBG 4BR0A 2PAVA 1Q7YO 1NGAA 3CMAN 5HL7L 2QWRA 3CETA 1YUWA 3C65A 3CPWM 3HTVA 4B1WB 5BR9A 2JWKA 2Q31A 3TSQA 4JK9A 3IKMA 5AQYA 1M1KO 3EN9A 4IOAL 4L3QA 1BWFO 3VEZA 4JKDA 3P04A 3I55N 3GG4A 3VGLA 1K4OA 4BR4A 4OO1J 4C1NI 3VENA 3CCLN 2RE2A 4BRMA 2ZJQL 2QWNA 2P9PA 5JVGL 3MK5A 3K9JA 5M1FA 3WUHA 1Q18A 1K4LA 5FPDA 3ZEUB 2V7ZA 5TKWA 3FFKB 5EVZA 4JHDB 4JNEA 3H1QA 3SJHA 3ULEB 1GLJO 4BC5A 3AAPA 3LDQA 4RTFD 3CXCM 3DXKB 4IFEA 1ILYA 4YDUA 4DQ8A 4FVUA 4EO0A 2BUPA 1TKSA 3AJEA 1TYQB 3WXMB 5GIOA 5M1OA 3CF5L 2RIUA 1NGDA 1K9MO 1RDWX 4BC3A 5H1SQ 1VQNN 3O1WA 4AM6A 4CZJA 1YF5L 4B9QA 1GLCG 4BRFA 4DCHA 3PIPL 1Q81O 4YDUC 3MGZA 2PBDA 4BRGA 3TTCA 4JKCA 2HF4A 5AQPA 3VESA 2A3ZA 2YX6A 5EOYA 2FSKA 3C6HA 3Q7CA 3SMSA 1YVNA 4RCHA 5JLHA 3ZX2A 2EQAA 3PLAA 5F1XA 5AQGA 3G4SN 3MCPA 2D0PA 4BRKA 2ZJRL 3QICA 3L4IA 4YORA 4CD3A 5C15A 3E1YA 3CD6N 4FBWA 1Q86O 4JKFA 3CCQN 2HBMA 5C10A 1VQ8N 3KZBA 5AQZA 4HVZA 4FWOA 3P4IA 2FSJA 4A57A 3QBXA 4G9ZA 4H0PA 3MX5A 1N8RO 3ZETB 2FXUA 3H3NO 4B1UB 4C23A 4EIAA 1QVFM 1IJJA 3D2EB 5AQNA 1T3VA 3LDOA 4JAXA 3KVGA 5KQ8A 3D6RA 3RSEA 3VTIA 4CBXA 4MLEA 3ZX3A 4U67L 5JMVA 3SMPA 1YJ9N 3P39A 3BF3A 2YCHA 4JD2B 3T1IA 1HUXA 5AFUH 1K7JA 2RISA 2F7TA 3O1BA 4WQ5A 4MDBA 4QS8A 3CCJN 3G6EN 3ZIHA 3FZMA 2ZGYA 1KQSM 3MN7A 4KH4A 3OW2M 1QQMA 1D4XA 4PL7A 1YJNN 1VQON 3CC7N 4K41A 1C0GA 4CZEA 2E2QA 3A8YA 5B8HA 1LOTB 2A41A 1BA1A 3DXMA 1J6ZA 1BUPA 3ENBA 3IUCA 4ISGA 1X9JA 3TSPA 1JCGA 4A5BA 4CZIA 3NVMA 4EFHA 2P9NA 3KK7A 3DAWA 3R6MA 4MLHA 1W97L 3ATVA 4NZTM 1QQOA 4OPHA 2I7PA 5LY3A 3F5TA 3EO3A 1YI2N 3BUZB 3W0LA 4HWIA 1T6CA 4YOVA 4FWLA 3CMEN 2KHOA 4FOEA 2IVPA 4A62A 4BR9A 3T69A 3HBTA 3VMFB 4BREA 1K8KB 2NRTA 3CI5A 5M1KA 4GV6A 2P9UB 1SQKA 4JEPA 2NZTA 5M1QA 3O9TA 2YHWA 3D2FB 5ADXA 3OA9A 5JVHL 2VGNA 4FPAA 1XC3A 4PHTX 3NMUA 4A61A 5HOOA 3HRGA 3EE8A 3ENOA 3VEOA 1NGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTD A;  3VEZ A;  3VES A;  3VTH A;  3VF2 A;  3TSP A;  3TTF A;  3VTI A;  3VER A;  3VET A;  3VEX A;  3TSU A;  3VEW A;  3VF4 A;  3TSQ A;  3VEN A;  3VEO A;  3TTC A; 
#chains in the Genus database with same CATH topology
 1LAW A;  1KLM A;  3BEX A;  3JS6 A;  3SUP A;  2VWJ A;  3VF2 A;  5M1N A;  1JL1 A;  1M90 O;  1EO1 A;  1HQU A;  3VGM A;  3OHR A;  4CJ5 A;  5KGW A;  1IKX A;  3ZIG A;  2P9I A;  1OKJ A;  1TK8 A;  2BDP A;  5E41 A;  3IAL A;  1H0X A;  1RBT A;  2FC0 A;  1UWB A;  3ZT1 A;  1XHX A;  4B9M A;  3OJS A;  1QVG M;  5C24 A;  3S3N A;  1TUY A;  3ID8 A;  3ZIE A;  4FJG A;  2QW9 A;  3RMD A;  4F3O A;  5AZJ B;  5AQO A;  5CZ1 A;  4DV4 K;  2HBL A;  4DTN A;  2QWM A;  4DTM A;  3WEE A;  4JRQ A;  3SZ2 A;  1NGH A;  4H5N A;  3QEV A;  3CFO A;  1IV0 A;  2X78 A;  3D45 A;  2VQE K;  4IZ9 A;  4MFB A;  2HMP A;  2V52 B;  3KK3 A;  2P9L B;  4ZHR A;  4PA1 A;  2H3G X;  3MXM A;  1VQ7 N;  3AAQ A;  4OPK A;  3B8A X;  4DS4 A;  1HNI A;  2IGI A;  2XY7 A;  4FSV A;  2DPN A;  1G58 A;  2DTU A;  3O9R A;  2G8V A;  1SS6 A;  3QNO A;  1U6Z A;  1R59 O;  4CF0 A;  4OLB A;  4NXN K;  4AQY K;  1KD1 O;  4RWT A;  4IDH A;  3G71 N;  2D1K A;  4NZR M;  3QFP A;  5CE3 A;  1S1T A;  1VSM A;  4LFB K;  4QCL A;  1NGC A;  2UYT A;  2UXD K;  3SV4 A;  5AJ3 K;  1N6Q A;  1JCE A;  2J4R A;  2RPI A;  1YT3 A;  3UKU A;  3O3H A;  4FJL A;  3QNN A;  2KQ2 A;  2GWJ A;  5F0X A;  4M3Z A;  3LVJ C;  1GLL O;  3S9H A;  1IKY A;  1NKB A;  5FPM A;  4B8A B;  2QI2 A;  4NO7 A;  1ZC6 A;  1K73 O;  5AQX A;  4H4O A;  4PKG A;  1LWF A;  4TSX A;  2VG5 A;  3AAR A;  4I7F A;  3O5B A;  3A2F A;  4CJK A;  5C2D A;  3VOV A;  4XH1 A;  4AF1 A;  5KTQ A;  4F2R A;  4NCX A;  4CGJ A;  4DUY K;  3LVK B;  4J2B A;  3WQU A;  2KKZ A;  3WT0 A;  1Z25 A;  2ZGZ A;  1JJ2 M;  3R1X A;  2G8H A;  1WSF A;  4CJ7 A;  3I8D A;  4HD0 A;  4JHD A;  3SBT A;  3L3V A;  3P1G A;  4E7L A;  3LS6 A;  3K5N A;  4DR5 K;  3THY A;  1P90 A;  4ID5 A;  3ALY A;  4CHY A;  1HNX K;  2ZD1 A;  4JI8 K;  1JLF A;  3AA3 A;  3ZT2 A;  4JI3 K;  5I9E B;  4LF6 K;  2WC9 A;  1KFD A;  3ENH A;  3HT3 A;  3SJJ A;  4H0X B;  4Y1C A;  4KB1 A;  3SLC A;  4BGA A;  5AQU A;  4DSI A;  5F2R A;  4FL9 A;  2YNG A;  3WNE A;  2ASO A;  4JN4 A;  4IEE A;  3FZF A;  3CHW A;  3PX4 A;  3RTV A;  4H03 B;  5GIP A;  4Y1D A;  4JI2 K;  4CEE A;  1NLV A;  1RGI A;  1SZ2 A;  5J2M A;  1NBW A;  2FF6 A;  1RIL A;  1ZYQ A;  4IWV A;  2HHW A;  5C2F A;  4DTP A;  1IKW A;  5AQJ A;  3T7Z A;  2HHT A;  5BRH A;  2YKN A;  1YIT N;  5JS1 A;  4CIG A;  3P31 A;  3OJU A;  3IDH A;  3MXJ A;  3E9P A;  4CJL A;  2UU9 K;  3BP8 A;  3DSC A;  1U4B A;  4ILH A;  4DKW A;  4CJP A;  1V4S A;  4JYA K;  3MK6 A;  3HVR A;  4ISF A;  1C0F A;  2FLO A;  3NGY A;  3SUN A;  4DF4 A;  2A2Y A;  5IWA K;  4B3R K;  1W2B M;  1QTM A;  1A5V A;  1WUA A;  1KK9 A;  4CJV A;  4B1X B;  4JS4 A;  5ELZ A;  3MDQ A;  3LZJ A;  3F9K A;  1KAZ A;  1K8K A;  4W5O A;  1Z05 A;  4XH5 A;  2IVO A;  3DMJ A;  1ATS A;  1L5U A;  1BG3 A;  1N34 K;  4B9S A;  2E88 A;  4CED A;  1TUU A;  4EP4 A;  5FPE A;  2CH6 A;  1VQ5 N;  5AQV A;  2G8U A;  1T05 A;  1RT5 A;  1DKG D;  4BRA A;  1N33 K;  3OYJ A;  1NJ1 A;  1W7A A;  1QQN A;  4O0J A;  1YAG A;  2BKY X;  5C0Y A;  2OAN A;  2YV0 X;  3SAG A;  1H4S A;  1HRU A;  3A5N C;  3J7A P;  1TKD A;  2Q36 A;  3TR8 A;  4DTU A;  1IEZ A;  4A5A A;  4CK1 A;  1BA0 A;  1SL0 A;  3FFI A;  3LM9 A;  5FPN A;  2AJQ A;  1Z26 A;  5AZJ A;  1LW2 A;  4V19 S;  3K9K A;  3MCA B;  1YJW N;  2ZF5 O;  2CH5 A;  3ZII A;  3CG7 A;  5EXW A;  5CY4 A;  1BCM A;  1OVY A;  3G25 A;  3TAM A;  4CJU A;  2P9L A;  1U45 A;  2ZQB A;  1QHA A;  3M8S A;  4GMJ B;  3G10 A;  1WB9 A;  1MWK A;  1X3M A;  4FO0 A;  1NKC A;  4CEC A;  5HRR A;  1Y97 A;  1W9H A;  2HNY A;  4A59 A;  1VSD A;  4DSL A;  1VQ4 N;  3HZ7 A;  4BR5 A;  4CJ4 A;  1KAX A;  1S1W A;  3S3M A;  1YTU A;  1S9G A;  2P9K B;  1T7P A;  4AHT A;  3CCS N;  1V4T A;  3Q7B A;  1C0M A;  3MEG A;  1X9S A;  1HNV A;  3ZET A;  3C7N B;  3MN6 A;  4CES A;  1JKH A;  2D5R A;  5BRE A;  2QWL A;  3FR0 A;  3OYI A;  5AQK A;  4WQ4 C;  4E1N A;  4LSL A;  4JLH A;  4RW7 A;  4CHQ A;  1W0H A;  3CMA N;  1FXX A;  4DU3 A;  1YUW A;  4AIL C;  1UDV A;  3CPW M;  5BR9 A;  2Q31 A;  4JK9 A;  1VSL A;  2QK9 A;  4IOA L;  1DTQ A;  1BWF O;  4L3Q A;  4DV7 K;  4JKD A;  3P04 A;  3GG4 A;  4CGD A;  3VEN A;  4F8R A;  3MK5 A;  1RDA A;  1Q18 A;  4R5P A;  3TAR A;  5EVZ A;  2XRI A;  1BQM A;  3M8R A;  1ILY A;  4YDU A;  4DQ8 A;  1WSG A;  1TYQ B;  3WNG A;  1TL1 A;  1SL2 A;  3CF5 L;  2RIU A;  4N47 A;  4BE2 A;  1K9M O;  2HNZ A;  3AO3 A;  2A3Z A;  3V1O A;  4ICL A;  2FSK A;  3Q7C A;  3THW B;  2IDO A;  2WTU A;  2Z1J A;  4EZ9 A;  4FJ7 A;  4BRK A;  2ZJR L;  3L4I A;  5C15 A;  4JKF A;  3O3F A;  3CCQ N;  2HBM A;  1VQ8 N;  1IBL K;  3L8B A;  1HYS A;  4FZZ A;  4O5B A;  4G9Z A;  3WBM A;  4KTW A;  4DR3 K;  3C6U A;  1NMN A;  5SWM A;  4CK3 A;  1TKZ A;  2FXU A;  4B1U B;  4C23 A;  3F73 A;  3UIQ A;  1IJJ A;  3K5O A;  1S1X A;  1HNW K;  1NH9 A;  3U3Y A;  4K87 A;  3T1I A;  2O8C B;  3V1Q A;  1DCJ A;  1D8Y A;  4B3O A;  3HYF A;  3CCJ N;  1B9D A;  1KQS M;  3MN7 A;  4DMN A;  1QQM A;  1D4X A;  4F3T A;  1NK6 A;  1VQO N;  1VSE A;  1ASW A;  2DY4 A;  4LF7 K;  1BA1 A;  4BRD A;  4IG0 A;  1WN7 A;  4EFH A;  1RTJ A;  4BE0 A;  2EK0 A;  3R6M A;  3ZT3 A;  3ATV A;  4NZT M;  3TAE A;  5LY3 A;  4Z4I A;  2YNF A;  4DQR A;  4FWL A;  2ATQ A;  2DFF A;  5FLX O;  2F4V K;  2KHO A;  4FOE A;  2Z7C A;  3CI5 A;  4GV6 A;  1SQK A;  1FKO A;  3ZSV A;  2YHW A;  3D2F B;  4NCA A;  5FRM A;  5ADX A;  1A5X A;  5JVH L;  4DTS A;  1NOY A;  1EX4 A;  4FPA A;  3LP1 A;  5CYQ A;  4PHT X;  2H9U A;  4A61 A;  1VSK A;  3LZI A;  3ENO A;  3HI0 A;  2YNH A;  3DOL A;  3JXU A;  2GWK A;  2HW3 A;  4BR7 A;  5AQS A;  3DLG A;  1JCU A;  1K4P A;  1KVB A;  3HVT A;  4M7X A;  3CM5 A;  2OPS A;  2JGU A;  4HCB A;  3ZT0 A;  1VR4 A;  2E2O A;  3OYG A;  4FJK A;  1LAV A;  4RG8 A;  2RHK A;  4KRE A;  2ITM A;  4J2E A;  3SV3 A;  3N4Q A;  3RRH A;  1L3T A;  4EHT A;  3L2W A;  3J8A A;  3D7E O;  4DG1 A;  1GLD G;  2QA4 N;  1NK4 A;  4KBO A;  5J1E A;  3VTH A;  1IKV A;  3SQ2 A;  2HHS A;  4LY7 A;  4CEA A;  1KXP A;  1C1A A;  2ZWH A;  1KVA A;  4N56 A;  3MAQ A;  3CFP A;  2E2P A;  3DOK A;  2IOC A;  3GOI A;  3H3O B;  5AQM A;  2P9N B;  3U6F A;  2HST A;  3O4N A;  1NFJ A;  3KLG A;  3CJ1 A;  4CFC A;  5BR8 K;  3THV A;  2P9S B;  4CZH A;  3KTQ A;  4KHS A;  5AQH A;  4FJX A;  3CC2 N;  1CZB A;  1RDB A;  1MWM A;  4K42 A;  5LJV A;  4LC9 B;  4CZG A;  2P9K A;  2LN3 A;  3NF7 A;  3RRG A;  3GDQ A;  4RW6 A;  4DWI A;  5BPM A;  4O55 A;  3O8M A;  5AQF A;  3C7N A;  2OA8 A;  2IIR A;  1CXQ A;  2UUA K;  4BVP A;  3TSU A;  5T7B A;  4FBQ A;  3PUF A;  3OYB A;  4AHU A;  3C6A A;  3P5J A;  4RW8 A;  2HHU A;  1RDD A;  3CJ9 A;  2WUS A;  1HKC A;  3W3D A;  5JIC A;  3VER A;  4DR6 K;  2QWQ A;  4N5S A;  3VQQ A;  3CCU N;  2X6S A;  1J54 A;  4FBK A;  4CF2 A;  2OCE A;  1XMQ K;  1RBR A;  4PL8 A;  3VPZ A;  4E3S A;  2QM1 A;  1VQK N;  4B9V A;  1O1W A;  4LH4 A;  3CFR A;  2GTD A;  2KZZ A;  3WQT A;  3IFR A;  5KGX A;  3AA2 A;  1TIG A;  1TYQ A;  3WXK A;  2L8Y A;  3SAH A;  2GUP A;  4GV3 A;  3SQ0 A;  4CEF A;  3ULD A;  4CJQ A;  3M8Q A;  1SKW A;  3OYE A;  5FDL A;  3IAB B;  2GV9 A;  2VGM A;  2ASP A;  4KFB A;  4ZTF A;  3THW A;  2JLE A;  3CM6 A;  1NK8 A;  3EKS A;  2ASM A;  4YNQ A;  2XY5 A;  3PX0 A;  2A5X A;  5FRN A;  2BE2 A;  2W40 A;  4BRC A;  3U4L A;  2XY8 A;  4DTO A;  3EL2 A;  2HMI A;  4YOW A;  3NGZ A;  3IS9 A;  4YOX A;  1CXU A;  3HL8 A;  1YXQ A;  4FCX A;  1JLG A;  4CEZ A;  1KC8 O;  2NRX A;  4M7Y A;  4IG3 A;  4YDQ A;  4BAC A;  3RSE B;  3V9Z A;  3DLK A;  4I14 A;  4CVN E;  5J2P A;  3RWU A;  3C0B A;  4KH5 A;  2O8C A;  4YOT A;  1T6D A;  1VK0 A;  4CJF A;  2Q2R A;  5KPZ A;  5HLF A;  3NH2 A;  4DB3 A;  4DR7 K;  3L6Q A;  4KTZ A;  1NM1 A;  4G1Q A;  4FZY A;  3PSI A;  4PKI A;  3OYL A;  3WXL A;  4CER A;  1NJ6 A;  1TL3 A;  2GX9 A;  3R8E A;  3O6W A;  3BGR A;  4K8Z A;  4W5T A;  4WI1 A;  1K49 A;  5GIN A;  4F9O A;  3DXM B;  3H45 C;  3OS0 A;  2VCP A;  1HC7 A;  1H4T A;  1JXE A;  3CJA A;  1VRU A;  3HO1 A;  1D9F A;  1VSF A;  4R79 A;  4KHW A;  1H0Y A;  1KTQ A;  2YJF A;  3C6T A;  1NJZ A;  4O5F A;  4JKA A;  2PZS A;  1BO5 O;  3AGR A;  4YKE A;  1GLA G;  1RDC A;  2EQA A;  2YJE A;  3D2F A;  1L3S A;  1BU6 O;  1ESV A;  2V51 B;  4WFB L;  2G8I A;  1C1B A;  1WSH A;  4P77 A;  1XHZ A;  4BGB A;  3LDS A;  4DUZ K;  4XEI A;  4CHP A;  3JYT A;  4E0D A;  2E1Y A;  4HUF A;  1SV5 A;  3AVB A;  3MWP A;  4KH6 A;  1DTT A;  4KHY A;  5DMR A;  4DFM A;  3AO1 A;  2LSN A;  4GV9 A;  1MA9 B;  1KAY A;  1C0T A;  3AVH A;  4CZM A;  1RT6 A;  3HPH A;  4JRP A;  4CEB A;  4FM2 A;  2I5J A;  1H4Q A;  4EZ6 A;  1SUQ A;  3DSD A;  4CBW A;  3O9U A;  4KO0 A;  2OTJ N;  3MWT A;  4IBN A;  4Z9E A;  3O4W A;  4ILJ A;  4NLC A;  2Y1I A;  5BRD A;  3ZCM A;  1UA0 A;  3VEX A;  3A0I X;  3EY1 A;  1LCU A;  4CJE A;  4FW2 A;  2IFE A;  1K8A O;  3AVA A;  4CW7 B;  3I56 N;  4ZTJ A;  5EU7 A;  4WQ5 C;  4IJN A;  2G8K A;  1VQP N;  2Q3S A;  2A42 A;  2F9W A;  5DM6 L;  2HBK A;  4H0T B;  2QWP A;  2BTF A;  2P9S A;  2BAN A;  1BOT O;  4GY2 B;  4KHN A;  2GTC A;  3BZK A;  3HPO A;  4EHU A;  3NHG A;  1MU2 A;  3VQB A;  3SCX A;  3PIO L;  1IG9 A;  3EYZ A;  4JI0 K;  5EX5 A;  4E19 A;  4WFN L;  1NJI O;  1JLA A;  2P5G A;  1ITG A;  3SPY A;  3AGK A;  1TKT A;  2VWB A;  4B9L A;  2EHG A;  4DV5 K;  3O9Q A;  3ZSQ A;  3EE9 A;  2NRV A;  5AZI B;  3OS2 A;  1NKE A;  1WSJ A;  3ISN C;  1HJO A;  3FZH A;  3BF1 A;  2KLA A;  3DLB A;  2RKI A;  4BR0 A;  4X62 K;  5LMU K;  1NJW A;  2OYQ A;  1U48 A;  5HL7 L;  2QWR A;  1Y9X A;  4CJS A;  4DR1 K;  2ETJ A;  3TSQ A;  2DFH A;  3NH0 A;  2OZM A;  4CEQ A;  4Z4C A;  1Q9X A;  4KB0 A;  3VGL A;  4OO1 J;  2ZJQ L;  4FLX A;  3K9J A;  5M1F A;  3WUH A;  3TWH A;  1K4L A;  3ULE B;  3SJH A;  4BC5 A;  3AAP A;  4OKJ A;  4KI4 A;  3ZSY A;  1GOB A;  2IS3 A;  4FVU A;  4CK2 A;  3WXM B;  4CEO A;  5J2N A;  1Q9Y A;  1HR0 K;  1U04 A;  4CIE A;  1RDW X;  2HND A;  4DSE A;  3O1W A;  1NJ5 A;  3PIP L;  4YDU C;  3IAB A;  1S9E A;  3TTC A;  2PBD A;  4BRG A;  2HF4 A;  3AO5 A;  5AQP A;  5JS2 A;  4JI5 K;  2YX6 A;  4OGC A;  1LW0 A;  3NF9 A;  4RCH A;  5JLH A;  1TK0 A;  1A5W A;  1WSE A;  4M3U A;  2F96 A;  5HRN A;  3MCP A;  1TK5 A;  4OKK A;  3HXM A;  3QIC A;  4DV6 K;  4FBW A;  1Q86 O;  5C42 A;  1S1U A;  4LF4 K;  3QIO A;  1OH5 A;  4FWO A;  5K14 A;  3VN5 A;  3P4I A;  1X9W A;  2X6N A;  2UXB K;  2FSJ A;  4A57 A;  3QBX A;  3K59 A;  3ZSO A;  3T1Y K;  1QVF M;  1PAV A;  3LDO A;  3HST B;  4JI7 K;  3RSE A;  3KJV A;  4CBX A;  2VG7 A;  3BF3 A;  2YCH A;  4JD2 B;  1HUX A;  5AFU H;  2QKB A;  1NJY A;  4LF9 K;  4WQ5 A;  5KRT A;  2VQF K;  3AVM A;  1BGX T;  3V1R A;  3VA3 A;  4CZE A;  3VQ4 A;  4IFV A;  1SKS A;  2A41 A;  3DXM A;  1LWC A;  2VG6 A;  1BUP A;  4B3M K;  3QES A;  1X9J A;  3TSP A;  4A5B A;  4LFA K;  1FKP A;  3DAW A;  4OPH A;  2I7P A;  2G8F A;  1YI2 N;  3VQ6 A;  3BUZ B;  1WAF A;  2UUB K;  4Z0U A;  1C1C A;  4BR9 A;  2XO7 A;  3HBT A;  3VMF B;  4BRE A;  3QEP A;  5M1Q A;  2OPQ A;  3OA9 A;  4DTJ A;  3NFA A;  4DR2 K;  2EH1 A;  5HOO A;  1C0U A;  4Q5V A;  1OH7 A;  4CF8 A;  1XQS C;  4A2B A;  3HK2 A;  3QEI A;  4AHS A;  3A5L C;  4HHT A;  5I42 A;  1REV A;  3NH1 A;  1GOA A;  1S5J A;  3HJF A;  4FLT A;  2XY6 A;  3LAL A;  4Z94 A;  3VGK A;  4UY8 O;  4ILG B;  1RDU A;  4P6D A;  4BVO A;  2QTD A;  1NG9 A;  3HZ6 A;  1K6Y A;  1HRH A;  4JI1 K;  4DQS A;  4ELU A;  3VQ9 A;  4LH5 A;  4OKE A;  5JLF A;  4IO8 A;  3SUQ A;  1LN4 A;  3CCE N;  1QZ6 A;  1WSI A;  3H46 O;  4FLZ A;  3LQU A;  4BRQ A;  4ELT A;  4GKK K;  4I6M B;  4BQL A;  4M45 A;  4PQU A;  3DI6 A;  4QAG A;  1G99 A;  5LL6 Z;  3MN5 A;  1Q82 O;  4DHY A;  1TAU A;  2Q3V A;  1TKU A;  4LF5 K;  2WOM A;  3L2R A;  3AVN A;  4YFU A;  3S41 A;  3QIN A;  5AR0 A;  4A2A A;  4IXC A;  1ASU A;  2MX1 A;  1XC9 A;  4M42 A;  4NYN A;  3CYM A;  1VQ6 N;  3TAG A;  4C8L A;  1OH8 A;  4WE1 A;  4JV5 K;  3L0Q A;  4MDA A;  4Y0W A;  3GBT A;  1QE1 A;  4Q15 A;  2WFB A;  4LF8 K;  2FBT A;  3ZLJ A;  4K25 A;  1OH6 A;  3KWI A;  4C8N A;  4HVC A;  2KFN A;  4YHH K;  3QET A;  5AZI A;  3QML A;  1QHT A;  1NGG A;  1OVQ A;  1WOQ A;  4CHZ A;  3LP0 A;  2NRR A;  5AQI A;  3U9D A;  1Z6R A;  1HMV A;  5A2Q O;  1SAZ A;  4MO4 A;  3ZX0 A;  4J8F A;  3LDN A;  4NCB A;  3I33 A;  4FWM A;  4CGF A;  3RR7 A;  5GAE P;  3ZT4 A;  1RT1 A;  4IOC L;  5KRS A;  1H1V A;  2P9I B;  5AQW A;  3LPT A;  4P8J A;  1ZXO A;  4KV8 A;  2X74 A;  2A1R A;  1HLU A;  2P9P B;  1S22 A;  5EY4 A;  4U7B A;  5HRP A;  1KCF A;  3HPG A;  1JDQ A;  4FWS A;  4H8K A;  3ULE A;  1RTD A;  1QSS A;  4KAZ A;  1JLB A;  2VWK A;  5AQL A;  4K43 A;  3LDL A;  4EP5 A;  2KZM A;  3CIP A;  1BIZ A;  4ELV A;  3L3U A;  3VQ8 A;  3LL3 A;  3CC4 N;  4CJ3 A;  1N36 K;  4CF1 A;  5BN9 A;  3KK2 A;  3IAY A;  2E8A A;  3OYK A;  3E9O A;  4CFB A;  1E4F T;  4C1N K;  3NCI A;  1NK5 A;  5BPN A;  5LJW A;  3M5R A;  3BDP A;  5HBM A;  1ZBS A;  4FOI A;  4M3W A;  4TWA A;  1SL1 A;  2FF3 B;  1UA1 A;  2O4I A;  2Q0U A;  3ATU A;  3R9P A;  1SNN A;  4NCG A;  1DT9 A;  1IH7 A;  4CBU A;  1TV6 A;  4JKB A;  4DSK A;  1L3U A;  4KHP K;  3UB5 A;  1PVW A;  3QFU A;  3FZL A;  4CGH A;  4CFD A;  1NMD A;  1N8R O;  3LDP A;  1JXB A;  3VEW A;  2D0C A;  3N4P A;  4J2A A;  4WCE L;  3TOE A;  1T44 A;  4CZL A;  4IEI A;  1J5E K;  1RFQ A;  3LAM A;  3J7Z O;  1DGK N;  5AQQ A;  4OVL A;  5CHI A;  5TKY A;  4IO9 L;  4Q0B A;  2O4G A;  4FWN A;  4QS9 A;  3IMX A;  4B8C A;  3TTD A;  4CF9 A;  2Z1H A;  2W6L A;  4JD2 A;  4AHR A;  2IVN A;  4I9Q A;  4H5T A;  4UQG A;  2ZJP L;  3AVG A;  4CE9 A;  1UOC A;  4ID1 A;  3V6D A;  3F2K A;  1VAZ A;  4B9N A;  3KLI A;  3LAK A;  4BWM A;  1E3M A;  4BDP A;  5GAD P;  4FM0 A;  1RT2 A;  1JE3 A;  4B3T K;  5E84 A;  2D0O A;  4BDZ A;  4K88 A;  4XIU A;  3WNH A;  2Z1I A;  3TTF A;  1EQY A;  3MN9 A;  4DTX A;  4DF8 A;  1NGJ A;  1NK7 A;  3VQ7 A;  3QER A;  3NVK A;  2HHQ A;  4OLF A;  3KKR A;  2HF3 A;  2W41 A;  4E1M A;  3KLE A;  3I8B A;  4JKH A;  3OYH A;  4IJA A;  2ZE2 A;  3PO5 A;  2E2N A;  4BG8 A;  3A5M C;  4E89 A;  4KTQ A;  2HBJ A;  3ZYY X;  1VQM N;  1QQC A;  2HB5 A;  1SKR A;  3QDK A;  3CQ8 A;  3NF6 A;  1G57 A;  1S3X A;  3A5O C;  3F9M A;  4RW9 A;  4BRL A;  4PWD A;  2HHV A;  3UKR B;  2NRZ A;  3DRP A;  1WAJ A;  1U47 A;  4WYB A;  1KSP A;  5C12 A;  5AQT A;  3AVC A;  3TAP A;  3L4Q A;  5KQD A;  1S8E A;  4JK7 A;  4OGE A;  3RMA A;  3SBG A;  2HOE A;  4W5R A;  3J7Y P;  1KRP A;  2O8E B;  1VRT A;  2XHB A;  3E66 A;  1VSI A;  3LWL A;  4DR4 K;  2B5J A;  2WBN A;  3E9L A;  5KI6 A;  2P5O A;  4BRN A;  3T3F A;  4I6M A;  4BC4 A;  1QZ5 A;  1XUP O;  4P6P A;  3H1V X;  2CGK A;  2HVH A;  3U8X A;  1VHX A;  3M8P A;  4BY9 C;  4H5R A;  4BQZ A;  1VQL N;  4PY5 A;  2BH1 A;  3V9W A;  2OPP A;  4GW6 A;  3K5M A;  2E6M A;  2Y1B A;  3M1F A;  3VEV A;  3B6O A;  5GAH P;  1YVU A;  1XEZ A;  1NK0 A;  1S72 N;  1JLQ A;  4DS5 A;  3O80 A;  4DFK A;  3HOT A;  1LV5 A;  5AQR A;  1O13 A;  3CER A;  4JK8 A;  4CJW A;  4DQI A;  1IBK K;  1HNZ K;  3U6Y A;  1ATR A;  3L7V A;  3NDK A;  2NNW A;  3MIO A;  3O9S A;  1LWE A;  1IBM K;  2NLX A;  4LD0 A;  3O08 A;  1NWK A;  3HOS A;  4QS7 A;  4DQQ A;  2CGL A;  1HQE A;  3L2V A;  2FBY A;  4E1J A;  3CPE A;  3THX B;  3KLH A;  4E7H A;  3LWM A;  4P8E A;  2IC3 A;  4FLV A;  2FBX A;  1RT7 A;  1Q7Y O;  3NF8 A;  4OPJ A;  2GBZ A;  3C65 A;  3HTV A;  4B1W B;  3OYN A;  2JWK A;  1M1K O;  3IKM A;  2W42 A;  3EN9 A;  4H4M A;  1RCH A;  3I55 N;  4FJJ A;  1K4O A;  1NJ2 A;  4BR4 A;  2RE2 A;  4GVM A;  3DYA A;  2P9P A;  5JVG L;  2HVI A;  3ZEU B;  1Y2I A;  3H1Q A;  1GLJ O;  3KKS A;  3LDQ A;  4RTF D;  3DXK B;  4IFE A;  2CRQ A;  1ZBU A;  1S6P A;  1EP4 A;  1CLQ A;  4CGI A;  5M1O A;  3TI0 A;  4Z4G A;  4RW4 A;  4BC3 A;  1VQN N;  4CZJ A;  4K0K K;  4B9Q A;  4DCH A;  1Q81 O;  4JKC A;  3VES A;  2YNI A;  3C6H A;  3C94 A;  3SMS A;  3PLA A;  5F1X A;  5AQG A;  4Z4H A;  3E1Y A;  4FLY A;  4FW1 A;  2M71 A;  1D9D A;  4M3T A;  3OVN A;  3KZB A;  5AQZ A;  3AV9 A;  4KHQ A;  3AA5 X;  4HTU A;  1VM0 A;  1WNS A;  3ZET B;  3H3N O;  3D2E B;  1T3V A;  3KVG A;  3VTI A;  3SMP A;  1YJ9 N;  3P39 A;  4DSF A;  3ZSX A;  3HP6 A;  5HP1 A;  5SZT A;  4DV3 K;  2PYL A;  5HRO A;  2F7T A;  4MDB A;  2B4J A;  1JLC A;  4PUO A;  3EZ5 A;  2YHA A;  1XI1 A;  3CC7 N;  4K41 A;  4W5N A;  1C0G A;  2E2Q A;  5B8H A;  1LOT B;  2B6A A;  4YOY A;  1J6Z A;  3ENB A;  3MED A;  4CZI A;  4O0I A;  1JCG A;  3AO4 A;  4IDK A;  5LMN K;  2P9N A;  3J81 O;  3KK7 A;  3PX6 A;  1W97 L;  1D5A A;  3F5T A;  3AO2 A;  3NBP A;  3W0L A;  4HWI A;  4O44 A;  4YOV A;  4FLW A;  4KPY A;  1NU0 A;  3MEE A;  2IVP A;  4A62 A;  3DM2 A;  3OYM A;  3ASM A;  2NRT A;  3RMB A;  1S6Q A;  4K8X A;  4DV1 K;  2P9U B;  4JEP A;  2NZT A;  3O9T A;  3V9X A;  4L8R B;  5J2Q A;  2VGN A;  3DLR A;  3QKB A;  1HYV A;  2BGG A;  4C8M A;  3HRG A;  3EE8 A;  3QO9 A;  3VEO A;  4DV0 K;  4JKG B;  4OJR A;  3UKR A;  2QWO A;  3CCM N;  4KI6 A;  1FJG K;  4DFP A;  5I3U A;  4AM7 A;  4BE1 A;  4FZX C;  2FSN A;  4FFJ A;  2Q0R A;  1RT3 A;  1VSH A;  1CZ9 A;  1ATN A;  1NGB A;  3K57 A;  3KD5 E;  2UXC K;  2QXF A;  4OPA A;  1P8Z A;  4AHV A;  3OTO K;  4DTR A;  2O8E A;  3OYC A;  5CYM A;  4GVE A;  4HUE A;  5DK5 A;  4EAH D;  2QEX N;  4ISE A;  2FBV A;  3DJC A;  4CZK A;  2F8T A;  1DEJ A;  4B08 A;  4Z4E A;  1NNE A;  2O8D B;  4FPB A;  3IRX A;  1BDG A;  3LRJ A;  3BZC A;  2F9T A;  3EZW A;  4FWP A;  2RF2 A;  3I0S A;  2NRH A;  4WFA L;  3D0P A;  1HPZ A;  1CZA N;  3DRR A;  3AY9 A;  4YOU A;  1BI4 B;  5CR4 A;  1KLN A;  3LP3 A;  1NFH A;  1KVC A;  4IFY A;  2HHH K;  4F2S A;  4PKH A;  2JWL A;  1WBD A;  1HX1 A;  1TKX A;  3K0S A;  2LXR A;  4M3X A;  3PY8 A;  3CQY A;  3KWG A;  1C6V A;  2KFZ A;  1EWR A;  3ZSR A;  1TGO A;  2QXL A;  3AA4 A;  3K58 A;  3OYA A;  3R3L A;  5AFU A;  3VQ5 A;  1U2V B;  5E26 A;  5KPT A;  2V7Y A;  3THX A;  3CQX A;  1K4I A;  1EET A;  3RR8 A;  4FXD A;  4X65 K;  4CJT A;  2YHY A;  4E1B A;  3SPZ A;  3VQC A;  3CCV N;  3HM8 A;  3SI6 A;  1VQ9 N;  2OPR A;  3U9Z A;  1EWQ A;  3JAM O;  4KHU A;  5BPL A;  1Y64 A;  4DLE A;  4GKJ K;  1RBV A;  1J9A A;  2Q1N A;  3ZSZ A;  2IAJ A;  2GEM A;  3IG1 A;  4DV2 K;  1B9F A;  4E7J A;  1XWL A;  3ZEU A;  3FZK A;  1JLE A;  1BIS A;  4C8K A;  3SYZ A;  3CJB A;  3VET A;  1JL2 A;  3DXK A;  4JKE A;  2KTQ A;  3EKU A;  1YHQ N;  4JS5 A;  4H0V B;  2NUB A;  3KIO A;  1TVR A;  1S1V A;  3SUO A;  4H5V A;  1ZBH A;  4F4K A;  4J2D A;  2E20 A;  3ID6 A;  3P38 A;  3TAQ A;  4B1Y B;  1GLE G;  3KHY A;  3M6G A;  3FGU A;  2A40 A;  2EWS A;  2CGJ A;  3VQA A;  4BRI A;  3I0R A;  2VYP A;  3V9S A;  4H0Y B;  3MXI A;  3FE1 A;  4FWK A;  3WNF A;  4NLB A;  4FJ5 A;  1XNR K;  4W5Q A;  3T1A A;  3FLC O;  4CD1 A;  4H5W A;  2YHX A;  1TAQ A;  3QEX A;  2WON A;  2YI1 A;  4O8K A;  2YKM A;  4HUG A;  1Q8I A;  5HRS A;  2I7N A;  1RNH A;  3G0Z A;  3GE1 A;  1X3N A;  3TU5 A;  4FWR A;  3D2E A;  3TPQ A;  3O4Q A;  1NGE A;  4BRP A;  3V81 A;  3LAN A;  5M1P A;  2NRW A;  1EXQ A;  4I2Q A;  3E01 A;  3DRS A;  3S3O A;  3GL1 A;  3RMC A;  3WXJ A;  4KKO A;  3OYD A;  4BC2 A;  1HKG A;  3HP9 A;  1RQ8 A;  3MMV A;  4FJ9 A;  3BY5 A;  4OLA A;  3VQP A;  2O8F B;  3VF6 A;  4OX9 K;  4M41 A;  4DQP A;  3TAB A;  4JI6 K;  1WLJ A;  2R7Y A;  1U49 A;  4N76 A;  4WF9 L;  2O8B B;  1XMO K;  2AP1 A;  4XH4 A;  3H6E A;  1BHL A;  4MO5 A;  4B3S K;  5GAG P;  1QSL A;  4N41 A;  3CCR N;  1FK9 A;  2D0A A;  4CIF A;  4O8U A;  5FRO A;  4FLU A;  1VSJ A;  1ZBF A;  1YIJ N;  2GUI A;  3VQE A;  4K86 A;  4E7I A;  4DU1 A;  3OBY A;  4KRF A;  1HJR A;  2AA4 A;  3PO4 A;  3HSC A;  2P9U A;  3DLL L;  4P6C A;  2GEL A;  4BRH A;  1GLF O;  4GNI A;  5BRF A;  3SK3 A;  2RN2 A;  3M3Z A;  3L2Q A;  4FJI A;  1MDU B;  1NJ8 A;  3EEQ A;  4FJH A;  3TAF A;  4CGG A;  3VA0 A;  4JKG A;  2KW4 A;  2P1J A;  2Q97 A;  1N5Y A;  3OBW A;  4BWJ A;  1N32 K;  4FWQ A;  4CI6 A;  3NGI A;  2Z1G A;  4JI4 K;  3H07 A;  3V4I A;  3AVL A;  2OZS A;  4AH9 A;  1ZBI A;  3DWL A;  2A6A A;  1BQN A;  2OTL N;  4H0O A;  1HPM A;  5KPR A;  3RVC A;  2D4W A;  4BRO A;  4NB4 A;  2PYJ A;  5MLC Q;  3T19 A;  3AVI A;  4Z4F A;  2O8D A;  4BG9 A;  3SQ1 A;  1PVY A;  4B1V A;  2W6K A;  4HTL A;  2Y1J A;  3WEE B;  1E4G T;  4CZF A;  1IO2 A;  4QOZ B;  3MX2 A;  3VEY A;  4IOX A;  1RT4 A;  4BR2 A;  3OY9 A;  4DFJ A;  2PFU A;  1JCF A;  3B6P A;  3MEC A;  5DM7 L;  4B9T A;  4FCY A;  3NAE A;  1ZBL A;  1BI4 A;  2ITG A;  1NGI A;  2DFE A;  2P9B A;  1NOZ A;  3LM2 A;  3DLH A;  1HKB A;  1RBS A;  2G8W A;  3OYF A;  3L2U A;  3TAN A;  3QB0 A;  1IG8 A;  3OS1 A;  4C8O A;  4WQ4 A;  4NXM K;  2E1Z A;  4M63 C;  4B1Z A;  3CJC A;  1YTA A;  3CJ7 A;  3QLH A;  1T03 A;  3KLF A;  4IKF A;  3WXI A;  3PV8 A;  5BN8 A;  1RTI A;  3VF4 A;  4FK0 A;  3UKU B;  1U2V A;  4O4G A;  3SAF A;  4NYF A;  1QSY A;  3UE5 A;  5ADX H;  3AVF A;  3QBW A;  3J80 O;  2A1S A;  3LP2 A;  1GLB G;  1JO0 A;  1DLO A;  3P83 D;  3PSF A;  2PAV A;  1NGA A;  1I39 A;  3CET A;  4M3Y A;  2UUC K;  2PY5 A;  5AQY A;  2EX3 A;  3JSM A;  5D3G A;  3VEZ A;  1ASV A;  2D0B A;  3U3G A;  1FW6 A;  3ZSW A;  4C1N I;  1GOC A;  3CCL N;  4BRM A;  1BCO A;  2QWN A;  3QIP A;  3ITH A;  5FPD A;  2V7Z A;  5TKW A;  3FFK B;  4JHD B;  4JNE A;  4FJ8 A;  3K2P A;  3CXC M;  2E4L A;  4EO0 A;  2BUP A;  1NK9 A;  1II7 A;  1J53 A;  1NJX A;  1J5O A;  4FJN A;  1TKS A;  3THY B;  3AJE A;  3K5L A;  5GIO A;  4AHC A;  1NGD A;  4YY3 K;  4FM1 A;  5H1S Q;  4AM6 A;  5C25 A;  1YF5 L;  4LSN A;  1XNQ K;  4BRF A;  1GLC G;  3SQ4 A;  2E5L K;  3MGZ A;  4HCC A;  3NE6 A;  3V9U A;  4CCH A;  5EOY A;  3DLE A;  2QKK A;  1HYZ A;  3H08 A;  3T1H K;  1YVN A;  3ZX2 A;  1T8E A;  4FYD A;  3G4S N;  5CZ2 A;  2D0P A;  2ZM6 K;  4YOR A;  4CD3 A;  3CD6 N;  4FK4 A;  4MQ3 A;  4DSJ A;  5C10 A;  1X9M A;  4E7K A;  3O3G A;  2P51 A;  4HVZ A;  1EKE A;  4H0P A;  3MX5 A;  4LFC K;  2F8S A;  4EIA A;  5AQN A;  1KFS A;  5KQ8 A;  4JAX A;  3D6R A;  3KD1 E;  4MLE A;  3ZX3 A;  4U67 L;  5JMV A;  4FK2 A;  3VQD A;  4DU4 A;  1RBU A;  3KK1 A;  4FVM A;  3HM9 A;  1I3A A;  2RIS A;  1K7J A;  1G15 A;  3O1B A;  2O8F A;  4QS8 A;  3G6E N;  3ZIH A;  3C95 A;  3FZM A;  4DLG A;  2ZGY A;  1BL3 A;  4KH4 A;  3OW2 M;  4PL7 A;  1YJN N;  4BDY A;  2O8B A;  5IT9 O;  1R0A A;  1QS4 A;  3A8Y A;  4CHN A;  4ISG A;  3IUC A;  3AVK A;  2HHX A;  3NVM A;  4I9L A;  4MLH A;  4HVJ A;  1QQO A;  4I2P A;  3EO3 A;  1UAX A;  1B92 A;  1T6C A;  4X64 K;  2E6L A;  3CME N;  4B9U A;  3SNN A;  3QEW A;  1F21 A;  1L3V A;  3T69 A;  5M1K A;  1K8K B;  3AVJ A;  4FJM A;  2YHB A;  3LPU A;  1I94 K;  1WBB A;  4CJR A;  1BIU A;  4CHO A;  1XC3 A;  4M3R A;  4X66 K;  3NMU A;  1RTH A;  1X1P A;  4CFA A;  1NGF A; 
#chains in the Genus database with same CATH homology
 3HI0 A;  3BEX A;  3JS6 A;  1XQS C;  3JXU A;  4JKG B;  3VF2 A;  2GWK A;  3UKR A;  4A2B A;  5M1N A;  4BR7 A;  1M90 O;  1EO1 A;  2QWO A;  3CCM N;  3VGM A;  3OHR A;  3A5L C;  5AQS A;  4AM7 A;  1JCU A;  1K4P A;  2FSN A;  4M7X A;  4FFJ A;  2Q0R A;  3ZIG A;  2P9I A;  1OKJ A;  4Z94 A;  3VGK A;  1NGB A;  1ATN A;  4UY8 O;  4ILG B;  1RDU A;  4P6D A;  4BVO A;  2QTD A;  4OPA A;  1P8Z A;  2E2O A;  3HZ6 A;  2RHK A;  2ITM A;  4GVE A;  1QVG M;  3N4Q A;  4EAH D;  5JLF A;  2QEX N;  4ISE A;  3DJC A;  4CZK A;  4EHT A;  1TUY A;  3ID8 A;  4IO8 A;  3J8A A;  3ZIE A;  3D7E O;  2QW9 A;  1DEJ A;  5AZJ B;  4FPB A;  5AQO A;  1QZ6 A;  3H46 O;  3CCE N;  3LQU A;  2HBL A;  4BRQ A;  1GLD G;  4I6M B;  2QWM A;  4BQL A;  1BDG A;  2QA4 N;  4KBO A;  3WEE A;  3LRJ A;  3VTH A;  1NGH A;  4H5N A;  2F9T A;  3EZW A;  1G99 A;  4FWP A;  4IZ9 A;  4YOY A;  2HMP A;  3MN5 A;  2V52 B;  1KXP A;  1Q82 O;  2P9L B;  2H3G X;  4DHY A;  1TKU A;  2ZWH A;  2NRH A;  4WFA L;  4P6C A;  1VQ7 N;  3AAQ A;  2E2P A;  1CZA N;  3B8A X;  4FSV A;  2DPN A;  3AY9 A;  3S41 A;  3GOI A;  3H3O B;  1G58 A;  5AQM A;  2P9N B;  3O9R A;  4YOU A;  5AR0 A;  2HST A;  4A2A A;  4IXC A;  5CR4 A;  1SS6 A;  3CJ1 A;  2MX1 A;  1U6Z A;  1R59 O;  2P9S B;  4CZH A;  1KD1 O;  5AQH A;  4RWT A;  4PKH A;  2JWL A;  4IDH A;  3G71 N;  1VQ6 N;  3CC2 N;  1HX1 A;  1MWM A;  4K42 A;  5LJV A;  2D1K A;  4NZR M;  3QFP A;  4LC9 B;  4CZG A;  3L0Q A;  2P9K A;  3CQY A;  4MDA A;  5CE3 A;  3KWG A;  2LN3 A;  4Y0W A;  3GDQ A;  1NGC A;  3GBT A;  5BPM A;  2UYT A;  2QXL A;  2WFB A;  3O8M A;  4K25 A;  5AQF A;  3C7N A;  3KWI A;  1JCE A;  3R3L A;  2IIR A;  2J4R A;  4BVP A;  5AFU A;  3UKU A;  5AZI A;  3TSU A;  3QML A;  1U2V B;  1NGG A;  5E26 A;  1WOQ A;  2GWJ A;  2V7Y A;  5F0X A;  4FBQ A;  3CQX A;  5KPT A;  1K4I A;  1GLL O;  2NRR A;  3C6A A;  5AQI A;  3U9D A;  1Z6R A;  5FPM A;  2QI2 A;  4NO7 A;  1SAZ A;  4MO4 A;  1ZC6 A;  3ZX0 A;  4J8F A;  3LDN A;  5AQX A;  2YHY A;  3I33 A;  4FWM A;  1K73 O;  3CJ9 A;  2WUS A;  4PKG A;  1HKC A;  5GAE P;  4E1B A;  3AAR A;  3W3D A;  4IOC L;  3CCV N;  3O5B A;  3VER A;  5JIC A;  5C2D A;  3HM8 A;  4XH1 A;  3VOV A;  4AF1 A;  1VQ9 N;  1H1V A;  2QWQ A;  2P9I B;  5AQW A;  3U9Z A;  3CCU N;  4P8J A;  4FBK A;  5BPL A;  1Y64 A;  1ZXO A;  4PL8 A;  3VPZ A;  3WQU A;  2KKZ A;  3WT0 A;  2QM1 A;  2ZGZ A;  2Q1N A;  1VQK N;  1JJ2 M;  3R1X A;  1HLU A;  2GEM A;  2P9P B;  1S22 A;  5EY4 A;  4CJ7 A;  4U7B A;  3ZEU A;  3FZK A;  3ULE A;  4FWS A;  4JHD A;  3SBT A;  5BRF A;  2GTD A;  3WQT A;  3CJB A;  3VET A;  3DXK A;  4JKE A;  5AQL A;  4K43 A;  3EKU A;  3LDL A;  3IFR A;  1YHQ N;  3CIP A;  3LS6 A;  4H0V B;  4H5V A;  3LL3 A;  1TYQ A;  1P90 A;  3CC4 N;  3WXK A;  2E20 A;  3ID6 A;  3P38 A;  5BN9 A;  4B1Y B;  1GLE G;  2E8A A;  3KHY A;  3SAH A;  3M6G A;  2GUP A;  3E9O A;  1E4F T;  3FGU A;  4C1N K;  4GV3 A;  2A40 A;  2EWS A;  2CGJ A;  5BPN A;  5LJW A;  3M5R A;  4BRI A;  1ZBS A;  2VGM A;  2VYP A;  4FOI A;  2ASP A;  4H0Y B;  3FE1 A;  5I9E B;  2FF3 B;  2WC9 A;  3ENH A;  2Q0U A;  3ATU A;  3EKS A;  2ASM A;  4FWK A;  3R9P A;  2A5X A;  4H0X B;  1SNN A;  3SLC A;  2W40 A;  4BGA A;  1DT9 A;  5AQU A;  4BRC A;  4CBU A;  4NLB A;  4JKB A;  3U4L A;  5F2R A;  3UB5 A;  1PVW A;  3FLC O;  4FL9 A;  4CD1 A;  3EL2 A;  3FZL A;  2YHX A;  3QFU A;  1NMD A;  2ASO A;  4H5W A;  4YOW A;  4JN4 A;  4IEE A;  3LDP A;  2YI1 A;  3VEW A;  4O8K A;  3N4P A;  4YOX A;  3FZF A;  4WCE L;  3CHW A;  2I7N A;  1T44 A;  3GE1 A;  4CZL A;  1YXQ A;  1X3N A;  4H03 B;  4IEI A;  1RFQ A;  3J7Z O;  4FCX A;  1DGK N;  3TU5 A;  5GIP A;  4FWR A;  3D2E A;  1KC8 O;  5AQQ A;  3TPQ A;  5CHI A;  1NGE A;  2NRX A;  4M7Y A;  4BRP A;  5M1P A;  5TKY A;  2NRW A;  3RSE B;  4IO9 L;  4FWN A;  1NLV A;  1RGI A;  4QS9 A;  3IMX A;  1SZ2 A;  1PVY A;  4I14 A;  3TTD A;  3GL1 A;  3WXJ A;  1NBW A;  2FF6 A;  4BC2 A;  3C0B A;  4JD2 A;  4KH5 A;  1HKG A;  4IWV A;  4YOT A;  1T6D A;  3MMV A;  2Q2R A;  5C2F A;  5AQJ A;  5KPZ A;  2IVN A;  3T7Z A;  4DB3 A;  3L6Q A;  4H5T A;  5BRH A;  2ZJP L;  1YIT N;  1NM1 A;  3P31 A;  3VF6 A;  3IDH A;  3E9P A;  4PKI A;  3WXL A;  4BRD A;  3BP8 A;  2GX9 A;  4ILH A;  4DKW A;  3R8E A;  4WF9 L;  3F2K A;  3O6W A;  1V4S A;  1VAZ A;  2AP1 A;  3MK6 A;  5GIN A;  1K49 A;  4ISF A;  1C0F A;  3H6E A;  3DXM B;  3H45 C;  4XH4 A;  4F9O A;  5GAD P;  5E84 A;  2D0O A;  2FLO A;  2VCP A;  4MO5 A;  3CJA A;  5GAG P;  4R79 A;  3CCR N;  1W2B M;  3MN9 A;  3TTF A;  1EQY A;  4O8U A;  1KK9 A;  1WUA A;  1YIJ N;  1NGJ A;  4B1X B;  2YJF A;  5ELZ A;  3NVK A;  3MDQ A;  3OBY A;  4O5F A;  2AA4 A;  1KAZ A;  1K8K A;  2HF3 A;  2W41 A;  4JKA A;  1BO5 O;  3AGR A;  3HSC A;  2P9U A;  3DLL L;  3I8B A;  2GEL A;  4YKE A;  4JKH A;  1GLF O;  1GLA G;  4IJA A;  4BRH A;  2YJE A;  1Z05 A;  3D2F A;  2E2N A;  2IVO A;  1BU6 O;  3A5M C;  1ESV A;  4GNI A;  4XH5 A;  4BG8 A;  3SK3 A;  2V51 B;  1ATS A;  4WFB L;  2HBJ A;  1BG3 A;  3M3Z A;  2E88 A;  3ZYY X;  1VQM N;  4P77 A;  1TUU A;  1MDU B;  3QDK A;  4BGB A;  5FPE A;  4XEI A;  2CH6 A;  1VQ5 N;  1S3X A;  5AQV A;  1G57 A;  3A5O C;  3F9M A;  4JKG A;  4BRL A;  1DKG D;  3UKR B;  4BRA A;  2NRZ A;  2Q97 A;  2E1Y A;  4WYB A;  3OBW A;  3MWP A;  1QQN A;  4KH6 A;  1YAG A;  5C12 A;  4FWQ A;  4CI6 A;  5AQT A;  2OAN A;  3SAG A;  5C0Y A;  3L4Q A;  5KQD A;  4GV9 A;  1MA9 B;  1HRU A;  4JK7 A;  1KAY A;  3H07 A;  3A5N C;  4CZM A;  2Q36 A;  3DWL A;  3SBG A;  2A6A A;  1IEZ A;  2HOE A;  2OTL N;  4H0O A;  4A5A A;  1HPM A;  5KPR A;  3RVC A;  1BA0 A;  2D4W A;  4BRO A;  4NB4 A;  3E66 A;  5MLC Q;  4CBW A;  3O9U A;  2OTJ N;  3LM9 A;  2WBN A;  3MWT A;  5FPN A;  5AZJ A;  3E9L A;  3O4W A;  4BG9 A;  4BRN A;  4I6M A;  4ILJ A;  4B1V A;  4NLC A;  1QZ5 A;  3K9K A;  3MCA B;  1XUP O;  4HTL A;  4BC4 A;  3WEE B;  1YJW N;  1E4G T;  4CZF A;  2ZF5 O;  5BRD A;  2CH5 A;  3MX2 A;  3A0I X;  3ZII A;  4IOX A;  3VEY A;  5EXW A;  3H1V X;  3VEX A;  4P6P A;  2CGK A;  1LCU A;  1OVY A;  3G25 A;  4BR2 A;  3U8X A;  4BY9 C;  1K8A O;  2P9L A;  4H5R A;  2PFU A;  4BQZ A;  1VQL N;  2BH1 A;  1QHA A;  1JCF A;  3I56 N;  1MWK A;  1X3M A;  4FO0 A;  4WQ5 C;  5DM7 L;  4IJN A;  3M1F A;  3VEV A;  1VQP N;  5GAH P;  2A42 A;  2F9W A;  5DM6 L;  1XEZ A;  1NGI A;  2P9B A;  2HBK A;  4H0T B;  2QWP A;  2BTF A;  2P9S A;  4A59 A;  3LM2 A;  1S72 N;  3O80 A;  1BOT O;  4GY2 B;  3HOT A;  1HKB A;  4BR5 A;  1VQ4 N;  1KAX A;  5AQR A;  4EHU A;  1O13 A;  3CER A;  3QB0 A;  4JK8 A;  1IG8 A;  3L7V A;  2P9K B;  1ATR A;  4WQ4 A;  3PIO L;  2E1Z A;  4M63 C;  5EX5 A;  4B1Z A;  4WFN L;  1V4T A;  3Q7B A;  2NNW A;  3CCS N;  3CJC A;  1NJI O;  3CJ7 A;  3MIO A;  3O9S A;  2NLX A;  3AGK A;  3WXI A;  3O08 A;  1NWK A;  3ZET A;  3HOS A;  3C7N B;  4QS7 A;  3MN6 A;  2VWB A;  2CGL A;  5BN8 A;  3O9Q A;  5BRE A;  2QWL A;  3EE9 A;  2NRV A;  3VF4 A;  3FR0 A;  1U2V A;  5AZI B;  3UKU B;  5AQK A;  4WQ4 C;  4E1J A;  3SAF A;  3CPE A;  1HJO A;  3FZH A;  3BF1 A;  2KLA A;  3UE5 A;  5ADX H;  3QBW A;  4P8E A;  1GLB G;  4BR0 A;  2PAV A;  1Q7Y O;  1NGA A;  3CMA N;  5HL7 L;  2QWR A;  3CET A;  1YUW A;  3C65 A;  3CPW M;  3HTV A;  4B1W B;  5BR9 A;  2JWK A;  2Q31 A;  3TSQ A;  4JK9 A;  3IKM A;  5AQY A;  1M1K O;  3EN9 A;  4IOA L;  4L3Q A;  1BWF O;  3VEZ A;  4JKD A;  3P04 A;  3I55 N;  3GG4 A;  3VGL A;  1K4O A;  4BR4 A;  4OO1 J;  4C1N I;  3VEN A;  3CCL N;  2RE2 A;  4BRM A;  2ZJQ L;  2QWN A;  2P9P A;  5JVG L;  3MK5 A;  3K9J A;  5M1F A;  3WUH A;  1Q18 A;  1K4L A;  5FPD A;  3ZEU B;  2V7Z A;  5TKW A;  3FFK B;  5EVZ A;  4JHD B;  4JNE A;  3H1Q A;  3SJH A;  3ULE B;  1GLJ O;  4BC5 A;  3AAP A;  3LDQ A;  4RTF D;  3CXC M;  3DXK B;  4IFE A;  1ILY A;  4YDU A;  4DQ8 A;  4FVU A;  4EO0 A;  2BUP A;  1TKS A;  3AJE A;  1TYQ B;  3WXM B;  5GIO A;  5M1O A;  3CF5 L;  2RIU A;  1NGD A;  1K9M O;  1RDW X;  4BC3 A;  5H1S Q;  1VQN N;  3O1W A;  4AM6 A;  4CZJ A;  1YF5 L;  4B9Q A;  1GLC G;  4BRF A;  4DCH A;  3PIP L;  1Q81 O;  4YDU C;  3MGZ A;  2PBD A;  4BRG A;  3TTC A;  4JKC A;  2HF4 A;  5AQP A;  3VES A;  2A3Z A;  2YX6 A;  5EOY A;  2FSK A;  3C6H A;  3Q7C A;  3SMS A;  1YVN A;  4RCH A;  5JLH A;  3ZX2 A;  2EQA A;  3PLA A;  5F1X A;  5AQG A;  3G4S N;  3MCP A;  2D0P A;  4BRK A;  2ZJR L;  3QIC A;  3L4I A;  4YOR A;  4CD3 A;  5C15 A;  3E1Y A;  3CD6 N;  4FBW A;  1Q86 O;  4JKF A;  3CCQ N;  2HBM A;  5C10 A;  1VQ8 N;  3KZB A;  5AQZ A;  4HVZ A;  4FWO A;  3P4I A;  2FSJ A;  4A57 A;  3QBX A;  4G9Z A;  4H0P A;  3MX5 A;  1N8R O;  3ZET B;  2FXU A;  3H3N O;  4B1U B;  4C23 A;  4EIA A;  1QVF M;  1IJJ A;  3D2E B;  5AQN A;  1T3V A;  3LDO A;  4JAX A;  3KVG A;  5KQ8 A;  3D6R A;  3RSE A;  3VTI A;  4CBX A;  4MLE A;  3ZX3 A;  4U67 L;  5JMV A;  3SMP A;  1YJ9 N;  3P39 A;  3BF3 A;  2YCH A;  4JD2 B;  3T1I A;  1HUX A;  5AFU H;  1K7J A;  2RIS A;  2F7T A;  3O1B A;  4WQ5 A;  4MDB A;  4QS8 A;  3CCJ N;  3G6E N;  3ZIH A;  3FZM A;  2ZGY A;  1KQS M;  3MN7 A;  4KH4 A;  3OW2 M;  1QQM A;  1D4X A;  4PL7 A;  1YJN N;  1VQO N;  3CC7 N;  4K41 A;  1C0G A;  4CZE A;  2E2Q A;  3A8Y A;  5B8H A;  1LOT B;  2A41 A;  1BA1 A;  3DXM A;  1J6Z A;  1BUP A;  3ENB A;  3IUC A;  4ISG A;  1X9J A;  3TSP A;  1JCG A;  4A5B A;  4CZI A;  3NVM A;  4EFH A;  2P9N A;  3KK7 A;  3DAW A;  3R6M A;  4MLH A;  1W97 L;  3ATV A;  4NZT M;  1QQO A;  4OPH A;  2I7P A;  5LY3 A;  3F5T A;  3EO3 A;  1YI2 N;  3BUZ B;  3W0L A;  4HWI A;  1T6C A;  4YOV A;  4FWL A;  3CME N;  2KHO A;  4FOE A;  2IVP A;  4A62 A;  4BR9 A;  3T69 A;  3HBT A;  3VMF B;  4BRE A;  1K8K B;  2NRT A;  3CI5 A;  5M1K A;  4GV6 A;  2P9U B;  1SQK A;  4JEP A;  2NZT A;  5M1Q A;  3O9T A;  2YHW A;  3D2F B;  5ADX A;  3OA9 A;  5JVH L;  2VGN A;  4FPA A;  1XC3 A;  4PHT X;  3NMU A;  4A61 A;  5HOO A;  3HRG A;  3EE8 A;  3ENO A;  3VEO A;  1NGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...