3TSQA

Crystal structure of e. coli hypf with atp and carbamoyl phosphate
Total Genus 209
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
209
sequence length
647
structure length
647
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 209
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3tsqA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3tsqA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3tsqA01
3VTIA 3VF2A 3VEWA 3TSPA 3VEZA 3VESA 3TSQA 3TTCA 3VEOA 3TTFA 3VERA 3VENA 3TSUA 3VETA 3TTDA 3VEXA 3VTHA 3VF4A
chains in the Genus database with same CATH superfamily
4H4OA 3SUOA 2Z1GA 3HZ7A 1TK0A 1U6ZA 4LSNA 4BG9A 1WAFA 2AP1A 2BH1A 4NCXA 3L3UA 1JCEA 3ZLJA 1J53A 2PY5A 4CD1A 3ENBA 3EKUA 4I6MA 1HRUA 4IBNA 1K49A 2UU9K 2D0CA 1P90A 3PV8A 4IZ9A 1A5XA 3NCIA 1JLAA 3L4QA 3IRXA 4CHQA 4M3UA 2P51A 4FPAA 3CIPA 4DTOA 5J2PA 3T1YK 4F4KA 3LDSA 3HM9A 3G6EN 4CK2A 1VAZA 2KFNA 1BQNA 3VTHA 3M8SA 3NF6A 4B3MK 2EX3A 3MDQA 1S5JA 1VQKN 1VHXA 4AQYK 3W3DA 5HRNA 1HYSA 3WNHA 4DR7K 1FK9A 1WAJA 1C6VA 2L8YA 4FZZA 3B6OA 1JLGA 1GLLO 2UYTA 3AAPA 4H03B 1NG9A 2DY4A 2LSNA 2ZF5O 4IXCA 3PSIA 4MQ3A 3SI6A 3KD1E 1VQ6N 4BRKA 1SS6A 4Z94A 4U7BA 4BRPA 4DB3A 4CHYA 5SWMA 4FM1A 4GVMA 4RW6A 3TANA 1F21A 4NB4A 5LJVA 4BR4A 1RT1A 3ZSRA 3A8YA 1MDUB 5BPMA 2HMPA 1NGAA 5C2FA 3EZ5A 4B9NA 1NJXA 3QESA 2E2PA 2JWKA 5DM7L 1NGGA 3ULEB 4CEZA 2CGLA 2ZM6K 1VSFA 5J2MA 3SQ4A 2D0PA 2B4JA 3AO5A 4A61A 4CIEA 3SJHA 4E7IA 1VQ4N 3PX6A 4FWMA 1C0GA 5FPMA 1HMVA 3CF5L 1VK0A 3QMLA 1OH6A 4NYNA 1CZAN 1YXQA 4XH5A 4B1UB 1JL1A 4LF5K 3AA3A 2A40A 4Q5VA 1ZBIA 1JCGA 3THVA 5HP1A 3SUNA 2CRQA 3IS9A 4EAHD 2HHHK 3V1OA 1NGEA 3TOEA 4P8EA 2A6AA 1H1VA 2VQEK 1HQUA 3CMAN 2DFFA 3DM2A 2HBMA 1BA1A 2RISA 3QERA 2R7YA 1GOCA 1EQYA 2NRVA 5SZTA 2QWQA 3LWLA 4ELUA 1BL3A 4H0TB 3QBWA 1BIZA 5AQWA 4I2QA 5DM6L 2E1YA 5I42A 4FWLA 4KO0A 5AQMA 4OPKA 3ZX0A 4B1VA 3RTVA 1BISA 2XY8A 3I0SA 2GWJA 1LW0A 3AGKA 4KTWA 1QVGM 4HCCA 1VQPN 1KD1O 3TTFA 2A42A 4C8KA 1HQEA 5FPDA 4YOYA 1W7AA 1RBVA 1DLOA 1LCUA 2ITMA 3HSTB 4ISFA 4WFAL 2QWMA 5FLXO 4LF8K 1UA1A 2D0BA 4OLFA 1NOYA 4W5RA 2QK9A 2NNWA 1SZ2A 1OVYA 4DTPA 1DTTA 3SLCA 4FBWA 4WCEL 1QS4A 1BI4B 2EHGA 2E1ZA 5KQDA 4KHUA 3FLCO 5I9EB 3FFKB 4JNEA 4DV7K 3U9ZA 1WSJA 3SUPA 2JLEA 4CJ7A 4CEFA 3O1WA 4JRQA 4KI6A 2KHOA 2VQFK 2FF6A 1XHZA 1TV6A 3J80O 4JKCA 1KVAA 1R59O 3VA3A 3HK2A 4NLBA 2P5OA 1WN7A 2V7YA 1QE1A 4M42A 2NRWA 3B6PA 4YDUC 3VQ9A 1K6YA 1S1UA 1EX4A 3IFRA 3WQTA 4C1NI 3HP9A 4J2AA 4QS7A 1TGOA 4Z4FA 3VMFB 5AFUA 3FZFA 4AILC 5HROA 3TSQA 1S9EA 3KLIA 4FFJA 4ILHA 3C95A 4I6MB 3P04A 2VGNA 3TAQA 4H4MA 3NH0A 3ZSQA 4CZIA 1TAQA 3K9JA 4OGCA 2XO7A 4RW4A 1JXEA 1OH7A 1HPMA 4KRFA 5AQLA 5CR4A 1JLBA 3PIOL 4P6CA 1LAVA 3GOIA 4CIGA 4G1QA 4FCYA 3SMPA 3KTQA 3UB5A 3QEPA 4IG3A 1O1WA 2QM1A 3VQ7A 2HHSA 2Q1NA 3MIOA 2CH5A 1TKUA 3QB0A 1T05A 3CQ8A 3CJBA 4FJ8A 3HSCA 2P9IA 4E3SA 4CI6A 3J7AP 3BEXA 1WSGA 2DFEA 1NJYA 3QFPA 3VEYA 4JRPA 3NH1A 5JVGL 4B3RK 4B9UA 1ZXOA 4N5SA 1XHXA 1ITGA 3OY9A 1KAZA 5AQSA 2VG7A 4JN4A 3VEXA 1BU6O 2ZJQL 2ZJPL 1E4GT 4FWRA 1VSIA 1FKOA 3FZLA 3DLLL 3QBXA 4LFCK 4CZFA 3DOKA 2E8AA 3NGZA 3QINA 2BTFA 1RTHA 2D0OA 3FZMA 1PVYA 1S72N 4JI2K 3CFOA 1MU2A 5HRSA 1YF5L 1QSSA 3SQ0A 4C8MA 5BR8K 1NJ6A 4XEIA 4CERA 4UY8O 4KBOA 4BRGA 1NM1A 2G8WA 4GKJK 1PVWA 4B8AB 3HYFA 3A5MC 1KTQA 1SKWA 5M1NA 4GW6A 5EX5A 1FJGK 2P9KA 1WSHA 4DU3A 5CYMA 4L3QA 4E1BA 3DLKA 2HBJA 3KKRA 5JMVA 4A5AA 4FWSA 4CBUA 2FBTA 1T3VA 2V7ZA 3MAQA 1K9MO 1X3MA 3VQCA 4IO8A 5AQHA 1GLFO 3G0ZA 4DQIA 3RRHA 1JCUA 3MEDA 2QWLA 1TIGA 1HKCA 5M1OA 1RT7A 4F3TA 3R3LA 4FLTA 2H3GX 5CYQA 4E1JA 1SV5A 1Z05A 1T03A 3E66A 3MXJA 4EP4A 3DRRA 3O80A 2B6AA 1OKJA 4J2BA 3AVCA 4JI1K 3O4QA 4FL9A 3KK3A 1TYQA 3C0BA 3K5NA 1GOBA 1JLFA 4HVJA 3V9UA 5AZJA 1EKEA 1M90O 2D1KA 3OJUA 1RT3A 4FZXC 1S1TA 1KRPA 2Z1JA 3CYMA 2A2YA 2EK0A 3FZHA 2BANA 4WQ5C 3TI0A 1LWFA 3CJ7A 1I3AA 3E9PA 4XH1A 5K14A 1W9HA 4JKEA 5FPEA 4RTFD 1RBUA 3L7VA 2JWLA 3ZSYA 4BROA 4CW7B 4DG1A 2IDOA 5KTQA 1IKVA 4IEEA 4PKGA 1RGIA 5LY3A 4FM2A 1UWBA 1X9WA 4LF9K 1ILYA 3F9KA 3DJCA 4H0XB 1HKGA 2FSJA 4CK3A 4DQPA 4FYDA 1X9MA 4B9TA 3I8DA 2Q97A 4RG8A 4CEDA 3NDKA 3THYA 4BWJA 3ZIEA 1Q9YA 3AVAA 3DWLA 3OS0A 2RF2A 4KI4A 1CXQA 5AQZA 3T1HK 3BDPA 3HOTA 1P8ZA 4M63C 1QTMA 1JXBA 2OPPA 3MEEA 5M1PA 4AHSA 2G8KA 4B1XB 3C94A 3DYAA 4A62A 4CJUA 3HZ6A 3M8PA 5JICA 4DV4K 4I2PA 3ZT3A 4YOXA 1XMQK 3TAGA 4JK8A 2IS3A 2DTUA 2X74A 1CLQA 2HMIA 4H5RA 3GL1A 2W6KA 3OW2M 3WBMA 3ZCMA 3O3FA 4DQSA 1KSPA 1LV5A 4KH4A 4R79A 4NYFA 1NGCA 4QOZB 1NGJA 2W40A 5KPZA 4E7HA 4JI3K 4MDBA 4X66K 3TR8A 4F2RA 1NWKA 3SBTA 3NMUA 3H45C 4FSVA 5IWAK 2PAVA 1HNWK 4FWOA 4CZGA 3SQ2A 5JLFA 1YT3A 3OYKA 3TAEA 3HTVA 1IBMK 3J81O 2ASPA 3CJCA 4I14A 2P9IB 4K87A 3V1RA 3A5OC 4DV2K 1NJ2A 2I7PA 4BC5A 3EY1A 1OVQA 4OVLA 1U48A 3O9TA 4FOIA 4JLHA 3DI6A 3GG4A 1XMOK 5GAGP 1K4PA 4IO9L 4NZRM 3KLGA 3VEVA 3EL2A 4CECA 3HM8A 5EU7A 2O8DA 4KHPK 1C0TA 4M3ZA 4BG8A 1U2VA 2UUCK 3ENOA 2QWNA 1N33K 2IVOA 4Y1DA 1LOTB 3SZ2A 1VQ9N 3KZBA 3LP2A 3KVGA 2X78A 2ZD1A 1GLBG 1RDCA 4M3YA 1SKRA 2ZGZA 4CEEA 1N6QA 3PLAA 3L2RA 1VR4A 1IV0A 1K4OA 5C10A 3V81A 1TVRA 4DTNA 3DLEA 4H5NA 4JKFA 2ZGYA 4FJ5A 3MK5A 4OO1J 5FROA 3O6WA 2P9KB 1RDWX 5KPRA 2E4LA 2ITGA 2KZMA 4CJLA 1RBRA 3TU5A 3GDQA 4PA1A 4FLYA 3RWUA 1C0MA 4JKBA 3S3MA 2XY5A 2Z1IA 1J9AA 5EOYA 3IAYA 4LH4A 3JSMA 1FKPA 4CGHA 4X62K 2QI2A 2VWKA 4E7KA 2YHYA 4XIUA 2WOMA 3OYAA 1B9DA 1VRTA 2YHXA 4DTMA 3SAGA 2G8HA 3P31A 3QFUA 4DFMA 4N47A 5D3GA 1KQSM 4PKHA 3V9ZA 4DHYA 4J8FA 3CQXA 4KPYA 5EVZA 3AVGA 3P39A 4L8RB 4WQ4A 1TYQB 3RVCA 4DV6K 5C42A 5AZJB 3TPQA 4FJNA 4KAZA 2GBZA 3RMBA 3MXMA 1VSMA 5FRNA 4DUYK 3ZSZA 3VGMA 1YITN 3KK7A 4FJLA 4DFPA 3HRGA 5ADXA 4E0DA 4JAXA 3O08A 3U3YA 4EHUA 3VENA 1NFHA 3MN5A 1KFDA 3ZETA 2WFBA 3ALYA 3CI5A 4CZMA 1QQNA 2FBXA 3TTCA 3WT0A 1BHLA 2HHUA 2ASMA 2YHBA 3R8EA 3P1GA 1BCOA 4EP5A 2YNIA 5AQPA 5J2QA 4W5TA 4FLVA 3LDPA 4DU1A 3THYB 3LL3A 3H6EA 4PKIA 5C12A 1ZBSA 4FPBA 2P1JA 1H4SA 3SQ1A 2OZSA 2NRTA 4I7FA 5AQOA 5B8HA 4HTUA 1PAVA 2IVNA 4MO5A 3LP3A 1NJ5A 2PYLA 3R1XA 4DSEA 5C25A 4K41A 1GLAG 4BDYA 1YAGA 2M71A 3ZT2A 1IBLK 3HOSA 3I8BA 1TUUA 4XH4A 2E5LK 3UKUB 2GTDA 1QHTA 2GEMA 1S6QA 4C8LA 4KFBA 4OPHA 2G8VA 3O3HA 1K8AO 3OYHA 3AO2A 3OTOK 2D0AA 2ZE2A 3U3GA 1W0HA 3K5OA 4ELVA 2X6SA 2ZJRL 4CF8A 3VA0A 3LVKB 2KLAA 2A5XA 3FZKA 3AA2A 3UKRA 3M3ZA 5JS2A 1W97L 3K2PA 1NU0A 5LJWA 1RILA 4I9LA 5HOOA 3OVNA 4MO4A 1XI1A 1S3XA 2PYJA 4BC2A 3M8RA 4DR2K 1EWRA 1D4XA 3HPOA 3EE8A 4RW9A 4IDHA 4FWQA 4IFVA 5CZ1A 4BRHA 4CHNA 4GVEA 3NVKA 4CHPA 3G71N 1BWFO 3WNFA 4E1NA 1BG3A 3C7NA 1XEZA 3MGZA 2O8DB 2HF3A 3JYTA 2IVPA 4C1NK 3QIOA 2PFUA 1U2VB 4CJTA 3O8MA 4BGAA 4H8KA 4NCGA 3I56N 3DAWA 5AQVA 4GNIA 3DRSA 3LAMA 2HNZA 2FXUA 3LANA 2NRZA 3P4IA 4JK9A 1T7PA 4KHYA 2E2QA 4BY9C 2D5RA 4DCHA 5AQNA 4BDPA 2WONA 1ZBHA 4Q0BA 3ATVA 2HNYA 1M1KO 2KZZA 1K7JA 4DTUA 3VETA 3ULDA 4HVZA 3LP0A 1YTAA 1G99A 4CJFA 4AHVA 4N41A 3CQYA 4E1MA 2Q3SA 4YDUA 4DSFA 3D2FA 5AQXA 3HXMA 1KC8O 2FLOA 3AY9A 4KHNA 2OA8A 4C23A 3UIQA 1KFSA 1HUXA 3S3OA 3L2UA 3VF4A 2P9PA 3VQ6A 2H9UA 3ENHA 4JI6K 3VOVA 3ZT1A 3K5LA 4ISEA 4P8JA 1S1XA 4BDZA 4FXDA 3CXCM 1NGHA 3OS1A 1XQSC 2O8BA 1NLVA 4FBQA 3K9KA 4AHTA 4YOTA 1DKGD 3V9SA 3KWGA 3ID6A 3V1QA 1UDVA 2G8IA 3KWIA 1H4QA 3TAFA 5TKWA 3BY5A 2QWOA 3FGUA 4CE9A 3HPGA 5E41A 4DSLA 1NMNA 3ZSOA 1JLCA 1RT6A 1TAUA 1ESVA 3ZETB 4GV9A 1HNXK 3JXUA 4IFYA 4JI5K 1BO5O 3MX2A 4BWMA 2Q36A 3LDLA 2YHWA 4KTZA 3V9XA 3U6FA 3CC2N 4BE1A 1X9SA 1DT9A 2BDPA 3CETA 2QXLA 4DMNA 1J54A 2J4RA 3GBTA 4OJRA 4WF9L 3V4IA 1TL3A 1ZBUA 3VQAA 3GE1A 1IJJA 1NBWA 3VQQA 1YVNA 3AV9A 2E2NA 4BC4A 3LM2A 4JI8K 3ID8A 5KQ8A 3KHYA 3NF7A 3CERA 4CJWA 1D9DA 1WSFA 2HB5A 2YHAA 1DGKN 5J2NA 3PUFA 1HNVA 3OYLA 1A5WA 1HX1A 3EE9A 1NOZA 1GLJO 5BN8A 1LN4A 3O3GA 1NGBA 2BKYX 4UQGA 1IKYA 2Q2RA 4LF7K 3C6AA 5EY4A 5BRFA 1NGIA 3G25A 4IDKA 4C8OA 3IMXA 4AHCA 3N4PA 3H07A 4Z9EA 2IAJA 4JKGA 4W5QA 2FBVA 1IKXA 3VGKA 3UKRB 3G4SN 3VEZA 3LALA 5BN9A 5F0XA 3L2QA 2YX6A 2HF4A 1SL0A 3NGIA 4FJGA 4BE2A 4PY5A 5AFUH 4CEOA 1JDQA 3AVFA 4FLXA 3EEQA 3NE6A 3UE5A 3N4QA 4KKOA 1VQLN 1SAZA 4DU4A 2FF3B 3DLRA 4BE0A 1T6DA 4O4GA 4F2SA 4O44A 1J5OA 3MEGA 4HUFA 4ID1A 3C7NB 1VQNN 3IABA 2GELA 3IDHA 4DTJA 3SPYA 3F73A 3MWTA 2O8CB 1UAXA 3D45A 3L3VA 1S1WA 3D2EA 2E2OA 1NKCA 3QEWA 4FOEA 3MECA 3NVMA 3QKBA 4HWIA 2O4GA 4E89A 3O9QA 3AGRA 1YTUA 4CESA 4KV8A 1NKBA 3T69A 3EN9A 4DV0K 3VQ4A 1QZ6A 1I94K 3R6MA 4JKAA 1N36K 1K4LA 3THWB 2EWSA 2YJEA 4MLEA 5C24A 2IIRA 4FK2A 4QS9A 4NCAA 1JL2A 5CY4A 3AO3A 1QVFM 1N32K 1HRHA 4FWNA 4BR2A 4GV6A 1KAYA 4YKEA 4DR5K 5KGWA 3ZSWA 4ZTJA 4CFCA 2A3ZA 4CZLA 4Z4IA 2VCPA 3CHWA 3D2FB 4OLAA 3AARA 3VQEA 5M1KA 3WNEA 2Y1IA 1WSEA 1YJNN 3K58A 4TWAA 3LDNA 2LN3A 1Y9XA 3OYJA 1TKTA 4Q15A 3NBPA 3ASMA 3SNNA 1VQMN 4FWKA 2Q0UA 1MWKA 1T6CA 4JKDA 3NAEA 2P9PB 4KHQA 1SQKA 3VQ5A 2OTLN 3RR8A 4HUGA 5CE3A 4FZYA 2FSNA 4FO0A 1HYZA 3HI0A 5C0YA 4DUZK 4CD3A 3SYZA 2O8BB 4RCHA 2NLXA 3F5TA 3LRJA 1IO2A 1II7A 1K8KA 1BOTO 3PO5A 3KIOA 4Z4HA 3SMSA 3MN7A 4HUEA 4IEIA 1UOCA 3SPZA 3HO1A 3CJ1A 3TAPA 4AM6A 1QQOA 4CVNE 3ZIGA 3CCEN 4KTQA 1VSJA 3CCVN 1SL1A 4B9LA 3IALA 2PBDA 3MK6A 3VN5A 5DMRA 3OYBA 3RRGA 4CZHA 1WB9A 1GLDG 3NFAA 3KLHA 1JCFA 3H46O 4U67L 5MLCQ 4CJEA 4IG0A 1VQ7N 1KLMA 2UUAK 1VSDA 4Z0UA 2XRIA 3A0IX 3ISNC 3LVJC 1K73O 4CGIA 5T7BA 3DLHA 1TKSA 1VSEA 3TWHA 3H08A 3CM6A 3KLFA 4K42A 4NCBA 3O5BA 4DV1K 1HNIA 1TK5A 1EWQA 1RNHA 4E7LA 4FJXA 5GAHP 2RHKA 3AVHA 1X3NA 1NK4A 3UKUA 4LSLA 2GTCA 4JI0K 1DCJA 4OPAA 3T19A 3E01A 4EHTA 2VG5A 3CM5A 5AQQA 1LWCA 5J1EA 1H0XA 1B9FA 3W0LA 3F9MA 1SL2A 5C15A 4X64K 4CF1A 5H1SQ 1QQMA 1HKBA 2ASOA 3LZJA 4BRAA 1VSKA 4O0JA 5JLHA 4BVOA 4DF4A 3I0RA 3M5RA 3VF6A 3NHGA 3PSFA 4K43A 2E6LA 4CJ5A 1VM0A 4BR7A 2QTDA 3BZKA 3QEVA 1U49A 3VQPA 4JKGB 4O55A 1BCMA 4DQRA 3T1IA 4ELTA 3LM9A 2OPSA 1G58A 4CGFA 1S6PA 2KW4A 3DRPA 4H0PA 1XNRK 4EO0A 4DV3K 1NJ1A 2HHWA 1CZBA 4B8CA 4EZ9A 1L3TA 3DLGA 3O9RA 4PWDA 2MX1A 3P38A 1YIJN 2NRXA 2B5JA 4BRQA 3CCJN 2KKZA 3HBTA 2UXBK 2Q0RA 3IABB 5GAEP 3WXJA 4K25A 4IJAA 4CK1A 4CF9A 4M7XA 2W42A 4ZHRA 3D2EB 4H5VA 5BRHA 4Z4EA 1BA0A 1NGDA 5BRDA 1Q81O 4LH5A 4FW1A 1C1AA 3ZEUA 4ILJA 3HJFA 4NLCA 2EQAA 4FBKA 2WC9A 3PO4A 3SCXA 4CHOA 5AQYA 1Y97A 4FLUA 2XY6A 3BF3A 3CC4N 4A57A 5LL6Z 5CHIA 1VQ5N 3VF2A 1NGFA 4CZEA 3AVBA 2HHQA 2DPNA 2QWPA 3AO1A 1RT4A 1NJ8A 3ZIHA 4FLWA 3IKMA 4BRNA 3QNNA 4OKKA 3KJVA 1RBSA 4F3OA 2YCHA 4OGEA 1GLCG 1UA0A 2V51B 4Y0WA 3C6TA 5FRMA 2F7TA 3IUCA 1VQ8N 3SJJA 1ZBFA 3CG7A 3KK2A 1C1CA 4YOVA 2YKNA 4MFBA 4DTRA 3DXMA 3FR0A 1I39A 4A2BA 2O8FB 3PY8A 1KLNA 3WQUA 3O4NA 1ASUA 2QKKA 3DLBA 4AHRA 4J2DA 3EYZA 1J6ZA 4DLEA 3VTIA 1S9GA 1NNEA 1NK6A 3OHRA 4B1YB 4OLBA 1TKZA 1NJZA 4CJPA 3VQDA 1JE3A 1OH5A 3M1FA 2G8UA 4FJHA 2I5JA 2ZWHA 1D9FA 1K8KB 5AQJA 4DR1K 3VQ8A 1R0AA 3QO9A 4O8KA 4DQQA 1TL1A 1HC7A 3AVLA 1KXPA 2YNGA 4O5FA 4DLGA 4OX9K 4DWIA 2F96A 4BR5A 4E7JA 4Y1CA 4CF0A 4B9SA 1QHAA 3THXB 1V4TA 4CJQA 1NK0A 3Q7BA 4PL8A 4CJKA 1ATNA 1NJWA 4BRMA 3K57A 2A1SA 3ZT0A 4BRIA 4YFUA 3L2WA 2OZMA 2NZTA 1H0YA 3U6YA 3NH2A 2IC3A 4BQZA 2OANA 5JVHL 1T8EA 4YDQA 3AVMA 4M3RA 3A5NC 4CJ3A 2CH6A 5A2QO 4CJSA 4FWPA 5AJ3K 1QSLA 2ETJA 2VWJA 4CEAA 4C8NA 2ATQA 4JHDA 3WUHA 3BGRA 3ITHA 4FJIA 1IG9A 2YJFA 3OYNA 1Q86O 5ADXH 1WLJA 4M45A 1SNNA 1QZ5A 4F8RA 1VRUA 1HPZA 4OPJA 3O4WA 4KH5A 4EFHA 3MWPA 1HR0K 2P9LA 4BRFA 2UXCK 4JK7A 5F2RA 3AAQA 2OPRA 2O4IA 4WQ4C 4CJVA 5CZ2A 1KK9A 1WBDA 4DR3K 4AH9A 3DXKA 1B92A 4DSKA 2NRRA 3TSPA 2HW3A 5KGXA 2BUPA 3S41A 3CFPA 1QSYA 3CPEA 3R9PA 4LF4K 3ZX2A 2VG6A 2OYQA 1NFJA 4H5WA 5BR9A 3QICA 5M1QA 4EZ6A 1DTQA 3MXIA 3VGLA 4WI1A 5I3UA 1Q82O 4FJMA 2W6LA 3ZSXA 4AF1A 4DR6K 4M3WA 4N56A 3Q7CA 2QA4N 4W5OA 3VEOA 4R5PA 1H4TA 2O8CA 4FK0A 4CFDA 4ISGA 1KVBA 5AR0A 1RFQA 4B9VA 4DFKA 3AVNA 1LAWA 3MN6A 4IOXA 1U4BA 3O9UA 3OYMA 4IFEA 3JAMO 4CFAA 4NXNK 4YHHK 4JI4K 2WUSA 2CGJA 2HSTA 2P5GA 1NKEA 1D5AA 4DSIA 3L4IA 2RE2A 2F9TA 2V52B 3K59A 3FFIA 2RIUA 1RT2A 1Z25A 3THWA 3ZEUB 4OKEA 4YOWA 5AQGA 4V19S 1ZYQA 3OBYA 5KRSA 2HVIA 3I55N 2F8SA 2GWKA 4YORA 2OCEA 3OS2A 4HTLA 3ZSVA 3OYIA 4FJJA 2Q3VA 1HNZK 1RTIA 5GIPA 1G57A 4FW2A 3PX4A 2HHVA 3LAKA 3DSDA 1JO0A 1JJ2M 1XUPO 1C0FA 3LWMA 1N5YA 2XHBA 3CCRN 3DXMB 2P9NA 5KPTA 4CFBA 4NXMK 3LP1A 4LF6K 3M8QA 4I9QA 5E84A 4E19A 3VEWA 1G15A 4P6PA 1OH8A 4NO7A 4DS5A 3HVTA 3E1YA 1BIUA 1T44A 1EO1A 1E4FT 1IEZA 1EP4A 4WYBA 5AQKA 1XC3A 3EKSA 3O9SA 3OYFA 3C6HA 4LD0A 1O13A 5GADP 4DTXA 3RSEA 4PUOA 5C2DA 3BP8A 3M6GA 3O1BA 4YY3K 3FE1A 3I33A 4K0KK 4HVCA 4H5TA 4PHTX 4IJNA 3CMEN 1GOAA 2P9SB 1C0UA 3A5LC 2X6NA 1SKSA 4BRLA 4B08A 3OYEA 3PX0A 1Y2IA 1NK8A 4FM0A 1Q9XA 3J8AA 3CCLN 4M7YA 1XNQK 2P9BA 3RMAA 3MMVA 4DQ8A 4BC3A 1A5VA 2RPIA 1S1VA 5ELZA 4FCXA 4QCLA 3OYCA 5AQFA 4TSXA 4HHTA 1NMDA 4JHDB 5DK5A 1TKDA 1WNSA 5AQIA 4BACA 3CCQN 4JEPA 1LW2A 1E3MA 4KB1A 1ASVA 2NRHA 4MLHA 1ZBLA 3NF9A 1C1BA 4LFAK 3H1QA 4KHSA 2HNDA 3QIPA 4BGBA 3L8BA 3C6UA 2BGGA 2P9LB 2W41A 4M3XA 3HL8A 5FPNA 2QW9A 1J5EK 3QEXA 3ZIIA 4B3OA 3TTDA 3S3NA 3VERA 4WFNL 1TK8A 2Y1BA 1QQCA 3SUQA 3DXKB 4FK4A 1FXXA 4K86A 4JKHA 3HVRA 3WEEA 4B1ZA 2CGKA 1L3UA 1CZ9A 4BRDA 4FJKA 1K4IA 3CJAA 3BF1A 3QNOA 1BQMA 1U45A 4BR0A 4K8ZA 1JLEA 3LDOA 1KVCA 4DR4K 3ZX3A 5KRTA 1S8EA 2Y1JA 4O5BA 1U47A 1RDUA 2P9UA 2O8EA 1RDDA 3EZWA 1D8YA 2JGUA 4BQLA 2QKBA 1WBBA 2GV9A 3TAMA 4WQ5A 2E88A 4P77A 2IOCA 4Z4GA 1N34K 4FJ7A 2G8FA 4P6DA 4K88A 2QWRA 4YNQA 1RTDA 3DOLA 4LC9B 3AJEA 4M41A 3DMJA 3MN9A 4HCBA 2EH1A 2YI1A 3T3FA 1BGXT 3U4LA 1HJRA 2WBNA 4CF2A 5M1FA 1Z6RA 3QETA 3D7EO 1S22A 1NK9A 4QS8A 4LFBK 4H0YB 3CD6N 1BUPA 1EXQA 4JD2A 1IG8A 5HRPA 4DS4A 3WXIA 3AA5X 3WXKA 4JS4A 5AZIA 2FBYA 2HBLA 4CBWA 2IGIA 2YKMA 4BREA 2O8FA 1YHQN 1L5UA 5HLFA 3U8XA 3OJSA 3HP6A 3TABA 1W2BM 4B9QA 3VPZA 3ZYYX 2P9NB 3HPHA 4IOAL 1XWLA 2HVHA 4CBXA 4PQUA 4CGDA 3V9WA 2A1RA 1NK5A 2YNHA 3P5JA 5TKYA 3KKSA 4JS5A 3KLEA 2AJQA 4FJ9A 4AM7A 2QXFA 4B1WB 2QEXN 1Q18A 3ZT4A 3K0SA 1KAXA 4DKWA 4BR9A 3SAFA 4X65K 2OTJN 1VSHA 4F9OA 2YNFA 1EETA 4JV5K 3THXA 3LQUA 3E9OA 1XC9A 3RSEB 1GLEG 2ZQBA 4CCHA 5JS1A 2IFEA 4CEQA 2YV0X 4MDAA 3K5MA 3QEIA 3BZCA 1ATSA 3LDQA 4GV3A 3JS6A 3WXLA 1RTJA 3MCAB 3RR7A 1Q7YO 5KI6A 2HHTA 4NZTM 4ILGB 2GUIA 4WE1A 4CGGA 4DTSA 1LWEA 2GX9A 5IT9O 1BDGA 2OPQA 4Z4CA 3LPUA 3TSUA 3CCSN 1YJWN 1CXUA 4W5NA 4KHWA 3DSCA 2VWBA 2LXRA 1REVA 3AVJA 4H0OA 3VQBA 4A59A 1VSLA 3L6QA 1MA9B 1Y64A 4B3SK 3RMDA 4CEBA 3QLHA 5GINA 1L3SA 3VESA 2RN2A 3QDKA 3V6DA 1NK7A 2XY7A 3WEEB 4ICLA 3CPWM 3MCPA 5LMUK 3NGYA 5AQTA 3SV3A 1HLUA 3LPTA 3C65A 3D0PA 3HT3A 4KH6A 4O0IA 4CIFA 2VYPA 1ZC6A 3H3NO 3MX5A 1YI2N 3PIPL 5LMNK 2FC0A 3LS6A 1X9JA 1FW6A 5F1XA 5HBMA 4WFBL 1L3VA 2P9UB 2O8EB 1JLQA 4GMJB 3CCMN 1MWMA 1V4SA 4IWVA 3H3OB 2E6MA 2F9WA 1NH9A 4DSJA 5EXWA 4DFJA 4ZTFA 4IKFA 2UXDK 3S9HA 4GKKK 1RDAA 3ULEA 3SV4A 1HYVA 2KQ2A 3KK1A 2HOEA 5HRRA 1N8RO 4CGJA 3AVIA 3LZIA 4B9MA 4CJRA 5GIOA 3SK3A 3AO4A 4O8UA 2WTUA 2AA4A 1RQ8A 3T7ZA 2PZSA 4DF8A 3A2FA 4CHZA 3WXMB 4A2AA 1YJ9N 2BE2A 4N76A 4K8XA 1WSIA 3P83D 2HBKA 4JD2B 2I7NA 5BREA 1RCHA 2KFZA 2F8TA 5AZIB 3WNGA 4G9ZA 4LY7A 1IH7A 1JKHA 3CJ9A 4CZJA 4RW8A 1IBKK 5FDLA 1RBTA 3RMCA 2UUBK 4JYAK 3BUZB 1WUAA 1WOQA 4EIAA 1Z26A 4RW7A 3B8AX 2FSKA 4FVMA 1YUWA 4H0VB 4PL7A 3CC7N 4RWTA 2VGMA 3ATUA 1VQON 3AA4A 4YOUA 4FVUA 2A41A 2DFHA 1U04A 3SAHA 2E20A 2D4WA 3J7YP 2F4VK 3OA9A 5AQUA 3SBGA 4KB0A 4B3TK 4M3TA 2Q31A 5BPLA 4GY2B 1HJOA 3H1VX 3TARA 3EO3A 2Z7CA 1TUYA 2KTQA 1SUQA 5BPNA 3IG1A 5E26A 3OYDA 3L0QA 3J7ZO 1Q8IA 3D6RA 2RKIA 4J2EA 4AHUA 4JI7K 1RT5A 2P9SA 4BRCA 5AQRA 3T1AA 4FLZA 4CZKA 2NUBA 1BI4A 5HL7L 1DEJA 1ATRA 4DV5K 3F2KA 4CJ4A 3L2VA 3AVKA 4IOCL 4KREA 2HHXA 3CCUN 1RDBA 3OYGA 3E9LA 4BVPA 4A5BA 1TKXA 1X1PA 2Z1HA 3CFRA 4QAGA 1YVUA 3NF8A 1KCFA 1IKWA 3KD5E 4OKJA 3G10A 2GUPA 3U9DA 3OBWA 1ASWA 4ID5A 1NJIO 4HD0A
chains in the Genus database with same CATH topology
3T69A 3EN9A 1E4FT 1IEZA 2ASPA 4WYBA 1QZ6A 3CJCA 3R6MA 2P9IB 4JKAA 1XC3A 5AQKA 4I14A 1K4LA 2EWSA 3EKSA 1U6ZA 2YJEA 4MLEA 3A5OC 2IIRA 4BG9A 3O9SA 4QS9A 2I7PA 2AP1A 2BH1A 4BC5A 1QVFM 3O9TA 4FOIA 1JCEA 3GG4A 4CD1A 5GAGP 1K4PA 4IO9L 3C6HA 4FWNA 4NZRM 3ENBA 3EKUA 4BR2A 4GV6A 1O13A 4I6MA 1KAYA 4YKEA 3VEVA 3EL2A 5GADP 1HRUA 3HM8A 3RSEA 5C2DA 1K49A 2A3ZA 4CZLA 3BP8A 1P90A 2VCPA 3M6GA 3O1BA 3FE1A 4BG8A 1U2VA 3CHWA 3D2FB 3ENOA 2QWNA 3AARA 3I33A 4H5TA 4IZ9A 5M1KA 4PHTX 4IJNA 3CMEN 2P9SB 3A5LC 1YJNN 3L4QA 2IVOA 3LDNA 2LN3A 4FPAA 4BRLA 3CIPA 1LOTB 3G6EN 1VQMN 3J8AA 4FWKA 1VQ9N 3KZBA 2Q0UA 1MWKA 1VAZA 1T6CA 3KVGA 4M7YA 3CCLN 4JKDA 2P9PB 3VTHA 2P9BA 1SQKA 1GLBG 2OTLN 3MMVA 4DQ8A 4BC3A 5CE3A 2ZGZA 2FSNA 4FO0A 3MDQA 1VQKN 3HI0A 5C0YA 3PLAA 3W3DA 1K4OA 4CD3A 5ELZA 4RCHA 2NLXA 5C10A 4FCXA 3F5TA 3LRJA 4H5NA 5AQFA 4JKFA 2ZGYA 3MK5A 1K8KA 1BOTO 1NMDA 4JHDB 4OO1J 3O6WA 2P9KB 3SMSA 5AQIA 1GLLO 3MN7A 3CCQN 4JEPA 4IEIA 2UYTA 3AAPA 1RDWX 4H03B 3CJ1A 5KPRA 2ZF5O 4IXCA 1QQOA 4AM6A 3ZIGA 3CCEN 2NRHA 4MLHA 1VQ6N 3TU5A 3GDQA 4BRKA 3CCVN 1SS6A 4Z94A 3H1QA 4BRPA 4JKBA 4DB3A 4U7BA 2PBDA 5EOYA 3MK6A 4NB4A 5LJVA 4BGBA 2P9LB 2W41A 5FPNA 2QI2A 2QW9A 4BR4A 4CZHA 2YHYA 3A8YA 3ZIIA 1GLDG 1MDUB 3TTDA 5BPMA 1JCFA 2HMPA 3H46O 2YHXA 3VERA 1NGAA 4U67L 5C2FA 4WFNL 3DXKB 5MLCQ 3SAGA 4BC4A 3P31A 2E2PA 2JWKA 3QFUA 1NGGA 3ULEB 5DM7L 2CGLA 1KQSM 4JKHA 1VQ7N 4PKHA 3WEEA 4B1ZA 2CGKA 2D0PA 4DHYA 4J8FA 3A0IX 3CQXA 4A61A 3SJHA 1K73O 5EVZA 1VQ4N 3P39A 4WQ4A 1TYQB 3RVCA 1TKSA 4FWMA 4BRDA 1C0GA 5FPMA 5AZJB 3TPQA 3CF5L 4K42A 1K4IA 3CJAA 3BF1A 3QMLA 3O5BA 4BR0A 1CZAN 1YXQA 4XH5A 4B1UB 5GAHP 2RHKA 3LDOA 1X3NA 3UKUA 3ZX3A 3VGMA 1YITN 2A40A 3KK7A 1JCGA 4OPAA 3HRGA 4EAHD 5ADXA 1RDUA 1NGEA 4EHTA 4JAXA 5AQQA 2P9UA 2A6AA 3O08A 1H1VA 4P8EA 3CMAN 3W0LA 3F9MA 3EZWA 4EHUA 3VENA 2HBMA 5C15A 1BA1A 3MN5A 3ZETA 2RISA 2WFBA 4BQLA 5H1SQ 3CI5A 4CZMA 1EQYA 4WQ5A 1QQNA 2E88A 2NRVA 2QWQA 4P77A 3TTCA 3WT0A 1QQMA 1HKBA 2ASOA 2ASMA 4H0TB 3QBWA 4BRAA 3R8EA 5JLHA 4P6DA 4BVOA 3VF6A 2QWRA 3M5RA 5AQWA 5DM6L 4K43A 2E1YA 5AQPA 4LC9B 3LDPA 4BR7A 3AJEA 2QTDA 4FWLA 3LL3A 5AQMA 3ZX0A 3H6EA 4PKIA 4B1VA 5C12A 1ZBSA 4FPBA 4JKGB 3MN9A 2YI1A 3T1IA 2GWJA 2NRTA 5AQOA 3AGKA 3LM9A 5B8HA 1QVGM 1VQPN 2IVNA 3U4LA 1G58A 2WBNA 3TTFA 2A42A 5M1FA 1KD1O 1Z6RA 4MO5A 3D7EO 5FPDA 4YOYA 1S22A 3R1XA 4QS8A 4H0YB 4H0PA 1LCUA 2ITMA 3CD6N 1BUPA 4EO0A 4ISFA 4JD2A 4WFAL 2QWMA 1IG8A 3WXIA 4K41A 1GLAG 3WXKA 5AZIA 1YAGA 3O9RA 2MX1A 2NNWA 3P38A 1SZ2A 2NRXA 1OVYA 4BRQA 3HOSA 3CCJN 3I8BA 1YIJN 1TUUA 4XH4A 2HBLA 2KKZA 3UKUB 3SLCA 4FBWA 2GTDA 4CBWA 4WCEL 2GEMA 3HBTA 2Q0RA 4BREA 2E1ZA 4OPHA 5KQDA 3FLCO 5I9EB 3FFKB 4JNEA 5GAEP 1YHQN 3WXJA 1K8AO 3U9ZA 4K25A 3U8XA 4IJAA 4CJ7A 1W2BM 4M7XA 4B9QA 3O1WA 3D2EB 2ZJRL 2KHOA 3VPZA 2FF6A 4H5VA 5BRHA 1BA0A 1NGDA 5BRDA 4JKCA 3ZYYX 2P9NB 1Q81O 4IOAL 2KLAA 1R59O 4CBXA 2A5XA 3FZKA 4NLBA 2V7YA 3UKRA 3M3ZA 3ZEUA 4ILJA 2NRWA 4NLCA 4YDUC 4FBKA 2WC9A 2EQAA 3IFRA 3WQTA 1W97L 4C1NI 5AQYA 5LJWA 5TKYA 3BF3A 5HOOA 3CC4N 4QS7A 4A57A 5CHIA 4MO4A 1VQ5N 3VF2A 1NGFA 3VMFB 4CZEA 2DPNA 4AM7A 2QEXN 4B1WB 5AFUA 2QWPA 3FZFA 1Q18A 1S3XA 4BC2A 1KAXA 4DKWA 3ZIHA 3IKMA 4BRNA 4BR9A 3SAFA 1D4XA 2OTJN 3TSQA 3EE8A 4IDHA 4FWQA 4F9OA 2YCHA 4BRHA 1GLCG 2V51B 4GVEA 3NVKA 4FFJA 4ILHA 1BWFO 4Y0WA 3G71N 4I6MB 2F7TA 1BG3A 3LQUA 3E9OA 3IUCA 1VQ8N 3P04A 2VGNA 3C7NA 3RSEB 1XEZA 3MGZA 1GLEG 4CZIA 2HF3A 2IVPA 4C1NK 3K9JA 4YOVA 2PFUA 1U2VB 3O8MA 1HPMA 3DXMA 5AQLA 3FR0A 5CR4A 4BGAA 4A2BA 3I56N 3PIOL 4P6CA 3GOIA 4MDAA 3DAWA 5AQVA 4GNIA 3SMPA 3WQUA 1ATSA 3UB5A 3LDQA 4GV3A 3JS6A 2FXUA 3P4IA 2NRZA 3WXLA 2QM1A 4JK9A 3MIOA 2Q1NA 1J6ZA 3MCAB 2E2QA 3VTIA 4BY9C 1Q7YO 2CH5A 1TKUA 3QB0A 4DCHA 3OHRA 3CJBA 4B1YB 4NZTM 4ILGB 5AQNA 3HSCA 2P9IA 4CI6A 3BEXA 2GX9A 1BDGA 3M1FA 3QFPA 3ATVA 3VEYA 2ZWHA 5JVGL 1M1KO 1K8KB 1ZXOA 5AQJA 1K7JA 3VETA 3TSUA 4O8KA 4HVZA 3CCSN 1YJWN 1KAZA 1G99A 1KXPA 5AQSA 4O5FA 3CQYA 2VWBA 4JN4A 4YDUA 3D2FA 4BR5A 3VEXA 1BU6O 2ZJQL 4H0OA 2ZJPL 1E4GT 1QHAA 4FWRA 5AQXA 1V4TA 1KC8O 2FLOA 3AY9A 4A59A 3FZLA 3DLLL 3Q7BA 3QBXA 4PL8A 1ATNA 4CZFA 3L6QA 2E8AA 4BRMA 1MA9B 1Y64A 4C23A 2BTFA 2D0OA 4BRIA 3FZMA 1PVYA 1HUXA 1S72N 2NZTA 3VF4A 2P9PA 5GINA 1YF5L 4BQZA 3ENHA 3VESA 2OANA 3VOVA 5JVHL 3QDKA 4ISEA 4P8JA 3WEEB 4XEIA 3CXCM 1NGHA 3A5NC 1XQSC 2CH6A 4KBOA 4BRGA 3CPWM 1NM1A 4UY8O 3MCPA 1PVWA 1NLVA 4FBQA 3K9KA 4FWPA 3A5MC 1DKGD 4YOTA 3KWGA 5AQTA 5M1NA 1HLUA 3ID6A 3C65A 5EX5A 4JHDA 2P9KA 4KH6A 3WUHA 2YJFA 4L3QA 1Q86O 4E1BA 2HBJA 5ADXH 3KWIA 2VYPA 1ZC6A 3H3NO 3MX5A 5JMVA 3PIPL 1YI2N 3LS6A 4A5AA 4FWSA 1X9JA 5TKWA 1SNNA 4CBUA 2QWOA 3FGUA 1T3VA 1QZ5A 2V7ZA 5F1XA 4WFBL 2P9UB 3O4WA 1K9MO 1X3MA 4KH5A 4IO8A 5AQHA 1GLFO 3MWPA 4EFHA 2P9LA 3CCMN 4BRFA 1MWMA 1ESVA 4JK7A 3ZETB 5F2RA 1V4SA 4IWVA 4GV9A 3JXUA 3AAQA 1JCUA 2QWLA 3H3OB 1BO5O 4WQ4C 3MX2A 1KK9A 2F9WA 1HKCA 5EXWA 5M1OA 3DXKA 3R3LA 2H3GX 2NRRA 3ULEA 4E1JA 1Z05A 2Q36A 3E66A 2YHWA 3TSPA 3LDLA 3CC2N 3O80A 1OKJA 2BUPA 3S41A 2HOEA 3CPEA 1DT9A 1N8RO 4FL9A 3R9PA 3CETA 1TYQA 3C0BA 2QXLA 3ZX2A 5GIOA 5AZJA 2J4RA 3GBTA 4WF9L 4H5WA 5BR9A 1M90O 2D1KA 3QICA 3SK3A 5M1QA 3GE1A 4O8UA 2AA4A 1IJJA 1NBWA 3T7ZA 3VGLA 3WXMB 1YVNA 4A2AA 3FZHA 1YJ9N 4WQ5C 1Q82O 3CJ7A 2E2NA 2HBKA 3E9PA 3LM2A 2I7NA 4JD2B 3ID8A 4XH1A 4AF1A 3KHYA 4JKEA 5FPEA 3CERA 4RTFD 5KQ8A 5BREA 3L7VA 2JWLA 4BROA 1DGKN 3Q7CA 5AZIB 2QA4N 3VEOA 4G9ZA 4ISGA 4IEEA 4PKGA 1RGIA 1RFQA 3CJ9A 5AR0A 4CZJA 1HX1A 5LY3A 3EE9A 1GLJO 3MN6A 4IOXA 5BN8A 4H0XB 3DJCA 3O9UA 1ILYA 1NGBA 1WUAA 3BUZB 1WOQA 4IFEA 1HKGA 2FSJA 4EIAA 2Q2RA 3B8AX 2FSKA 1YUWA 3C6AA 4H0VB 5EY4A 5BRFA 4PL7A 2WUSA 1NGIA 3CC7N 3G25A 2CGJA 2HSTA 2Q97A 3IMXA 4RWTA 2VGMA 3ZIEA 3N4PA 3ATUA 3DWLA 3L4IA 2RE2A 2F9TA 2V52B 4JKGA 1VQON 4YOUA 3H07A 4FVUA 5AQZA 2RIUA 3VGKA 2A41A 3UKRB 3G4SN 3HOTA 1P8ZA 3VEZA 4M63C 5BN9A 3ZEUB 5F0XA 2YX6A 2HF4A 2E20A 2D4WA 3SAHA 4YOWA 3OA9A 5AQGA 5AQUA 3SBGA 3OBYA 5AFUH 5M1PA 2Q31A 5BPLA 4B1XB 4GY2B 1HJOA 4A62A 3H1VX 3I55N 3EO3A 3HZ6A 5JICA 1TUYA 3UE5A 3N4QA 4YOXA 2GWKA 5BPNA 1VQLN 4YORA 4JK8A 1SAZA 5E26A 2FF3B 3L0QA 3J7ZO 4HTLA 3D6RA 1T6DA 2P9SA 4H5RA 4BRCA 5AQRA 5GIPA 1G57A 4CZKA 3GL1A 5HL7L 3OW2M 1DEJA 3C7NB 1ATRA 1VQNN 2GELA 3F2KA 3IDHA 4IOCL 3CCUN 4KH4A 1XUPO 3MWTA 1JJ2M 3E9LA 4R79A 4BVPA 4A5BA 1C0FA 3D2EA 1NGCA 1NGJA 2W40A 5KPZA 3CCRN 3DXMB 2E2OA 1EO1A 4MDBA 2P9NA 5KPTA 1NWKA 3SBTA 3NMUA 3H45C 4FSVA 2PAVA 4FOEA 5E84A 3VEWA 3NVMA 4FWOA 4HWIA 2GUPA 4CZGA 4P6PA 3U9DA 3O9QA 3OBWA 3AGRA 4NO7A 5JLFA 3E1YA 3HTVA 1NJIO 1T44A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VTI A;  3VF2 A;  3VEW A;  3TSP A;  3VEZ A;  3VES A;  3TSQ A;  3TTC A;  3VEO A;  3TTF A;  3VER A;  3VEN A;  3TSU A;  3VET A;  3TTD A;  3VEX A;  3VTH A;  3VF4 A; 
#chains in the Genus database with same CATH topology
 4H4O A;  3SUO A;  2Z1G A;  3HZ7 A;  1TK0 A;  1U6Z A;  4LSN A;  4BG9 A;  1WAF A;  2AP1 A;  2BH1 A;  4NCX A;  3L3U A;  1JCE A;  3ZLJ A;  1J53 A;  2PY5 A;  4CD1 A;  3ENB A;  3EKU A;  4I6M A;  1HRU A;  4IBN A;  1K49 A;  2UU9 K;  2D0C A;  1P90 A;  3PV8 A;  4IZ9 A;  1A5X A;  3NCI A;  1JLA A;  3L4Q A;  3IRX A;  4CHQ A;  4M3U A;  2P51 A;  4FPA A;  3CIP A;  4DTO A;  5J2P A;  3T1Y K;  4F4K A;  3LDS A;  3HM9 A;  3G6E N;  4CK2 A;  1VAZ A;  2KFN A;  1BQN A;  3VTH A;  3M8S A;  3NF6 A;  4B3M K;  2EX3 A;  3MDQ A;  1S5J A;  1VQK N;  1VHX A;  4AQY K;  3W3D A;  5HRN A;  1HYS A;  3WNH A;  4DR7 K;  1FK9 A;  1WAJ A;  1C6V A;  2L8Y A;  4FZZ A;  3B6O A;  1JLG A;  1GLL O;  2UYT A;  3AAP A;  4H03 B;  1NG9 A;  2DY4 A;  2LSN A;  2ZF5 O;  4IXC A;  3PSI A;  4MQ3 A;  3SI6 A;  3KD1 E;  1VQ6 N;  4BRK A;  1SS6 A;  4Z94 A;  4U7B A;  4BRP A;  4DB3 A;  4CHY A;  5SWM A;  4FM1 A;  4GVM A;  4RW6 A;  3TAN A;  1F21 A;  4NB4 A;  5LJV A;  4BR4 A;  1RT1 A;  3ZSR A;  3A8Y A;  1MDU B;  5BPM A;  2HMP A;  1NGA A;  5C2F A;  3EZ5 A;  4B9N A;  1NJX A;  3QES A;  2E2P A;  2JWK A;  5DM7 L;  1NGG A;  3ULE B;  4CEZ A;  2CGL A;  2ZM6 K;  1VSF A;  5J2M A;  3SQ4 A;  2D0P A;  2B4J A;  3AO5 A;  4A61 A;  4CIE A;  3SJH A;  4E7I A;  1VQ4 N;  3PX6 A;  4FWM A;  1C0G A;  5FPM A;  1HMV A;  3CF5 L;  1VK0 A;  3QML A;  1OH6 A;  4NYN A;  1CZA N;  1YXQ A;  4XH5 A;  4B1U B;  1JL1 A;  4LF5 K;  3AA3 A;  2A40 A;  4Q5V A;  1ZBI A;  1JCG A;  3THV A;  5HP1 A;  3SUN A;  2CRQ A;  3IS9 A;  4EAH D;  2HHH K;  3V1O A;  1NGE A;  3TOE A;  4P8E A;  2A6A A;  1H1V A;  2VQE K;  1HQU A;  3CMA N;  2DFF A;  3DM2 A;  2HBM A;  1BA1 A;  2RIS A;  3QER A;  2R7Y A;  1GOC A;  1EQY A;  2NRV A;  5SZT A;  2QWQ A;  3LWL A;  4ELU A;  1BL3 A;  4H0T B;  3QBW A;  1BIZ A;  5AQW A;  4I2Q A;  5DM6 L;  2E1Y A;  5I42 A;  4FWL A;  4KO0 A;  5AQM A;  4OPK A;  3ZX0 A;  4B1V A;  3RTV A;  1BIS A;  2XY8 A;  3I0S A;  2GWJ A;  1LW0 A;  3AGK A;  4KTW A;  1QVG M;  4HCC A;  1VQP N;  1KD1 O;  3TTF A;  2A42 A;  4C8K A;  1HQE A;  5FPD A;  4YOY A;  1W7A A;  1RBV A;  1DLO A;  1LCU A;  2ITM A;  3HST B;  4ISF A;  4WFA L;  2QWM A;  5FLX O;  4LF8 K;  1UA1 A;  2D0B A;  4OLF A;  1NOY A;  4W5R A;  2QK9 A;  2NNW A;  1SZ2 A;  1OVY A;  4DTP A;  1DTT A;  3SLC A;  4FBW A;  4WCE L;  1QS4 A;  1BI4 B;  2EHG A;  2E1Z A;  5KQD A;  4KHU A;  3FLC O;  5I9E B;  3FFK B;  4JNE A;  4DV7 K;  3U9Z A;  1WSJ A;  3SUP A;  2JLE A;  4CJ7 A;  4CEF A;  3O1W A;  4JRQ A;  4KI6 A;  2KHO A;  2VQF K;  2FF6 A;  1XHZ A;  1TV6 A;  3J80 O;  4JKC A;  1KVA A;  1R59 O;  3VA3 A;  3HK2 A;  4NLB A;  2P5O A;  1WN7 A;  2V7Y A;  1QE1 A;  4M42 A;  2NRW A;  3B6P A;  4YDU C;  3VQ9 A;  1K6Y A;  1S1U A;  1EX4 A;  3IFR A;  3WQT A;  4C1N I;  3HP9 A;  4J2A A;  4QS7 A;  1TGO A;  4Z4F A;  3VMF B;  5AFU A;  3FZF A;  4AIL C;  5HRO A;  3TSQ A;  1S9E A;  3KLI A;  4FFJ A;  4ILH A;  3C95 A;  4I6M B;  3P04 A;  2VGN A;  3TAQ A;  4H4M A;  3NH0 A;  3ZSQ A;  4CZI A;  1TAQ A;  3K9J A;  4OGC A;  2XO7 A;  4RW4 A;  1JXE A;  1OH7 A;  1HPM A;  4KRF A;  5AQL A;  5CR4 A;  1JLB A;  3PIO L;  4P6C A;  1LAV A;  3GOI A;  4CIG A;  4G1Q A;  4FCY A;  3SMP A;  3KTQ A;  3UB5 A;  3QEP A;  4IG3 A;  1O1W A;  2QM1 A;  3VQ7 A;  2HHS A;  2Q1N A;  3MIO A;  2CH5 A;  1TKU A;  3QB0 A;  1T05 A;  3CQ8 A;  3CJB A;  4FJ8 A;  3HSC A;  2P9I A;  4E3S A;  4CI6 A;  3J7A P;  3BEX A;  1WSG A;  2DFE A;  1NJY A;  3QFP A;  3VEY A;  4JRP A;  3NH1 A;  5JVG L;  4B3R K;  4B9U A;  1ZXO A;  4N5S A;  1XHX A;  1ITG A;  3OY9 A;  1KAZ A;  5AQS A;  2VG7 A;  4JN4 A;  3VEX A;  1BU6 O;  2ZJQ L;  2ZJP L;  1E4G T;  4FWR A;  1VSI A;  1FKO A;  3FZL A;  3DLL L;  3QBX A;  4LFC K;  4CZF A;  3DOK A;  2E8A A;  3NGZ A;  3QIN A;  2BTF A;  1RTH A;  2D0O A;  3FZM A;  1PVY A;  1S72 N;  4JI2 K;  3CFO A;  1MU2 A;  5HRS A;  1YF5 L;  1QSS A;  3SQ0 A;  4C8M A;  5BR8 K;  1NJ6 A;  4XEI A;  4CER A;  4UY8 O;  4KBO A;  4BRG A;  1NM1 A;  2G8W A;  4GKJ K;  1PVW A;  4B8A B;  3HYF A;  3A5M C;  1KTQ A;  1SKW A;  5M1N A;  4GW6 A;  5EX5 A;  1FJG K;  2P9K A;  1WSH A;  4DU3 A;  5CYM A;  4L3Q A;  4E1B A;  3DLK A;  2HBJ A;  3KKR A;  5JMV A;  4A5A A;  4FWS A;  4CBU A;  2FBT A;  1T3V A;  2V7Z A;  3MAQ A;  1K9M O;  1X3M A;  3VQC A;  4IO8 A;  5AQH A;  1GLF O;  3G0Z A;  4DQI A;  3RRH A;  1JCU A;  3MED A;  2QWL A;  1TIG A;  1HKC A;  5M1O A;  1RT7 A;  4F3T A;  3R3L A;  4FLT A;  2H3G X;  5CYQ A;  4E1J A;  1SV5 A;  1Z05 A;  1T03 A;  3E66 A;  3MXJ A;  4EP4 A;  3DRR A;  3O80 A;  2B6A A;  1OKJ A;  4J2B A;  3AVC A;  4JI1 K;  3O4Q A;  4FL9 A;  3KK3 A;  1TYQ A;  3C0B A;  3K5N A;  1GOB A;  1JLF A;  4HVJ A;  3V9U A;  5AZJ A;  1EKE A;  1M90 O;  2D1K A;  3OJU A;  1RT3 A;  4FZX C;  1S1T A;  1KRP A;  2Z1J A;  3CYM A;  2A2Y A;  2EK0 A;  3FZH A;  2BAN A;  4WQ5 C;  3TI0 A;  1LWF A;  3CJ7 A;  1I3A A;  3E9P A;  4XH1 A;  5K14 A;  1W9H A;  4JKE A;  5FPE A;  4RTF D;  1RBU A;  3L7V A;  2JWL A;  3ZSY A;  4BRO A;  4CW7 B;  4DG1 A;  2IDO A;  5KTQ A;  1IKV A;  4IEE A;  4PKG A;  1RGI A;  5LY3 A;  4FM2 A;  1UWB A;  1X9W A;  4LF9 K;  1ILY A;  3F9K A;  3DJC A;  4H0X B;  1HKG A;  2FSJ A;  4CK3 A;  4DQP A;  4FYD A;  1X9M A;  4B9T A;  3I8D A;  2Q97 A;  4RG8 A;  4CED A;  3NDK A;  3THY A;  4BWJ A;  3ZIE A;  1Q9Y A;  3AVA A;  3DWL A;  3OS0 A;  2RF2 A;  4KI4 A;  1CXQ A;  5AQZ A;  3T1H K;  3BDP A;  3HOT A;  1P8Z A;  4M63 C;  1QTM A;  1JXB A;  2OPP A;  3MEE A;  5M1P A;  4AHS A;  2G8K A;  4B1X B;  3C94 A;  3DYA A;  4A62 A;  4CJU A;  3HZ6 A;  3M8P A;  5JIC A;  4DV4 K;  4I2P A;  3ZT3 A;  4YOX A;  1XMQ K;  3TAG A;  4JK8 A;  2IS3 A;  2DTU A;  2X74 A;  1CLQ A;  2HMI A;  4H5R A;  3GL1 A;  2W6K A;  3OW2 M;  3WBM A;  3ZCM A;  3O3F A;  4DQS A;  1KSP A;  1LV5 A;  4KH4 A;  4R79 A;  4NYF A;  1NGC A;  4QOZ B;  1NGJ A;  2W40 A;  5KPZ A;  4E7H A;  4JI3 K;  4MDB A;  4X66 K;  3TR8 A;  4F2R A;  1NWK A;  3SBT A;  3NMU A;  3H45 C;  4FSV A;  5IWA K;  2PAV A;  1HNW K;  4FWO A;  4CZG A;  3SQ2 A;  5JLF A;  1YT3 A;  3OYK A;  3TAE A;  3HTV A;  1IBM K;  3J81 O;  2ASP A;  3CJC A;  4I14 A;  2P9I B;  4K87 A;  3V1R A;  3A5O C;  4DV2 K;  1NJ2 A;  2I7P A;  4BC5 A;  3EY1 A;  1OVQ A;  4OVL A;  1U48 A;  3O9T A;  4FOI A;  4JLH A;  3DI6 A;  3GG4 A;  1XMO K;  5GAG P;  1K4P A;  4IO9 L;  4NZR M;  3KLG A;  3VEV A;  3EL2 A;  4CEC A;  3HM8 A;  5EU7 A;  2O8D A;  4KHP K;  1C0T A;  4M3Z A;  4BG8 A;  1U2V A;  2UUC K;  3ENO A;  2QWN A;  1N33 K;  2IVO A;  4Y1D A;  1LOT B;  3SZ2 A;  1VQ9 N;  3KZB A;  3LP2 A;  3KVG A;  2X78 A;  2ZD1 A;  1GLB G;  1RDC A;  4M3Y A;  1SKR A;  2ZGZ A;  4CEE A;  1N6Q A;  3PLA A;  3L2R A;  1VR4 A;  1IV0 A;  1K4O A;  5C10 A;  3V81 A;  1TVR A;  4DTN A;  3DLE A;  4H5N A;  4JKF A;  2ZGY A;  4FJ5 A;  3MK5 A;  4OO1 J;  5FRO A;  3O6W A;  2P9K B;  1RDW X;  5KPR A;  2E4L A;  2ITG A;  2KZM A;  4CJL A;  1RBR A;  3TU5 A;  3GDQ A;  4PA1 A;  4FLY A;  3RWU A;  1C0M A;  4JKB A;  3S3M A;  2XY5 A;  2Z1I A;  1J9A A;  5EOY A;  3IAY A;  4LH4 A;  3JSM A;  1FKP A;  4CGH A;  4X62 K;  2QI2 A;  2VWK A;  4E7K A;  2YHY A;  4XIU A;  2WOM A;  3OYA A;  1B9D A;  1VRT A;  2YHX A;  4DTM A;  3SAG A;  2G8H A;  3P31 A;  3QFU A;  4DFM A;  4N47 A;  5D3G A;  1KQS M;  4PKH A;  3V9Z A;  4DHY A;  4J8F A;  3CQX A;  4KPY A;  5EVZ A;  3AVG A;  3P39 A;  4L8R B;  4WQ4 A;  1TYQ B;  3RVC A;  4DV6 K;  5C42 A;  5AZJ B;  3TPQ A;  4FJN A;  4KAZ A;  2GBZ A;  3RMB A;  3MXM A;  1VSM A;  5FRN A;  4DUY K;  3ZSZ A;  3VGM A;  1YIT N;  3KK7 A;  4FJL A;  4DFP A;  3HRG A;  5ADX A;  4E0D A;  4JAX A;  3O08 A;  3U3Y A;  4EHU A;  3VEN A;  1NFH A;  3MN5 A;  1KFD A;  3ZET A;  2WFB A;  3ALY A;  3CI5 A;  4CZM A;  1QQN A;  2FBX A;  3TTC A;  3WT0 A;  1BHL A;  2HHU A;  2ASM A;  2YHB A;  3R8E A;  3P1G A;  1BCO A;  4EP5 A;  2YNI A;  5AQP A;  5J2Q A;  4W5T A;  4FLV A;  3LDP A;  4DU1 A;  3THY B;  3LL3 A;  3H6E A;  4PKI A;  5C12 A;  1ZBS A;  4FPB A;  2P1J A;  1H4S A;  3SQ1 A;  2OZS A;  2NRT A;  4I7F A;  5AQO A;  5B8H A;  4HTU A;  1PAV A;  2IVN A;  4MO5 A;  3LP3 A;  1NJ5 A;  2PYL A;  3R1X A;  4DSE A;  5C25 A;  4K41 A;  1GLA G;  4BDY A;  1YAG A;  2M71 A;  3ZT2 A;  1IBL K;  3HOS A;  3I8B A;  1TUU A;  4XH4 A;  2E5L K;  3UKU B;  2GTD A;  1QHT A;  2GEM A;  1S6Q A;  4C8L A;  4KFB A;  4OPH A;  2G8V A;  3O3H A;  1K8A O;  3OYH A;  3AO2 A;  3OTO K;  2D0A A;  2ZE2 A;  3U3G A;  1W0H A;  3K5O A;  4ELV A;  2X6S A;  2ZJR L;  4CF8 A;  3VA0 A;  3LVK B;  2KLA A;  2A5X A;  3FZK A;  3AA2 A;  3UKR A;  3M3Z A;  5JS2 A;  1W97 L;  3K2P A;  1NU0 A;  5LJW A;  1RIL A;  4I9L A;  5HOO A;  3OVN A;  4MO4 A;  1XI1 A;  1S3X A;  2PYJ A;  4BC2 A;  3M8R A;  4DR2 K;  1EWR A;  1D4X A;  3HPO A;  3EE8 A;  4RW9 A;  4IDH A;  4FWQ A;  4IFV A;  5CZ1 A;  4BRH A;  4CHN A;  4GVE A;  3NVK A;  4CHP A;  3G71 N;  1BWF O;  3WNF A;  4E1N A;  1BG3 A;  3C7N A;  1XEZ A;  3MGZ A;  2O8D B;  2HF3 A;  3JYT A;  2IVP A;  4C1N K;  3QIO A;  2PFU A;  1U2V B;  4CJT A;  3O8M A;  4BGA A;  4H8K A;  4NCG A;  3I56 N;  3DAW A;  5AQV A;  4GNI A;  3DRS A;  3LAM A;  2HNZ A;  2FXU A;  3LAN A;  2NRZ A;  3P4I A;  4JK9 A;  1T7P A;  4KHY A;  2E2Q A;  4BY9 C;  2D5R A;  4DCH A;  5AQN A;  4BDP A;  2WON A;  1ZBH A;  4Q0B A;  3ATV A;  2HNY A;  1M1K O;  2KZZ A;  1K7J A;  4DTU A;  3VET A;  3ULD A;  4HVZ A;  3LP0 A;  1YTA A;  1G99 A;  4CJF A;  4AHV A;  4N41 A;  3CQY A;  4E1M A;  2Q3S A;  4YDU A;  4DSF A;  3D2F A;  5AQX A;  3HXM A;  1KC8 O;  2FLO A;  3AY9 A;  4KHN A;  2OA8 A;  4C23 A;  3UIQ A;  1KFS A;  1HUX A;  3S3O A;  3L2U A;  3VF4 A;  2P9P A;  3VQ6 A;  2H9U A;  3ENH A;  4JI6 K;  3VOV A;  3ZT1 A;  3K5L A;  4ISE A;  4P8J A;  1S1X A;  4BDZ A;  4FXD A;  3CXC M;  1NGH A;  3OS1 A;  1XQS C;  2O8B A;  1NLV A;  4FBQ A;  3K9K A;  4AHT A;  4YOT A;  1DKG D;  3V9S A;  3KWG A;  3ID6 A;  3V1Q A;  1UDV A;  2G8I A;  3KWI A;  1H4Q A;  3TAF A;  5TKW A;  3BY5 A;  2QWO A;  3FGU A;  4CE9 A;  3HPG A;  5E41 A;  4DSL A;  1NMN A;  3ZSO A;  1JLC A;  1RT6 A;  1TAU A;  1ESV A;  3ZET B;  4GV9 A;  1HNX K;  3JXU A;  4IFY A;  4JI5 K;  1BO5 O;  3MX2 A;  4BWM A;  2Q36 A;  3LDL A;  2YHW A;  4KTZ A;  3V9X A;  3U6F A;  3CC2 N;  4BE1 A;  1X9S A;  1DT9 A;  2BDP A;  3CET A;  2QXL A;  4DMN A;  1J54 A;  2J4R A;  3GBT A;  4OJR A;  4WF9 L;  3V4I A;  1TL3 A;  1ZBU A;  3VQA A;  3GE1 A;  1IJJ A;  1NBW A;  3VQQ A;  1YVN A;  3AV9 A;  2E2N A;  4BC4 A;  3LM2 A;  4JI8 K;  3ID8 A;  5KQ8 A;  3KHY A;  3NF7 A;  3CER A;  4CJW A;  1D9D A;  1WSF A;  2HB5 A;  2YHA A;  1DGK N;  5J2N A;  3PUF A;  1HNV A;  3OYL A;  1A5W A;  1HX1 A;  3EE9 A;  1NOZ A;  1GLJ O;  5BN8 A;  1LN4 A;  3O3G A;  1NGB A;  2BKY X;  4UQG A;  1IKY A;  2Q2R A;  4LF7 K;  3C6A A;  5EY4 A;  5BRF A;  1NGI A;  3G25 A;  4IDK A;  4C8O A;  3IMX A;  4AHC A;  3N4P A;  3H07 A;  4Z9E A;  2IAJ A;  4JKG A;  4W5Q A;  2FBV A;  1IKX A;  3VGK A;  3UKR B;  3G4S N;  3VEZ A;  3LAL A;  5BN9 A;  5F0X A;  3L2Q A;  2YX6 A;  2HF4 A;  1SL0 A;  3NGI A;  4FJG A;  4BE2 A;  4PY5 A;  5AFU H;  4CEO A;  1JDQ A;  3AVF A;  4FLX A;  3EEQ A;  3NE6 A;  3UE5 A;  3N4Q A;  4KKO A;  1VQL N;  1SAZ A;  4DU4 A;  2FF3 B;  3DLR A;  4BE0 A;  1T6D A;  4O4G A;  4F2S A;  4O44 A;  1J5O A;  3MEG A;  4HUF A;  4ID1 A;  3C7N B;  1VQN N;  3IAB A;  2GEL A;  3IDH A;  4DTJ A;  3SPY A;  3F73 A;  3MWT A;  2O8C B;  1UAX A;  3D45 A;  3L3V A;  1S1W A;  3D2E A;  2E2O A;  1NKC A;  3QEW A;  4FOE A;  3MEC A;  3NVM A;  3QKB A;  4HWI A;  2O4G A;  4E89 A;  3O9Q A;  3AGR A;  1YTU A;  4CES A;  4KV8 A;  1NKB A;  3T69 A;  3EN9 A;  4DV0 K;  3VQ4 A;  1QZ6 A;  1I94 K;  3R6M A;  4JKA A;  1N36 K;  1K4L A;  3THW B;  2EWS A;  2YJE A;  4MLE A;  5C24 A;  2IIR A;  4FK2 A;  4QS9 A;  4NCA A;  1JL2 A;  5CY4 A;  3AO3 A;  1QVF M;  1N32 K;  1HRH A;  4FWN A;  4BR2 A;  4GV6 A;  1KAY A;  4YKE A;  4DR5 K;  5KGW A;  3ZSW A;  4ZTJ A;  4CFC A;  2A3Z A;  4CZL A;  4Z4I A;  2VCP A;  3CHW A;  3D2F B;  4OLA A;  3AAR A;  3VQE A;  5M1K A;  3WNE A;  2Y1I A;  1WSE A;  1YJN N;  3K58 A;  4TWA A;  3LDN A;  2LN3 A;  1Y9X A;  3OYJ A;  1TKT A;  4Q15 A;  3NBP A;  3ASM A;  3SNN A;  1VQM N;  4FWK A;  2Q0U A;  1MWK A;  1T6C A;  4JKD A;  3NAE A;  2P9P B;  4KHQ A;  1SQK A;  3VQ5 A;  2OTL N;  3RR8 A;  4HUG A;  5CE3 A;  4FZY A;  2FSN A;  4FO0 A;  1HYZ A;  3HI0 A;  5C0Y A;  4DUZ K;  4CD3 A;  3SYZ A;  2O8B B;  4RCH A;  2NLX A;  3F5T A;  3LRJ A;  1IO2 A;  1II7 A;  1K8K A;  1BOT O;  3PO5 A;  3KIO A;  4Z4H A;  3SMS A;  3MN7 A;  4HUE A;  4IEI A;  1UOC A;  3SPZ A;  3HO1 A;  3CJ1 A;  3TAP A;  4AM6 A;  1QQO A;  4CVN E;  3ZIG A;  3CCE N;  4KTQ A;  1VSJ A;  3CCV N;  1SL1 A;  4B9L A;  3IAL A;  2PBD A;  3MK6 A;  3VN5 A;  5DMR A;  3OYB A;  3RRG A;  4CZH A;  1WB9 A;  1GLD G;  3NFA A;  3KLH A;  1JCF A;  3H46 O;  4U67 L;  5MLC Q;  4CJE A;  4IG0 A;  1VQ7 N;  1KLM A;  2UUA K;  1VSD A;  4Z0U A;  2XRI A;  3A0I X;  3ISN C;  3LVJ C;  1K73 O;  4CGI A;  5T7B A;  3DLH A;  1TKS A;  1VSE A;  3TWH A;  3H08 A;  3CM6 A;  3KLF A;  4K42 A;  4NCB A;  3O5B A;  4DV1 K;  1HNI A;  1TK5 A;  1EWQ A;  1RNH A;  4E7L A;  4FJX A;  5GAH P;  2RHK A;  3AVH A;  1X3N A;  1NK4 A;  3UKU A;  4LSL A;  2GTC A;  4JI0 K;  1DCJ A;  4OPA A;  3T19 A;  3E01 A;  4EHT A;  2VG5 A;  3CM5 A;  5AQQ A;  1LWC A;  5J1E A;  1H0X A;  1B9F A;  3W0L A;  3F9M A;  1SL2 A;  5C15 A;  4X64 K;  4CF1 A;  5H1S Q;  1QQM A;  1HKB A;  2ASO A;  3LZJ A;  4BRA A;  1VSK A;  4O0J A;  5JLH A;  4BVO A;  4DF4 A;  3I0R A;  3M5R A;  3VF6 A;  3NHG A;  3PSF A;  4K43 A;  2E6L A;  4CJ5 A;  1VM0 A;  4BR7 A;  2QTD A;  3BZK A;  3QEV A;  1U49 A;  3VQP A;  4JKG B;  4O55 A;  1BCM A;  4DQR A;  3T1I A;  4ELT A;  3LM9 A;  2OPS A;  1G58 A;  4CGF A;  1S6P A;  2KW4 A;  3DRP A;  4H0P A;  1XNR K;  4EO0 A;  4DV3 K;  1NJ1 A;  2HHW A;  1CZB A;  4B8C A;  4EZ9 A;  1L3T A;  3DLG A;  3O9R A;  4PWD A;  2MX1 A;  3P38 A;  1YIJ N;  2NRX A;  2B5J A;  4BRQ A;  3CCJ N;  2KKZ A;  3HBT A;  2UXB K;  2Q0R A;  3IAB B;  5GAE P;  3WXJ A;  4K25 A;  4IJA A;  4CK1 A;  4CF9 A;  4M7X A;  2W42 A;  4ZHR A;  3D2E B;  4H5V A;  5BRH A;  4Z4E A;  1BA0 A;  1NGD A;  5BRD A;  1Q81 O;  4LH5 A;  4FW1 A;  1C1A A;  3ZEU A;  4ILJ A;  3HJF A;  4NLC A;  2EQA A;  4FBK A;  2WC9 A;  3PO4 A;  3SCX A;  4CHO A;  5AQY A;  1Y97 A;  4FLU A;  2XY6 A;  3BF3 A;  3CC4 N;  4A57 A;  5LL6 Z;  5CHI A;  1VQ5 N;  3VF2 A;  1NGF A;  4CZE A;  3AVB A;  2HHQ A;  2DPN A;  2QWP A;  3AO1 A;  1RT4 A;  1NJ8 A;  3ZIH A;  4FLW A;  3IKM A;  4BRN A;  3QNN A;  4OKK A;  3KJV A;  1RBS A;  4F3O A;  2YCH A;  4OGE A;  1GLC G;  1UA0 A;  2V51 B;  4Y0W A;  3C6T A;  5FRM A;  2F7T A;  3IUC A;  1VQ8 N;  3SJJ A;  1ZBF A;  3CG7 A;  3KK2 A;  1C1C A;  4YOV A;  2YKN A;  4MFB A;  4DTR A;  3DXM A;  3FR0 A;  1I39 A;  4A2B A;  2O8F B;  3PY8 A;  1KLN A;  3WQU A;  3O4N A;  1ASU A;  2QKK A;  3DLB A;  4AHR A;  4J2D A;  3EYZ A;  1J6Z A;  4DLE A;  3VTI A;  1S9G A;  1NNE A;  1NK6 A;  3OHR A;  4B1Y B;  4OLB A;  1TKZ A;  1NJZ A;  4CJP A;  3VQD A;  1JE3 A;  1OH5 A;  3M1F A;  2G8U A;  4FJH A;  2I5J A;  2ZWH A;  1D9F A;  1K8K B;  5AQJ A;  4DR1 K;  3VQ8 A;  1R0A A;  3QO9 A;  4O8K A;  4DQQ A;  1TL1 A;  1HC7 A;  3AVL A;  1KXP A;  2YNG A;  4O5F A;  4DLG A;  4OX9 K;  4DWI A;  2F96 A;  4BR5 A;  4E7J A;  4Y1C A;  4CF0 A;  4B9S A;  1QHA A;  3THX B;  1V4T A;  4CJQ A;  1NK0 A;  3Q7B A;  4PL8 A;  4CJK A;  1ATN A;  1NJW A;  4BRM A;  3K57 A;  2A1S A;  3ZT0 A;  4BRI A;  4YFU A;  3L2W A;  2OZM A;  2NZT A;  1H0Y A;  3U6Y A;  3NH2 A;  2IC3 A;  4BQZ A;  2OAN A;  5JVH L;  1T8E A;  4YDQ A;  3AVM A;  4M3R A;  3A5N C;  4CJ3 A;  2CH6 A;  5A2Q O;  4CJS A;  4FWP A;  5AJ3 K;  1QSL A;  2ETJ A;  2VWJ A;  4CEA A;  4C8N A;  2ATQ A;  4JHD A;  3WUH A;  3BGR A;  3ITH A;  4FJI A;  1IG9 A;  2YJF A;  3OYN A;  1Q86 O;  5ADX H;  1WLJ A;  4M45 A;  1SNN A;  1QZ5 A;  4F8R A;  1VRU A;  1HPZ A;  4OPJ A;  3O4W A;  4KH5 A;  4EFH A;  3MWP A;  1HR0 K;  2P9L A;  4BRF A;  2UXC K;  4JK7 A;  5F2R A;  3AAQ A;  2OPR A;  2O4I A;  4WQ4 C;  4CJV A;  5CZ2 A;  1KK9 A;  1WBD A;  4DR3 K;  4AH9 A;  3DXK A;  1B92 A;  4DSK A;  2NRR A;  3TSP A;  2HW3 A;  5KGX A;  2BUP A;  3S41 A;  3CFP A;  1QSY A;  3CPE A;  3R9P A;  4LF4 K;  3ZX2 A;  2VG6 A;  2OYQ A;  1NFJ A;  4H5W A;  5BR9 A;  3QIC A;  5M1Q A;  4EZ6 A;  1DTQ A;  3MXI A;  3VGL A;  4WI1 A;  5I3U A;  1Q82 O;  4FJM A;  2W6L A;  3ZSX A;  4AF1 A;  4DR6 K;  4M3W A;  4N56 A;  3Q7C A;  2QA4 N;  4W5O A;  3VEO A;  4R5P A;  1H4T A;  2O8C A;  4FK0 A;  4CFD A;  4ISG A;  1KVB A;  5AR0 A;  1RFQ A;  4B9V A;  4DFK A;  3AVN A;  1LAW A;  3MN6 A;  4IOX A;  1U4B A;  3O9U A;  3OYM A;  4IFE A;  3JAM O;  4CFA A;  4NXN K;  4YHH K;  4JI4 K;  2WUS A;  2CGJ A;  2HST A;  2P5G A;  1NKE A;  1D5A A;  4DSI A;  3L4I A;  2RE2 A;  2F9T A;  2V52 B;  3K59 A;  3FFI A;  2RIU A;  1RT2 A;  1Z25 A;  3THW A;  3ZEU B;  4OKE A;  4YOW A;  5AQG A;  4V19 S;  1ZYQ A;  3OBY A;  5KRS A;  2HVI A;  3I55 N;  2F8S A;  2GWK A;  4YOR A;  2OCE A;  3OS2 A;  4HTL A;  3ZSV A;  3OYI A;  4FJJ A;  2Q3V A;  1HNZ K;  1RTI A;  5GIP A;  1G57 A;  4FW2 A;  3PX4 A;  2HHV A;  3LAK A;  3DSD A;  1JO0 A;  1JJ2 M;  1XUP O;  1C0F A;  3LWM A;  1N5Y A;  2XHB A;  3CCR N;  3DXM B;  2P9N A;  5KPT A;  4CFB A;  4NXM K;  3LP1 A;  4LF6 K;  3M8Q A;  4I9Q A;  5E84 A;  4E19 A;  3VEW A;  1G15 A;  4P6P A;  1OH8 A;  4NO7 A;  4DS5 A;  3HVT A;  3E1Y A;  1BIU A;  1T44 A;  1EO1 A;  1E4F T;  1IEZ A;  1EP4 A;  4WYB A;  5AQK A;  1XC3 A;  3EKS A;  3O9S A;  3OYF A;  3C6H A;  4LD0 A;  1O13 A;  5GAD P;  4DTX A;  3RSE A;  4PUO A;  5C2D A;  3BP8 A;  3M6G A;  3O1B A;  4YY3 K;  3FE1 A;  3I33 A;  4K0K K;  4HVC A;  4H5T A;  4PHT X;  4IJN A;  3CME N;  1GOA A;  2P9S B;  1C0U A;  3A5L C;  2X6N A;  1SKS A;  4BRL A;  4B08 A;  3OYE A;  3PX0 A;  1Y2I A;  1NK8 A;  4FM0 A;  1Q9X A;  3J8A A;  3CCL N;  4M7Y A;  1XNQ K;  2P9B A;  3RMA A;  3MMV A;  4DQ8 A;  4BC3 A;  1A5V A;  2RPI A;  1S1V A;  5ELZ A;  4FCX A;  4QCL A;  3OYC A;  5AQF A;  4TSX A;  4HHT A;  1NMD A;  4JHD B;  5DK5 A;  1TKD A;  1WNS A;  5AQI A;  4BAC A;  3CCQ N;  4JEP A;  1LW2 A;  1E3M A;  4KB1 A;  1ASV A;  2NRH A;  4MLH A;  1ZBL A;  3NF9 A;  1C1B A;  4LFA K;  3H1Q A;  4KHS A;  2HND A;  3QIP A;  4BGB A;  3L8B A;  3C6U A;  2BGG A;  2P9L B;  2W41 A;  4M3X A;  3HL8 A;  5FPN A;  2QW9 A;  1J5E K;  3QEX A;  3ZII A;  4B3O A;  3TTD A;  3S3N A;  3VER A;  4WFN L;  1TK8 A;  2Y1B A;  1QQC A;  3SUQ A;  3DXK B;  4FK4 A;  1FXX A;  4K86 A;  4JKH A;  3HVR A;  3WEE A;  4B1Z A;  2CGK A;  1L3U A;  1CZ9 A;  4BRD A;  4FJK A;  1K4I A;  3CJA A;  3BF1 A;  3QNO A;  1BQM A;  1U45 A;  4BR0 A;  4K8Z A;  1JLE A;  3LDO A;  1KVC A;  4DR4 K;  3ZX3 A;  5KRT A;  1S8E A;  2Y1J A;  4O5B A;  1U47 A;  1RDU A;  2P9U A;  2O8E A;  1RDD A;  3EZW A;  1D8Y A;  2JGU A;  4BQL A;  2QKB A;  1WBB A;  2GV9 A;  3TAM A;  4WQ5 A;  2E88 A;  4P77 A;  2IOC A;  4Z4G A;  1N34 K;  4FJ7 A;  2G8F A;  4P6D A;  4K88 A;  2QWR A;  4YNQ A;  1RTD A;  3DOL A;  4LC9 B;  3AJE A;  4M41 A;  3DMJ A;  3MN9 A;  4HCB A;  2EH1 A;  2YI1 A;  3T3F A;  1BGX T;  3U4L A;  1HJR A;  2WBN A;  4CF2 A;  5M1F A;  1Z6R A;  3QET A;  3D7E O;  1S22 A;  1NK9 A;  4QS8 A;  4LFB K;  4H0Y B;  3CD6 N;  1BUP A;  1EXQ A;  4JD2 A;  1IG8 A;  5HRP A;  4DS4 A;  3WXI A;  3AA5 X;  3WXK A;  4JS4 A;  5AZI A;  2FBY A;  2HBL A;  4CBW A;  2IGI A;  2YKM A;  4BRE A;  2O8F A;  1YHQ N;  1L5U A;  5HLF A;  3U8X A;  3OJS A;  3HP6 A;  3TAB A;  1W2B M;  4B9Q A;  3VPZ A;  3ZYY X;  2P9N B;  3HPH A;  4IOA L;  1XWL A;  2HVH A;  4CBX A;  4PQU A;  4CGD A;  3V9W A;  2A1R A;  1NK5 A;  2YNH A;  3P5J A;  5TKY A;  3KKS A;  4JS5 A;  3KLE A;  2AJQ A;  4FJ9 A;  4AM7 A;  2QXF A;  4B1W B;  2QEX N;  1Q18 A;  3ZT4 A;  3K0S A;  1KAX A;  4DKW A;  4BR9 A;  3SAF A;  4X65 K;  2OTJ N;  1VSH A;  4F9O A;  2YNF A;  1EET A;  4JV5 K;  3THX A;  3LQU A;  3E9O A;  1XC9 A;  3RSE B;  1GLE G;  2ZQB A;  4CCH A;  5JS1 A;  2IFE A;  4CEQ A;  2YV0 X;  4MDA A;  3K5M A;  3QEI A;  3BZC A;  1ATS A;  3LDQ A;  4GV3 A;  3JS6 A;  3WXL A;  1RTJ A;  3MCA B;  3RR7 A;  1Q7Y O;  5KI6 A;  2HHT A;  4NZT M;  4ILG B;  2GUI A;  4WE1 A;  4CGG A;  4DTS A;  1LWE A;  2GX9 A;  5IT9 O;  1BDG A;  2OPQ A;  4Z4C A;  3LPU A;  3TSU A;  3CCS N;  1YJW N;  1CXU A;  4W5N A;  4KHW A;  3DSC A;  2VWB A;  2LXR A;  1REV A;  3AVJ A;  4H0O A;  3VQB A;  4A59 A;  1VSL A;  3L6Q A;  1MA9 B;  1Y64 A;  4B3S K;  3RMD A;  4CEB A;  3QLH A;  5GIN A;  1L3S A;  3VES A;  2RN2 A;  3QDK A;  3V6D A;  1NK7 A;  2XY7 A;  3WEE B;  4ICL A;  3CPW M;  3MCP A;  5LMU K;  3NGY A;  5AQT A;  3SV3 A;  1HLU A;  3LPT A;  3C65 A;  3D0P A;  3HT3 A;  4KH6 A;  4O0I A;  4CIF A;  2VYP A;  1ZC6 A;  3H3N O;  3MX5 A;  1YI2 N;  3PIP L;  5LMN K;  2FC0 A;  3LS6 A;  1X9J A;  1FW6 A;  5F1X A;  5HBM A;  4WFB L;  1L3V A;  2P9U B;  2O8E B;  1JLQ A;  4GMJ B;  3CCM N;  1MWM A;  1V4S A;  4IWV A;  3H3O B;  2E6M A;  2F9W A;  1NH9 A;  4DSJ A;  5EXW A;  4DFJ A;  4ZTF A;  4IKF A;  2UXD K;  3S9H A;  4GKK K;  1RDA A;  3ULE A;  3SV4 A;  1HYV A;  2KQ2 A;  3KK1 A;  2HOE A;  5HRR A;  1N8R O;  4CGJ A;  3AVI A;  3LZI A;  4B9M A;  4CJR A;  5GIO A;  3SK3 A;  3AO4 A;  4O8U A;  2WTU A;  2AA4 A;  1RQ8 A;  3T7Z A;  2PZS A;  4DF8 A;  3A2F A;  4CHZ A;  3WXM B;  4A2A A;  1YJ9 N;  2BE2 A;  4N76 A;  4K8X A;  1WSI A;  3P83 D;  2HBK A;  4JD2 B;  2I7N A;  5BRE A;  1RCH A;  2KFZ A;  2F8T A;  5AZI B;  3WNG A;  4G9Z A;  4LY7 A;  1IH7 A;  1JKH A;  3CJ9 A;  4CZJ A;  4RW8 A;  1IBK K;  5FDL A;  1RBT A;  3RMC A;  2UUB K;  4JYA K;  3BUZ B;  1WUA A;  1WOQ A;  4EIA A;  1Z26 A;  4RW7 A;  3B8A X;  2FSK A;  4FVM A;  1YUW A;  4H0V B;  4PL7 A;  3CC7 N;  4RWT A;  2VGM A;  3ATU A;  1VQO N;  3AA4 A;  4YOU A;  4FVU A;  2A41 A;  2DFH A;  1U04 A;  3SAH A;  2E20 A;  2D4W A;  3J7Y P;  2F4V K;  3OA9 A;  5AQU A;  3SBG A;  4KB0 A;  4B3T K;  4M3T A;  2Q31 A;  5BPL A;  4GY2 B;  1HJO A;  3H1V X;  3TAR A;  3EO3 A;  2Z7C A;  1TUY A;  2KTQ A;  1SUQ A;  5BPN A;  3IG1 A;  5E26 A;  3OYD A;  3L0Q A;  3J7Z O;  1Q8I A;  3D6R A;  2RKI A;  4J2E A;  4AHU A;  4JI7 K;  1RT5 A;  2P9S A;  4BRC A;  5AQR A;  3T1A A;  4FLZ A;  4CZK A;  2NUB A;  1BI4 A;  5HL7 L;  1DEJ A;  1ATR A;  4DV5 K;  3F2K A;  4CJ4 A;  3L2V A;  3AVK A;  4IOC L;  4KRE A;  2HHX A;  3CCU N;  1RDB A;  3OYG A;  3E9L A;  4BVP A;  4A5B A;  1TKX A;  1X1P A;  2Z1H A;  3CFR A;  4QAG A;  1YVU A;  3NF8 A;  1KCF A;  1IKW A;  3KD5 E;  4OKJ A;  3G10 A;  2GUP A;  3U9D A;  3OBW A;  1ASW A;  4ID5 A;  1NJI O;  4HD0 A; 
#chains in the Genus database with same CATH homology
 3T69 A;  3EN9 A;  1E4F T;  1IEZ A;  2ASP A;  4WYB A;  1QZ6 A;  3CJC A;  3R6M A;  2P9I B;  4JKA A;  1XC3 A;  5AQK A;  4I14 A;  1K4L A;  2EWS A;  3EKS A;  1U6Z A;  2YJE A;  4MLE A;  3A5O C;  2IIR A;  4BG9 A;  3O9S A;  4QS9 A;  2I7P A;  2AP1 A;  2BH1 A;  4BC5 A;  1QVF M;  3O9T A;  4FOI A;  1JCE A;  3GG4 A;  4CD1 A;  5GAG P;  1K4P A;  4IO9 L;  3C6H A;  4FWN A;  4NZR M;  3ENB A;  3EKU A;  4BR2 A;  4GV6 A;  1O13 A;  4I6M A;  1KAY A;  4YKE A;  3VEV A;  3EL2 A;  5GAD P;  1HRU A;  3HM8 A;  3RSE A;  5C2D A;  1K49 A;  2A3Z A;  4CZL A;  3BP8 A;  1P90 A;  2VCP A;  3M6G A;  3O1B A;  3FE1 A;  4BG8 A;  1U2V A;  3CHW A;  3D2F B;  3ENO A;  2QWN A;  3AAR A;  3I33 A;  4H5T A;  4IZ9 A;  5M1K A;  4PHT X;  4IJN A;  3CME N;  2P9S B;  3A5L C;  1YJN N;  3L4Q A;  2IVO A;  3LDN A;  2LN3 A;  4FPA A;  4BRL A;  3CIP A;  1LOT B;  3G6E N;  1VQM N;  3J8A A;  4FWK A;  1VQ9 N;  3KZB A;  2Q0U A;  1MWK A;  1VAZ A;  1T6C A;  3KVG A;  4M7Y A;  3CCL N;  4JKD A;  2P9P B;  3VTH A;  2P9B A;  1SQK A;  1GLB G;  2OTL N;  3MMV A;  4DQ8 A;  4BC3 A;  5CE3 A;  2ZGZ A;  2FSN A;  4FO0 A;  3MDQ A;  1VQK N;  3HI0 A;  5C0Y A;  3PLA A;  3W3D A;  1K4O A;  4CD3 A;  5ELZ A;  4RCH A;  2NLX A;  5C10 A;  4FCX A;  3F5T A;  3LRJ A;  4H5N A;  5AQF A;  4JKF A;  2ZGY A;  3MK5 A;  1K8K A;  1BOT O;  1NMD A;  4JHD B;  4OO1 J;  3O6W A;  2P9K B;  3SMS A;  5AQI A;  1GLL O;  3MN7 A;  3CCQ N;  4JEP A;  4IEI A;  2UYT A;  3AAP A;  1RDW X;  4H03 B;  3CJ1 A;  5KPR A;  2ZF5 O;  4IXC A;  1QQO A;  4AM6 A;  3ZIG A;  3CCE N;  2NRH A;  4MLH A;  1VQ6 N;  3TU5 A;  3GDQ A;  4BRK A;  3CCV N;  1SS6 A;  4Z94 A;  3H1Q A;  4BRP A;  4JKB A;  4DB3 A;  4U7B A;  2PBD A;  5EOY A;  3MK6 A;  4NB4 A;  5LJV A;  4BGB A;  2P9L B;  2W41 A;  5FPN A;  2QI2 A;  2QW9 A;  4BR4 A;  4CZH A;  2YHY A;  3A8Y A;  3ZII A;  1GLD G;  1MDU B;  3TTD A;  5BPM A;  1JCF A;  2HMP A;  3H46 O;  2YHX A;  3VER A;  1NGA A;  4U67 L;  5C2F A;  4WFN L;  3DXK B;  5MLC Q;  3SAG A;  4BC4 A;  3P31 A;  2E2P A;  2JWK A;  3QFU A;  1NGG A;  3ULE B;  5DM7 L;  2CGL A;  1KQS M;  4JKH A;  1VQ7 N;  4PKH A;  3WEE A;  4B1Z A;  2CGK A;  2D0P A;  4DHY A;  4J8F A;  3A0I X;  3CQX A;  4A61 A;  3SJH A;  1K73 O;  5EVZ A;  1VQ4 N;  3P39 A;  4WQ4 A;  1TYQ B;  3RVC A;  1TKS A;  4FWM A;  4BRD A;  1C0G A;  5FPM A;  5AZJ B;  3TPQ A;  3CF5 L;  4K42 A;  1K4I A;  3CJA A;  3BF1 A;  3QML A;  3O5B A;  4BR0 A;  1CZA N;  1YXQ A;  4XH5 A;  4B1U B;  5GAH P;  2RHK A;  3LDO A;  1X3N A;  3UKU A;  3ZX3 A;  3VGM A;  1YIT N;  2A40 A;  3KK7 A;  1JCG A;  4OPA A;  3HRG A;  4EAH D;  5ADX A;  1RDU A;  1NGE A;  4EHT A;  4JAX A;  5AQQ A;  2P9U A;  2A6A A;  3O08 A;  1H1V A;  4P8E A;  3CMA N;  3W0L A;  3F9M A;  3EZW A;  4EHU A;  3VEN A;  2HBM A;  5C15 A;  1BA1 A;  3MN5 A;  3ZET A;  2RIS A;  2WFB A;  4BQL A;  5H1S Q;  3CI5 A;  4CZM A;  1EQY A;  4WQ5 A;  1QQN A;  2E88 A;  2NRV A;  2QWQ A;  4P77 A;  3TTC A;  3WT0 A;  1QQM A;  1HKB A;  2ASO A;  2ASM A;  4H0T B;  3QBW A;  4BRA A;  3R8E A;  5JLH A;  4P6D A;  4BVO A;  3VF6 A;  2QWR A;  3M5R A;  5AQW A;  5DM6 L;  4K43 A;  2E1Y A;  5AQP A;  4LC9 B;  3LDP A;  4BR7 A;  3AJE A;  2QTD A;  4FWL A;  3LL3 A;  5AQM A;  3ZX0 A;  3H6E A;  4PKI A;  4B1V A;  5C12 A;  1ZBS A;  4FPB A;  4JKG B;  3MN9 A;  2YI1 A;  3T1I A;  2GWJ A;  2NRT A;  5AQO A;  3AGK A;  3LM9 A;  5B8H A;  1QVG M;  1VQP N;  2IVN A;  3U4L A;  1G58 A;  2WBN A;  3TTF A;  2A42 A;  5M1F A;  1KD1 O;  1Z6R A;  4MO5 A;  3D7E O;  5FPD A;  4YOY A;  1S22 A;  3R1X A;  4QS8 A;  4H0Y B;  4H0P A;  1LCU A;  2ITM A;  3CD6 N;  1BUP A;  4EO0 A;  4ISF A;  4JD2 A;  4WFA L;  2QWM A;  1IG8 A;  3WXI A;  4K41 A;  1GLA G;  3WXK A;  5AZI A;  1YAG A;  3O9R A;  2MX1 A;  2NNW A;  3P38 A;  1SZ2 A;  2NRX A;  1OVY A;  4BRQ A;  3HOS A;  3CCJ N;  3I8B A;  1YIJ N;  1TUU A;  4XH4 A;  2HBL A;  2KKZ A;  3UKU B;  3SLC A;  4FBW A;  2GTD A;  4CBW A;  4WCE L;  2GEM A;  3HBT A;  2Q0R A;  4BRE A;  2E1Z A;  4OPH A;  5KQD A;  3FLC O;  5I9E B;  3FFK B;  4JNE A;  5GAE P;  1YHQ N;  3WXJ A;  1K8A O;  3U9Z A;  4K25 A;  3U8X A;  4IJA A;  4CJ7 A;  1W2B M;  4M7X A;  4B9Q A;  3O1W A;  3D2E B;  2ZJR L;  2KHO A;  3VPZ A;  2FF6 A;  4H5V A;  5BRH A;  1BA0 A;  1NGD A;  5BRD A;  4JKC A;  3ZYY X;  2P9N B;  1Q81 O;  4IOA L;  2KLA A;  1R59 O;  4CBX A;  2A5X A;  3FZK A;  4NLB A;  2V7Y A;  3UKR A;  3M3Z A;  3ZEU A;  4ILJ A;  2NRW A;  4NLC A;  4YDU C;  4FBK A;  2WC9 A;  2EQA A;  3IFR A;  3WQT A;  1W97 L;  4C1N I;  5AQY A;  5LJW A;  5TKY A;  3BF3 A;  5HOO A;  3CC4 N;  4QS7 A;  4A57 A;  5CHI A;  4MO4 A;  1VQ5 N;  3VF2 A;  1NGF A;  3VMF B;  4CZE A;  2DPN A;  4AM7 A;  2QEX N;  4B1W B;  5AFU A;  2QWP A;  3FZF A;  1Q18 A;  1S3X A;  4BC2 A;  1KAX A;  4DKW A;  3ZIH A;  3IKM A;  4BRN A;  4BR9 A;  3SAF A;  1D4X A;  2OTJ N;  3TSQ A;  3EE8 A;  4IDH A;  4FWQ A;  4F9O A;  2YCH A;  4BRH A;  1GLC G;  2V51 B;  4GVE A;  3NVK A;  4FFJ A;  4ILH A;  1BWF O;  4Y0W A;  3G71 N;  4I6M B;  2F7T A;  1BG3 A;  3LQU A;  3E9O A;  3IUC A;  1VQ8 N;  3P04 A;  2VGN A;  3C7N A;  3RSE B;  1XEZ A;  3MGZ A;  1GLE G;  4CZI A;  2HF3 A;  2IVP A;  4C1N K;  3K9J A;  4YOV A;  2PFU A;  1U2V B;  3O8M A;  1HPM A;  3DXM A;  5AQL A;  3FR0 A;  5CR4 A;  4BGA A;  4A2B A;  3I56 N;  3PIO L;  4P6C A;  3GOI A;  4MDA A;  3DAW A;  5AQV A;  4GNI A;  3SMP A;  3WQU A;  1ATS A;  3UB5 A;  3LDQ A;  4GV3 A;  3JS6 A;  2FXU A;  3P4I A;  2NRZ A;  3WXL A;  2QM1 A;  4JK9 A;  3MIO A;  2Q1N A;  1J6Z A;  3MCA B;  2E2Q A;  3VTI A;  4BY9 C;  1Q7Y O;  2CH5 A;  1TKU A;  3QB0 A;  4DCH A;  3OHR A;  3CJB A;  4B1Y B;  4NZT M;  4ILG B;  5AQN A;  3HSC A;  2P9I A;  4CI6 A;  3BEX A;  2GX9 A;  1BDG A;  3M1F A;  3QFP A;  3ATV A;  3VEY A;  2ZWH A;  5JVG L;  1M1K O;  1K8K B;  1ZXO A;  5AQJ A;  1K7J A;  3VET A;  3TSU A;  4O8K A;  4HVZ A;  3CCS N;  1YJW N;  1KAZ A;  1G99 A;  1KXP A;  5AQS A;  4O5F A;  3CQY A;  2VWB A;  4JN4 A;  4YDU A;  3D2F A;  4BR5 A;  3VEX A;  1BU6 O;  2ZJQ L;  4H0O A;  2ZJP L;  1E4G T;  1QHA A;  4FWR A;  5AQX A;  1V4T A;  1KC8 O;  2FLO A;  3AY9 A;  4A59 A;  3FZL A;  3DLL L;  3Q7B A;  3QBX A;  4PL8 A;  1ATN A;  4CZF A;  3L6Q A;  2E8A A;  4BRM A;  1MA9 B;  1Y64 A;  4C23 A;  2BTF A;  2D0O A;  4BRI A;  3FZM A;  1PVY A;  1HUX A;  1S72 N;  2NZT A;  3VF4 A;  2P9P A;  5GIN A;  1YF5 L;  4BQZ A;  3ENH A;  3VES A;  2OAN A;  3VOV A;  5JVH L;  3QDK A;  4ISE A;  4P8J A;  3WEE B;  4XEI A;  3CXC M;  1NGH A;  3A5N C;  1XQS C;  2CH6 A;  4KBO A;  4BRG A;  3CPW M;  1NM1 A;  4UY8 O;  3MCP A;  1PVW A;  1NLV A;  4FBQ A;  3K9K A;  4FWP A;  3A5M C;  1DKG D;  4YOT A;  3KWG A;  5AQT A;  5M1N A;  1HLU A;  3ID6 A;  3C65 A;  5EX5 A;  4JHD A;  2P9K A;  4KH6 A;  3WUH A;  2YJF A;  4L3Q A;  1Q86 O;  4E1B A;  2HBJ A;  5ADX H;  3KWI A;  2VYP A;  1ZC6 A;  3H3N O;  3MX5 A;  5JMV A;  3PIP L;  1YI2 N;  3LS6 A;  4A5A A;  4FWS A;  1X9J A;  5TKW A;  1SNN A;  4CBU A;  2QWO A;  3FGU A;  1T3V A;  1QZ5 A;  2V7Z A;  5F1X A;  4WFB L;  2P9U B;  3O4W A;  1K9M O;  1X3M A;  4KH5 A;  4IO8 A;  5AQH A;  1GLF O;  3MWP A;  4EFH A;  2P9L A;  3CCM N;  4BRF A;  1MWM A;  1ESV A;  4JK7 A;  3ZET B;  5F2R A;  1V4S A;  4IWV A;  4GV9 A;  3JXU A;  3AAQ A;  1JCU A;  2QWL A;  3H3O B;  1BO5 O;  4WQ4 C;  3MX2 A;  1KK9 A;  2F9W A;  1HKC A;  5EXW A;  5M1O A;  3DXK A;  3R3L A;  2H3G X;  2NRR A;  3ULE A;  4E1J A;  1Z05 A;  2Q36 A;  3E66 A;  2YHW A;  3TSP A;  3LDL A;  3CC2 N;  3O80 A;  1OKJ A;  2BUP A;  3S41 A;  2HOE A;  3CPE A;  1DT9 A;  1N8R O;  4FL9 A;  3R9P A;  3CET A;  1TYQ A;  3C0B A;  2QXL A;  3ZX2 A;  5GIO A;  5AZJ A;  2J4R A;  3GBT A;  4WF9 L;  4H5W A;  5BR9 A;  1M90 O;  2D1K A;  3QIC A;  3SK3 A;  5M1Q A;  3GE1 A;  4O8U A;  2AA4 A;  1IJJ A;  1NBW A;  3T7Z A;  3VGL A;  3WXM B;  1YVN A;  4A2A A;  3FZH A;  1YJ9 N;  4WQ5 C;  1Q82 O;  3CJ7 A;  2E2N A;  2HBK A;  3E9P A;  3LM2 A;  2I7N A;  4JD2 B;  3ID8 A;  4XH1 A;  4AF1 A;  3KHY A;  4JKE A;  5FPE A;  3CER A;  4RTF D;  5KQ8 A;  5BRE A;  3L7V A;  2JWL A;  4BRO A;  1DGK N;  3Q7C A;  5AZI B;  2QA4 N;  3VEO A;  4G9Z A;  4ISG A;  4IEE A;  4PKG A;  1RGI A;  1RFQ A;  3CJ9 A;  5AR0 A;  4CZJ A;  1HX1 A;  5LY3 A;  3EE9 A;  1GLJ O;  3MN6 A;  4IOX A;  5BN8 A;  4H0X B;  3DJC A;  3O9U A;  1ILY A;  1NGB A;  1WUA A;  3BUZ B;  1WOQ A;  4IFE A;  1HKG A;  2FSJ A;  4EIA A;  2Q2R A;  3B8A X;  2FSK A;  1YUW A;  3C6A A;  4H0V B;  5EY4 A;  5BRF A;  4PL7 A;  2WUS A;  1NGI A;  3CC7 N;  3G25 A;  2CGJ A;  2HST A;  2Q97 A;  3IMX A;  4RWT A;  2VGM A;  3ZIE A;  3N4P A;  3ATU A;  3DWL A;  3L4I A;  2RE2 A;  2F9T A;  2V52 B;  4JKG A;  1VQO N;  4YOU A;  3H07 A;  4FVU A;  5AQZ A;  2RIU A;  3VGK A;  2A41 A;  3UKR B;  3G4S N;  3HOT A;  1P8Z A;  3VEZ A;  4M63 C;  5BN9 A;  3ZEU B;  5F0X A;  2YX6 A;  2HF4 A;  2E20 A;  2D4W A;  3SAH A;  4YOW A;  3OA9 A;  5AQG A;  5AQU A;  3SBG A;  3OBY A;  5AFU H;  5M1P A;  2Q31 A;  5BPL A;  4B1X B;  4GY2 B;  1HJO A;  4A62 A;  3H1V X;  3I55 N;  3EO3 A;  3HZ6 A;  5JIC A;  1TUY A;  3UE5 A;  3N4Q A;  4YOX A;  2GWK A;  5BPN A;  1VQL N;  4YOR A;  4JK8 A;  1SAZ A;  5E26 A;  2FF3 B;  3L0Q A;  3J7Z O;  4HTL A;  3D6R A;  1T6D A;  2P9S A;  4H5R A;  4BRC A;  5AQR A;  5GIP A;  1G57 A;  4CZK A;  3GL1 A;  5HL7 L;  3OW2 M;  1DEJ A;  3C7N B;  1ATR A;  1VQN N;  2GEL A;  3F2K A;  3IDH A;  4IOC L;  3CCU N;  4KH4 A;  1XUP O;  3MWT A;  1JJ2 M;  3E9L A;  4R79 A;  4BVP A;  4A5B A;  1C0F A;  3D2E A;  1NGC A;  1NGJ A;  2W40 A;  5KPZ A;  3CCR N;  3DXM B;  2E2O A;  1EO1 A;  4MDB A;  2P9N A;  5KPT A;  1NWK A;  3SBT A;  3NMU A;  3H45 C;  4FSV A;  2PAV A;  4FOE A;  5E84 A;  3VEW A;  3NVM A;  4FWO A;  4HWI A;  2GUP A;  4CZG A;  4P6P A;  3U9D A;  3O9Q A;  3OBW A;  3AGR A;  4NO7 A;  5JLF A;  3E1Y A;  3HTV A;  1NJI O;  1T44 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...