3TTDA

Crystal structure of e. coli hypf with amp-cpp and carbamoyl phosphate
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
647
structure length
647
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 211
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttdA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttdA01
3VERA 3VF4A 3VEWA 3VEOA 3VEZA 3TSPA 3VTIA 3VF2A 3VENA 3TTCA 3TTFA 3VTHA 3TSQA 3VESA 3TSUA 3VETA 3TTDA 3VEXA
chains in the Genus database with same CATH superfamily
1X9SA 4BROA 1JL2A 3BF3A 3S3OA 1NK9A 4FJIA 4XH5A 5AZIA 2HNZA 4DTPA 1CXQA 3H1QA 4OJRA 4O55A 3V1OA 3OJUA 3H45C 4R5PA 2YHYA 4DSJA 2UYTA 3D7EO 4P6CA 4IDHA 3TAQA 3RMCA 4EP4A 5CR4A 4FJ5A 2QK9A 2RIUA 3O8MA 4RW6A 4ELTA 3WNFA 4OLBA 3MXJA 3ZT4A 3CIPA 3A0IX 4QS7A 3SCXA 5BRDA 4HTLA 4FJKA 3IMXA 4C1NK 4J2EA 4E1JA 1NJWA 1DKGD 4KI6A 4FJMA 4BC2A 2HOEA 2YHAA 3HPOA 3EZ5A 5KGXA 4OPJA 3JSMA 4F4KA 1UOCA 4FLYA 4FWOA 2P9KB 3KTQA 2A1SA 2FLOA 1IKVA 3HP6A 3D45A 2B5JA 2WUSA 3QETA 1OH7A 1LOTB 3SNNA 2BH1A 1X9JA 3C95A 2VWJA 3OYLA 3IDHA 4DR6K 2V7ZA 4FW1A 1BQMA 2JLEA 4FJ8A 1S6QA 1A5VA 4H0YB 1QQOA 4P6DA 4PY5A 5AQNA 3H3NO 4AM6A 2YNHA 4BRMA 3M8QA 1ZBHA 1RBTA 1TL1A 3MK5A 3BF1A 3HYFA 3CCVN 2PY5A 5FROA 4GNIA 4I9QA 4NXMK 1HJRA 2W42A 4DLEA 1VQNN 2D0CA 1B9FA 4CBXA 3D2EA 1NG9A 4PKGA 4CZEA 4DQRA 4X64K 2HF3A 3QEPA 3PIPL 2G8FA 3HBTA 2QI2A 1JE3A 4M3ZA 1HJOA 2LXRA 4B3OA 3SMSA 4B9NA 4CCHA 1Q7YO 2FBXA 3AO5A 1TAQA 4H5RA 4AHSA 2V7YA 1G57A 3HOTA 4EFHA 1S6PA 1YTAA 1NJXA 3WBMA 1XEZA 1Z26A 3LVJC 5M1PA 1N32K 4DTUA 3HVRA 2XY5A 1N6QA 1NGCA 1K8KB 2E20A 1WSJA 3F9KA 3QNOA 3FZKA 5KQDA 3V4IA 3UKUA 3EYZA 4FOIA 4DMNA 1YXQA 4B9VA 1RT2A 4IOAL 1VQ8N 1ZBFA 5BR9A 2Q3SA 1HNZK 1BO5O 3VA3A 4CI6A 4JI5K 3RR8A 4ISGA 1Y97A 2LSNA 2XO7A 3AJEA 4MDAA 1U47A 3VEYA 1EO1A 4CEDA 4JV5K 2BTFA 4A2AA 4IKFA 4FZYA 4B9SA 3KIOA 1MWKA 2AJQA 2ITMA 3CCEN 4B1XB 3G10A 2JWLA 1EWQA 2P9NB 5BPNA 1TKSA 1HPZA 1VRTA 5C12A 4E19A 1YHQN 4OKKA 1WLJA 4WQ5C 5KI6A 3AVCA 3DJCA 4KREA 2NRVA 1WSHA 4BRPA 3VQPA 4FJ7A 4JD2B 4IO9L 3NH1A 1WOQA 3L4QA 1JLQA 4FWNA 5GIPA 3JS6A 3A5MC 2RKIA 1RTJA 2KKZA 4FBWA 1C1AA 1ZC6A 4DSFA 1NK0A 3VQCA 1OKJA 1NFJA 3OYMA 4I9LA 2X6NA 1NKBA 2VG5A 4CHPA 4H5NA 4HCBA 4GY2B 5K14A 4FLVA 1O13A 1WNSA 5AQLA 4NCAA 4CZKA 3VOVA 2W6LA 2NUBA 4U67L 3NMUA 2GWKA 1VQ5N 3BZKA 2VWKA 4EO0A 4E7HA 4DS4A 4OGCA 4BRKA 5DK5A 3KKRA 3A5NC 4CZFA 5C25A 2G8KA 4AHUA 5HLFA 3OYBA 1VSFA 4W5OA 4A59A 1C0MA 1VSMA 3MN6A 3QDKA 1HYSA 1PVYA 1QQMA 3H3OB 2VQFK 1SV5A 2EHGA 4H0PA 3CCJN 3SUPA 1OVYA 1GOCA 3V1QA 4CF0A 3DWLA 4DHYA 2QW9A 3VQ4A 4DTNA 1NFHA 3V1RA 1NGGA 3JYTA 1C1BA 3VN5A 2KFNA 4GKJK 3LDSA 3G71N 3GG4A 3A8YA 3TABA 1NGBA 3FZFA 4FLXA 1E4FT 3SUQA 1JXEA 4A61A 1BUPA 3V9ZA 3OYJA 4HCCA 1XI1A 3OYFA 2YHBA 3VQ5A 1D9FA 1X3NA 1NK6A 4DQQA 4XH4A 3CHWA 3K5OA 4OGEA 1TYQA 3GOIA 1J53A 1T03A 3CCSN 4KBOA 1C0UA 1BA1A 3DMJA 2O8BA 3ASMA 1I94K 3O4NA 2EH1A 3D6RA 3TAFA 1JLGA 3Q7CA 4CEBA 3ENBA 3WXJA 1KFDA 2IC3A 3VQDA 1F21A 1VQMN 1WUAA 1LWEA 4CZGA 2YNIA 4OLAA 4M45A 1YJNN 4CE9A 2OZMA 3LPTA 2QEXN 4K88A 4KTWA 3VERA 2D4WA 4Z0UA 1RBUA 4KRFA 4DSIA 4LF6K 5MLCQ 1REVA 3EE9A 4BG9A 5ADXH 4G1QA 5KTQA 4FJXA 4PL8A 1LWFA 1ASWA 4K25A 1RTHA 3C65A 2WBNA 3VQAA 3ZCMA 4BREA 3QIOA 4K41A 3F73A 3HRGA 1JDQA 2IS3A 1YT3A 2E2PA 4BWMA 4LD0A 4JKCA 4O4GA 1YTUA 4NO7A 3OS0A 5AQHA 5AQPA 4CJLA 1UAXA 3KK1A 1GLEG 1L3VA 2Q1NA 2OPQA 2QXLA 2UUCK 4Y1CA 4NZRM 4CD1A 4DU1A 2QXFA 1VSKA 4J2DA 4Q0BA 3DLEA 1KRPA 1EP4A 4F3TA 3O9UA 3AAPA 4DV2K 1S9GA 1L3UA 2HBMA 1QTMA 2VCPA 1G15A 4RTFD 2YKNA 4KV8A 1XUPO 1EETA 1SQKA 1VSJA 5DM7L 3P5JA 5AQUA 3ZT1A 1S72N 4KPYA 4NLBA 3R3LA 2YX6A 1TKUA 2F9TA 4CJEA 1C6VA 4AHCA 4BC5A 1SL1A 2PYLA 1KXPA 4M3RA 5HRPA 2A6AA 2UU9K 1VSLA 3ULEB 5AQWA 2NRWA 5AQOA 4LF7K 1RNHA 3AVHA 1XC3A 2CRQA 5ADXA 3RVCA 3FE1A 4E7LA 1E4GT 4N5SA 4PWDA 1CZ9A 2ASOA 2Q3VA 2YNFA 1ZYQA 1YIJN 5AQIA 5JS2A 3I0SA 3ATVA 3QEVA 1S1TA 2O4GA 3HPHA 3GBTA 2X6SA 1Q8IA 2P9KA 1BCOA 2OCEA 3PLAA 1XNRK 1H1VA 3HJFA 1XC9A 5ELZA 2G8UA 4QCLA 1D8YA 2D1KA 2BKYX 2P9IB 3HZ7A 1OH6A 1EQYA 2IVNA 4C1NI 3OVNA 1BWFO 2NNWA 3VF6A 3DLKA 4NLCA 2IVPA 4I7FA 3QBWA 1RBVA 2HSTA 3R9PA 3E1YA 2I7NA 1HC7A 3RWUA 5EOYA 3CFPA 4CF2A 3RTVA 3LM2A 3LDLA 4EHTA 4HWIA 3D2FB 1JXBA 4AHRA 2HVHA 1RTDA 4BY9C 2P51A 2GTCA 3RR7A 3TAGA 4FLWA 4B3RK 3IG1A 5LMNK 1KQSM 4FJNA 3CM5A 2JWKA 3LDNA 2FXUA 4B9MA 4DF4A 4H0XB 3WNHA 1BIUA 3ZT0A 4RW9A 1Q9YA 4B3MK 2BANA 3QO9A 2UXBK 2NLXA 2UUAK 1A5WA 2ZJRL 2FSKA 2G8IA 4KH6A 2Y1JA 4C8LA 1D4XA 2GV9A 3BY5A 4E1NA 1K8KA 4JEPA 1TKTA 5AQZA 4FFJA 4EP5A 3VQEA 3MXMA 2A5XA 2RF2A 5AQRA 4CJSA 5IT9O 4BC3A 3ZSOA 4OPKA 4FCYA 4BRQA 1IEZA 4FJJA 3HK2A 2HHWA 1TIGA 1RT6A 3SUNA 3I8DA 4PHTX 4HHTA 1N36K 2HBJA 3LANA 4RCHA 1HQEA 4DSKA 2ZQBA 3OJSA 5JS1A 1TL3A 4RG8A 3TAEA 3U8XA 1H4SA 1N34K 1JLBA 4BE2A 2FBTA 5AR0A 3LWMA 1DT9A 3NF7A 4NB4A 3LS6A 4JHDB 2G8WA 3E66A 2VYPA 3V9SA 2IFEA 2XRIA 1ESVA 3DSCA 2HHQA 4UQGA 3V9UA 4E1MA 4ZTFA 1IKWA 3K58A 1BU6O 3LAKA 2D5RA 4YFUA 1T8EA 3C6HA 2QWNA 4DUZK 5HP1A 3SQ0A 1VQON 3MCAB 3O6WA 5SZTA 4DFPA 3DLGA 4IEEA 1XMQK 3MN5A 2IGIA 3H07A 4I2PA 4CHNA 1L3SA 1HMVA 4CK3A 4JD2A 3OS2A 1ZBIA 1NJZA 2OA8A 5JMVA 1TK8A 1VSIA 3AARA 4G9ZA 4O5BA 3CJ9A 2V52B 2ATQA 4FXDA 5I9EB 4HTUA 4KHSA 4YDUC 1ATSA 1IG9A 3EEQA 3IFRA 2HBKA 3NFAA 3VEWA 3SK3A 2XY8A 1QS4A 3H08A 4XH1A 4RW7A 1JCUA 4DV7K 4JKDA 1IBLK 1YVNA 3TAPA 4N41A 3ITHA 4WFNL 3B6OA 4DTSA 4CJTA 3ZEUB 3K5LA 4U7BA 1G99A 1DCJA 4RWTA 2ZGYA 3LDQA 5GINA 3O9RA 3P1GA 3CCLN 3OY9A 3Q7BA 4H0VB 3TOEA 2Q31A 4KH4A 3OYKA 2X74A 4FZXC 4IJNA 1Z05A 1MU2A 4WF9L 3VGLA 3TSPA 3OYDA 1K73O 1YI2N 4JK7A 1NGJA 3A2FA 4IFYA 3V81A 3AVKA 4Z4HA 5C42A 2BE2A 3HZ6A 4K43A 1TGOA 3T69A 1SNNA 3KK3A 2P5GA 4CHQA 1U2VB 5TKWA 4KHYA 2YJEA 3ZIHA 4CJKA 4HUEA 1NKEA 3DRRA 4TSXA 4B9UA 3AVAA 3CMEN 1RDWX 3QIPA 1IV0A 3QEIA 3EN9A 4WFAL 2E5LK 3KLHA 1K4LA 2ZJPL 1JCFA 2IAJA 3M1FA 4MO4A 1GLBG 4R79A 4MLEA 5M1QA 2XHBA 1RFQA 1XNQK 3L6QA 4DFKA 1YJ9N 4DV1K 1JO0A 4DR7K 1YVUA 4H0OA 2DFEA 1SUQA 3RRHA 3CCQN 1KVBA 3OBYA 1NU0A 2HNDA 3MDQA 1S22A 4CGHA 3CMAN 3THWB 2DFHA 5BN9A 3ALYA 2I7PA 3G0ZA 3TTDA 5J2PA 1NJYA 4YOYA 4DTMA 1MA9B 4DV3K 3T19A 1I39A 3VETA 2W41A 4FM0A 2YV0X 3SBGA 4CF1A 3LVKB 5GAHP 1Y2IA 3CQXA 5AFUH 4M3WA 4J2BA 3OYIA 1SL2A 4LSNA 3DAWA 3CG7A 3VQ8A 4CIFA 1FW6A 2E2QA 3QINA 4FJLA 4IOCL 4KTQA 3O08A 4GKKK 5LJWA 3VMFB 2HW3A 2BUPA 4CFAA 4CEZA 4WYBA 4M7XA 4C23A 1SZ2A 3NAEA 4BACA 1CZBA 4C8KA 3OYHA 3TR8A 2HMIA 3LM9A 4IZ9A 4HD0A 4J2AA 3HO1A 3SBTA 1WBBA 3DLRA 1N8RO 1T6CA 4H5TA 3V9WA 2Z1IA 3LZIA 2E88A 2Q0UA 4DTRA 3NCIA 1N33K 1KAXA 2Z1GA 2UXCK 1LN4A 3ULEA 2OANA 4HVJA 2GX9A 4CF8A 2P5OA 4MFBA 3U4LA 4BRHA 1NK4A 3E9LA 1GLAG 1DEJA 3WT0A 1BOTO 3AVBA 3CFOA 4BQLA 1O1WA 4YOWA 3SQ2A 5AFUA 1Z25A 1EWRA 2P9SB 4B08A 5I3UA 2QWOA 4LFBK 1NGHA 4HUFA 2BGGA 3I33A 1BL3A 5AZJB 3U9ZA 2E1ZA 3GE1A 4CZLA 2O4IA 1KAZA 2E4LA 3DOKA 1N5YA 2G8VA 2P9IA 2EK0A 3FZHA 1VQ4N 3U3GA 5M1OA 3NDKA 3CC2N 5CY4A 4FOEA 2Z1HA 1KLNA 3VEOA 3VEZA 4JI7K 4YOVA 3AGRA 5GIOA 3NVMA 5KPZA 3CJBA 3CI5A 4BR7A 2YHWA 1T44A 2RISA 3AA4A 1S1XA 4OX9K 4FM2A 3OW2M 3D2FA 3O3FA 3FR0A 3VQBA 3V6DA 3ISNC 1H0YA 3SUOA 4UY8O 4H0TB 4FJ9A 1HNXK 4MDBA 3J7YP 4CGDA 3NF8A 4OKEA 1WBDA 2Y1BA 4EAHD 5AQSA 5KGWA 3ZSYA 3CCUN 4FK0A 3AA3A 4CFBA 5HRNA 5JVGL 1X1PA 3P4IA 3MX5A 1Y9XA 3AO2A 1BDGA 4H4OA 3M8PA 2FF6A 3CJ1A 3PO4A 2OTJN 5FPMA 1ITGA 1QSYA 4JI2K 1NGAA 4X62K 4YOUA 2ASPA 3B8AX 4JI3K 3DXKB 1RT5A 3TTCA 4MO5A 1NGFA 3NGZA 4LH5A 2QWLA 1BQNA 4IO8A 2YHXA 4FWSA 1J6ZA 1U49A 1NK8A 2QA4N 4LF8K 2EQAA 1QHTA 1WSEA 4ZTJA 5GAGP 1I3AA 5H1SQ 4Y1DA 3CPEA 3O1WA 3FZMA 3UB5A 4BRLA 4IFEA 2CH5A 3O3HA 3HP9A 2W40A 1NK5A 2KTQA 3QLHA 4L3QA 5T7BA 4FWPA 1DTTA 4JKHA 1D9DA 5M1KA 1RBSA 1T3VA 4JHDA 4CEQA 4M3XA 5KQ8A 3I55N 1U48A 4BWJA 1W9HA 3U6FA 4DQ8A 1H0XA 3W3DA 3HVTA 5AQQA 2GEMA 4M41A 3AVLA 3AVGA 1VQLN 4LC9B 4H5WA 5CYMA 4JS5A 1EXQA 2FSNA 2A1RA 1HRHA 2MX1A 4DR1K 1TV6A 1A5XA 2P9UB 2OYQA 1FKPA 1PVWA 1RGIA 3SV3A 5IWAK 2O8DB 4BRCA 2BDPA 4TWAA 5DM6L 3T1IA 3THVA 5BPLA 5FPEA 1IKYA 4FBQA 3L3VA 2VQEK 1HRUA 4FSVA 4B1UB 3J7AP 4AHTA 4Z9EA 5FDLA 1NGIA 1EX4A 1RT7A 3I8BA 4DWIA 3GL1A 5EY4A 3TPQA 4DB3A 5BPMA 3KLGA 3AO3A 1S3XA 1P90A 3ZEUA 5CYQA 4BR2A 1RT1A 4DUYK 3SQ1A 3ZETB 4JRQA 4FVUA 5M1NA 2KZZA 1R0AA 1FJGK 1S1UA 1XQSC 3SPZA 5F2RA 4N47A 3MMVA 4FJHA 3EKSA 3RMBA 4FYDA 4IJAA 3O3GA 2CH6A 4MQ3A 3V9XA 4LF5K 2PFUA 4CHZA 2ZM6K 1LAWA 2E6MA 4B3TK 1RTIA 5AQVA 4A62A 3L4IA 3ZX2A 3KD5E 4M3UA 2D0BA 2QKKA 1VQ9N 1ATNA 4OVLA 4DQIA 1CXUA 2KLAA 3AAQA 4W5NA 3UKRB 3IALA 3L7VA 1TKDA 1U2VA 1RILA 3IABB 1WSFA 4GV3A 1U04A 3KHYA 4XEIA 3T3FA 4K8ZA 3NHGA 3CCMN 4NYNA 2FBYA 2XY6A 3LL3A 4IEIA 4P8EA 1QZ5A 4CBWA 1K6YA 3WQTA 2WTUA 2QM1A 2WOMA 3FLCO 1TVRA 3HL8A 3R1XA 4Z4CA 3RMDA 1SKRA 5FLXO 1BHLA 5SWMA 1QSLA 3HT3A 5J1EA 3ZIGA 3VENA 3VEVA 3A5LC 1VAZA 1QE1A 1HKCA 4CEFA 4WQ4A 3MEDA 4DV4K 4BRNA 1NJ8A 3THWA 1XMOK 4CGGA 1XWLA 1K9MO 2Z1JA 4E7IA 2OPPA 3NE6A 2O8FB 5HRSA 3CXCM 4CFDA 2PBDA 3HM8A 3DLLL 4CZHA 4QS8A 2OPRA 4AF1A 4CEEA 4DFJA 4PKIA 4BRIA 3TAMA 4FWLA 4NXNK 5B8HA 5GAEP 3MGZA 4IDKA 5F0XA 4DV5K 4B8AB 5C2DA 5EXWA 1U4BA 3WEEB 1YF5L 3BGRA 1UDVA 3K57A 3AA2A 4ILJA 2FSJA 3L2QA 4KHNA 2UUBK 1T7PA 4OLFA 3BP8A 3VTIA 5JLHA 4IG0A 1W97L 5CZ1A 4KB1A 1H4QA 4CJ3A 2GELA 3S9HA 3M8RA 2QTDA 4IXCA 4FLZA 2KW4A 4JNEA 5CZ2A 5HBMA 3L2WA 2KQ2A 5HROA 3K5MA 2P9LB 4O8KA 5KRTA 3F5TA 4OO1J 1X3MA 4KTZA 4LF4K 4K8XA 4PKHA 3LAMA 2QKBA 2Q0RA 1KAYA 1GLDG 4N56A 2DFFA 4OPAA 4KH5A 3QEWA 2P9SA 4FZZA 1C0GA 3NBPA 4YORA 1QQCA 4CK1A 4ID1A 2OTLN 3VESA 1DGKN 4NCXA 5AZJA 4P8JA 5AQMA 3C0BA 4CHOA 3K59A 3CD6N 4XIUA 1V4SA 3H46O 3VQ6A 3ZYYX 3P39A 3ZX3A 2I5JA 3QBXA 5EX5A 5JLFA 1RDUA 3SI6A 2DPNA 4O5FA 1S1VA 2E1YA 4H5VA 1IBMK 1HNVA 4CJ5A 3BZCA 2B4JA 4K86A 4DR3K 4J8FA 2HHVA 3BEXA 2YCHA 5LL6Z 2J4RA 4ICLA 4FLTA 3VEXA 2E6LA 1KD1O 2R7YA 3B6PA 2H9UA 1VM0A 2B6AA 3RSEB 1NMDA 2P9NA 3KJVA 4KHPK 4NCGA 4AM7A 4BDZA 3AO4A 1KVAA 3MEGA 5KRSA 1NWKA 4BRFA 1II7A 3J7ZO 4CBUA 2A3ZA 1FXXA 4QOZB 4FPBA 3AO1A 1B92A 3QICA 3OTOK 4GVMA 1NGDA 3EZWA 1HKGA 4LH4A 3ZT2A 3VQQA 1OH8A 1OH5A 1VQPN 2V51B 5KPTA 4BE1A 1C1CA 3MECA 3M6GA 1K4IA 1VSDA 3LP2A 3H6EA 3SZ2A 1K7JA 1VSHA 2WFBA 3C7NB 2L8YA 3ZSVA 3LDPA 3PX0A 3DXKA 3CCRN 3HSCA 3PSFA 2E2NA 3MAQA 3ZLJA 3F2KA 3WNGA 1R59O 4CERA 4JKFA 4CJUA 3E9OA 1C0FA 3CETA 4FBKA 5TKYA 3U3YA 1PAVA 4YY3K 3L3UA 3VQ7A 3ZSQA 4BQZA 3OYAA 3CF5L 4CZMA 3LP0A 1VSEA 4B9LA 1S8EA 5BR8K 4IFVA 2NZTA 3EE8A 1HKBA 4DCHA 3SQ4A 3KKSA 3G4SN 4YNQA 4DTOA 3K0SA 3MXIA 2PZSA 2HMPA 3PY8A 4A57A 3QERA 2HBLA 2YKMA 4JK9A 3OYGA 1M90O 4EZ6A 1KFSA 4E89A 3CC4N 4M63C 2FC0A 4KB0A 3AV9A 2NRZA 4DQPA 3S41A 1X9WA 2IOCA 4BR0A 1GLJO 3VF4A 4F2RA 2O8CB 1JLEA 2P9UA 3WXIA 3TI0A 3EL2A 2GUIA 4K0KK 3OHRA 4FO0A 3ZIIA 4PQUA 3WXLA 1RBRA 4DU4A 1W2BM 2O8DA 3NVKA 2VGMA 1IG8A 4M3YA 2RE2A 1GLLO 3AVMA 5C2FA 4B9QA 3IS9A 3CERA 1SKSA 2KFZA 3CQ8A 1CLQA 4DKWA 2NRTA 2HNYA 1LV5A 1V4TA 5C0YA 1NOZA 4Y0WA 1J54A 3AVFA 3ZSXA 1S9EA 2ASMA 2XY7A 3DI6A 3GDQA 1HLUA 5BN8A 3PO5A 1HPMA 2CGKA 4DV6K 4H8KA 1P8ZA 5CE3A 1C0TA 3ZETA 3C6UA 1D5AA 3QMLA 3QEXA 4W5RA 3CFRA 3ID8A 3ZT3A 3M8SA 1KVCA 1GOBA 3J80O 1BGXT 1NMNA 3ULDA 1H4TA 3TANA 4FCXA 4MLHA 1RDAA 3PV8A 4C8MA 3DXMB 3AVIA 3QNNA 4E1BA 4C8OA 4FL9A 3MWTA 4YKEA 1NJIO 2F7TA 5C24A 3MX2A 4LFCK 3VQ9A 1OVQA 4FPAA 5JICA 4NYFA 1MWMA 1QZ6A 3FFIA 3K2PA 3CPWM 4DF8A 3UKRA 3THYB 3IABA 1VQ7N 4F9OA 1CZAN 3SAGA 4F3OA 3J8AA 4P6PA 3MWPA 1Y64A 5FPDA 3T1AA 1UA0A 4Q15A 3L8BA 3I0RA 2HHSA 1DLOA 2GBZA 3ENOA 4CZIA 4CJVA 3CC7N 4IOXA 3THXB 2O8EB 1T6DA 1ZXOA 4Z4IA 3IRXA 4ELUA 1W0HA 3A5OC 4E3SA 4JLHA 2IDOA 3T1YK 4O44A 4B3SK 3SMPA 5AQJA 3BUZB 2UXDK 3FGUA 1L5UA 4FW2A 1IH7A 2RHKA 3NH2A 2YNGA 4F2SA 2GWJA 4B1YB 3PSIA 1QQNA 4KFBA 4CJPA 2GTDA 4EZ9A 1RDDA 1K49A 1RDBA 3SLCA 5J2NA 4Q5VA 5I42A 2O8FA 2VGNA 2WC9A 4BGAA 3WXMB 3TSUA 1WN7A 3L2VA 1KK9A 4W5QA 1NM1A 4PL7A 4WFBL 1HR0K 3WUHA 4CECA 1K8AO 4L8RB 2RN2A 1VQ6N 3S3MA 1HYZA 5AQGA 4JKGB 5AJ3K 2JGUA 1WAFA 2VG6A 4WQ5A 3VTHA 3DM2A 2HHHK 3QFPA 5CHIA 3WEEA 4KI4A 2EX3A 3G6EN 1BIZA 5LY3A 1E3MA 1U45A 4A2BA 4BDYA 3ZSZA 4JI1K 4I6MB 1W7AA 3WXKA 5F1XA 3BDPA 3OYNA 1SAZA 3O4QA 2NRHA 3SV4A 1LCUA 5HL7L 5EU7A 4GVEA 4KHQA 3P83D 4RW8A 2OZSA 3MN9A 4YHHK 2P9LA 4BE0A 4CVNE 3AVNA 2HHUA 4CGJA 3EKUA 1BI4B 1QHAA 4JI8K 2A42A 1YAGA 1BISA 3QKBA 2YI1A 5A2QO 3ZSWA 2EWSA 3HTVA 4CZJA 3ZIEA 5FPNA 5J2MA 3DOLA 1HUXA 3P31A 3LPUA 3DLHA 3LP3A 3K9KA 4JKBA 3KK7A 1B9DA 3UIQA 1T05A 4LFAK 2Q2RA 1ILYA 3KLEA 1ZBSA 3ENHA 2Q36A 2QWPA 1BCMA 1NBWA 4Z94A 1SKWA 1EKEA 4CJ4A 3OBWA 2HB5A 4YDQA 1JCEA 3LDOA 3G25A 2P9BA 3PIOL 4V19S 4BC4A 3MEEA 1KC8O 3LZJA 1SS6A 3UE5A 2PAVA 4EIAA 4B9TA 3L0QA 1U6ZA 4CJ7A 4O0IA 2Y1IA 2M71A 3EO3A 4B1VA 3KLFA 3C6AA 4DLGA 3K9JA 5AQKA 4K87A 1WB9A 2PYJA 3DLBA 1Q81O 3RSEA 3W0LA 3VGMA 3CM6A 4GMJB 4AHVA 4GW6A 3N4QA 2P9PB 5EVZA 3NH0A 3L2RA 4WI1A 4JN4A 1BA0A 5D3GA 2VG7A 1NLVA 3ZSRA 3AGKA 2AA4A 4FVMA 3OYEA 4BRAA 1MDUB 3JXUA 5AZIB 4CHYA 1SL0A 1NJ6A 4RW4A 2FBVA 1QVFM 5AQXA 4CJFA 4X65K 2A40A 3VPZA 1LW2A 2AP1A 4DR2K 3LQUA 1IBKK 1DTQA 3C7NA 1Q86O 3VGKA 2H3GX 4I14A 5AQTA 3IKMA 2G8HA 4F8RA 2A2YA 1GOAA 4N76A 2DTUA 1KSPA 4AQYK 4CJWA 4PA1A 1JL1A 4E0DA 1NK7A 3KVGA 4E7KA 4ZHRA 4X66K 4M42A 2ZF5O 1J5OA 3LRJA 3HPGA 3HSTB 3O9QA 3ATUA 1JCGA 2KZMA 1LW0A 4BR5A 3QB0A 1HX1A 1ASVA 4JKEA 4NZTM 4CD3A 5AQFA 5LMUK 3T7ZA 3S3NA 4I2QA 4DU3A 2NRRA 3TWHA 3R6MA 1VRUA 4DR4K 1TKZA 4O0JA 4WCEL 3JAMO 5LJVA 3AA5X 5M1FA 4ISEA 4CESA 2X78A 3PX4A 3OA9A 5KPRA 3O80A 5HRRA 2QWQA 3AVJA 1Q18A 2O8CA 4JYAK 3QFUA 4CW7B 1X9MA 4DTXA 4HUGA 4KHWA 3SJHA 3TSQA 3D2EB 1ZBLA 2GUPA 2QWRA 1IO2A 3LWLA 2HVIA 2W6KA 3J81O 4KHUA 3WQUA 4CIGA 4E7JA 2IVOA 3M5RA 1LAVA 4QS9A 1S5JA 4CIEA 3P38A 1TKXA 4DSLA 2ZD1A 3PX6A 3KZBA 1Q82O 3AY9A 4H4MA 1UA1A 3VA0A 3M3ZA 3L2UA 4JI6K 4LF9K 2HHXA 3F9MA 4O8UA 1NH9A 5E26A 2HHTA 3C6TA 1WSGA 3O4WA 3SJJA 2A41A 3FZLA 4GV6A 2CGLA 3HXMA 3UKUB 4HVCA 4HVZA 2HF4A 1QSSA 1KCFA 4P77A 3DXMA 5FRMA 1S1WA 4YOTA 2DY4A 3HM9A 1NKCA 1L3TA 4ELVA 4K42A 4IWVA 3SPYA 2LN3A 3PUFA 3FFKB 2ETJA 1QVGM 1JLAA 4AILC 4BRGA 4JAXA 2D0AA 1K4PA 3KWGA 2E8AA 4WQ4C 5C10A 3P04A 1HYVA 3KK2A 1VK0A 3NF6A 3THYA 3KWIA 3DRPA 2YJFA 4FK4A 3IAYA 3O9SA 3DSDA 4LY7A 2ZGZA 1WSIA 4CEAA 1FKOA 1GLCG 3QESA 3LALA 1RT4A 4FWMA 4W5TA 1NOYA 3SAHA 4FM1A 4ILHA 3THXA 4FK2A 2O8EA 3TTFA 1JLFA 2F4VK 3CYMA 4B8CA 1YITN 5AQYA 1LWCA 3MIOA 1Q9XA 4Z4FA 2F8TA 1NJ5A 5E41A 4Z4EA 3IUCA 4DSEA 1NNEA 1VQKN 4BDPA 2D0OA 4JI0K 1RDCA 4DR5K 4IBNA 4BGBA 4Z4GA 2RPIA 4M3TA 3MCPA 1VHXA 1VR4A 1RT3A 4KAZA 3I56N 4OKJA 3MN7A 1JKHA 4FLUA 3N4PA 3RRGA 1IKXA 1XHXA 4CJQA 1NGEA 4DG1A 3CJCA 3WNEA 4CK2A 4JKGA 3OS1A 4WE1A 5HOOA 3SAFA 1J5EK 3O1BA 4NCBA 1TAUA 4JS4A 2IIRA 1UWBA 1ZBUA 4FWKA 3HOSA 4H03B 4JKAA 3DRSA 4FWRA 4I6MA 3CJ7A 4CGFA 3CJAA 1K4OA 2ITGA 3C94A 2D0PA 4YDUA 1Z6RA 3TARA 1HNWK 2Z7CA 4A5AA 4QAGA 3O9TA 4FWQA 3E9PA 2F9WA 3LP1A 4CFCA 3R8EA 4ILGB 1FK9A 4OPHA 1BI4A 4ISFA 1RQ8A 1TK5A 4JK8A 4IG3A 3CQYA 1WAJA 1TUUA 2OPSA 2E2OA 3HI0A 4BR4A 3NGIA 1GLFO 1RCHA 3H1VX 1YJWN 1KTQA 3O5BA 4B1ZA 1TUYA 2WONA 2F96A 3KD1E 3MK6A 1YUWA 1IJJA 3RMAA 4JRPA 4CF9A 4KKOA 5C15A 2P1JA 2VWBA 1TK0A 1ATRA 2FF3B 3U6YA 1M1KO 2KHOA 5J2QA 2F8SA 1TYQB 4BG8A 3SYZA 1BG3A 5FRNA 3T1HK 1NJ2A 2Q97A 4B1WB 3VF2A 5BREA 2O8BB 1NJ1A 2NRXA 3E01A 1JLCA 4DTJA 1J9AA 4DFMA 5BRHA 4AH9A 4A5BA 5GADP 4JI4K 3D0PA 5DMRA 4CGIA 4PUOA 4YOXA 2CGJA 5BRFA 3K5NA 3EY1A 4FJGA 4BVOA 5JVHL 4GV9A 4DS5A 1G58A 4BVPA 5E84A 4DV0K 4BRDA 3ZX0A 4CEOA 2ZE2A 3DYAA 3TU5A 4KO0A 4M7YA 3NF9A 4C8NA 1ASUA 2P9PA 2ZJQL 3NGYA 1KLMA 1JJ2M 1XHZA 4LSLA 4DQSA 3OYCA 4CJRA 1HQUA 3U9DA 4ID5A 2QWMA 2ZWHA 1HNIA 4BR9A 3KLIA 4EHUA 3ID6A
chains in the Genus database with same CATH topology
5AQGA 4JKGB 4BROA 3BF3A 1NGIA 4WQ5A 3VTHA 3QFPA 5CHIA 3WEEA 4XH5A 3I8BA 5AZIA 3GL1A 5EY4A 3TPQA 4DB3A 3G6EN 2NLXA 5BPMA 5LY3A 3H1QA 2ZJRL 1S3XA 2FSKA 1P90A 3ZEUA 4A2BA 4KH6A 4BR2A 1D4XA 4I6MB 3ZETB 3H45C 2YHYA 3WXKA 5F1XA 1K8KA 4JEPA 4FVUA 5M1NA 5AQZA 1SAZA 1XQSC 2UYTA 3D7EO 5F2RA 4IDHA 4FFJA 4P6CA 2NRHA 3MMVA 1LCUA 5HL7L 2A5XA 4GVEA 5AQRA 5CR4A 2RIUA 3O8MA 4BC3A 3EKSA 3MN9A 4IJAA 2CH6A 4BRQA 2P9LA 1IEZA 2PFUA 3EKUA 2QEXN 1QHAA 3CIPA 5AQVA 4A62A 2A42A 3A0IX 1YAGA 3L4IA 4QS7A 3ZX2A 4PHTX 5BRDA 4HTLA 3IMXA 2HBJA 4C1NK 2YI1A 1ATNA 4E1JA 1VQ9N 1DKGD 4RCHA 2EWSA 3HTVA 2KLAA 3ZIEA 4CZJA 5FPNA 1HUXA 4BC2A 3AAQA 3P31A 2HOEA 3UKRB 3L7VA 1U2VA 3U8XA 4GV3A 3KHYA 3K9KA 4XEIA 4JKBA 3KK7A 3CCMN 5AR0A 1DT9A 4FWOA 2P9KB 4NB4A 3LS6A 2FLOA 4JHDB 2Q2RA 3LL3A 3E66A 2VYPA 1ZBSA 4IEIA 1ILYA 3ENHA 2Q36A 1ESVA 2WUSA 1LOTB 4P8EA 2QWPA 1QZ5A 4CBWA 1NBWA 4Z94A 3WQTA 2BH1A 1X9JA 2QM1A 3R1XA 3FLCO 3OBWA 3IDHA 2V7ZA 1JCEA 1BU6O 3LDOA 3G25A 3C6HA 2P9BA 3PIOL 3ZIGA 2QWNA 3VENA 4BC4A 3VEVA 3A5LC 1VAZA 1VQON 4H0YB 1KC8O 1QQOA 4P6DA 3MCAB 1HKCA 5AQNA 1SS6A 3H3NO 3O6WA 3UE5A 4AM6A 2PAVA 4BRMA 4IEEA 4EIAA 3MN5A 3H07A 3MK5A 4WQ4A 3L0QA 1U6ZA 4BRNA 3BF1A 4CJ7A 3CCVN 4JD2A 3EO3A 4B1VA 5JMVA 3C6AA 4GNIA 3AARA 1K9MO 4G9ZA 3CJ9A 2V52B 1VQ6N 3K9JA 5AQKA 1VQNN 5I9EB 1Q81O 3RSEA 3W0LA 4YDUC 3VGMA 4CBXA 1ATSA 3D2EA 3IFRA 2P9PB 3N4QA 4PKGA 5EVZA 4CZEA 2HF3A 3CXCM 1TKUA 2PBDA 2HBKA 3HM8A 4JN4A 1BA0A 3PIPL 4CZHA 3DLLL 3HBTA 4QS8A 2QI2A 4AF1A 3VEWA 3SK3A 1HJOA 1NLVA 3AGKA 4XH1A 3SMSA 4PKIA 2AA4A 4BRIA 1JCUA 1Q7YO 4FWLA 5B8HA 4JKDA 5GAEP 3MGZA 5F0XA 5C2DA 1YVNA 5EXWA 4H5RA 4BRAA 1MDUB 3JXUA 5AZIB 3WEEB 2V7YA 1G57A 1YF5L 3HOTA 4WFNL 4EFHA 4ILJA 5M1PA 1XEZA 2FSJA 3ZEUB 4U7BA 1G99A 1QVFM 5AQXA 4RWTA 2A40A 2ZGYA 3LDQA 3VPZA 3O9RA 5GINA 1NGCA 1K8KB 3CCLN 3BP8A 3VTIA 2AP1A 2E20A 3Q7BA 5JLHA 3LQUA 4H0VB 1W97L 3C7NA 2Q31A 4KH4A 1Q86O 3VGKA 2GELA 2H3GX 4I14A 3FZKA 5KQDA 3UKUA 2QTDA 4IJNA 4FOIA 4IXCA 5AQTA 1YXQA 4JNEA 3IKMA 4IOAL 1Z05A 1VQ8N 4WF9L 2P9LB 3TSPA 3VGLA 5BR9A 1K73O 4O8KA 1BO5O 1YI2N 3F5TA 4JK7A 3KVGA 1NGJA 4CI6A 4OO1J 1X3MA 4ISGA 3AJEA 4MDAA 3HZ6A 4K43A 3T69A 3VEYA 1EO1A 1SNNA 4PKHA 2BTFA 2ZF5O 3LRJA 1U2VB 2Q0RA 3O9QA 3ATUA 5TKWA 1KAYA 4A2AA 1GLDG 1JCGA 3ZIHA 2YJEA 4BR5A 3QB0A 1HX1A 4OPAA 4KH5A 2P9SA 1MWKA 4JKEA 1C0GA 4YORA 4NZTM 4CD3A 3CMEN 1RDWX 2ITMA 3CCEN 5AQFA 4B1XB 3EN9A 4WFAL 2OTLN 3T7ZA 3VESA 1DGKN 2JWLA 1K4LA 2ZJPL 5AZJA 1JCFA 2NRRA 4P8JA 3M1FA 2P9NB 4MO4A 5AQMA 1GLBG 3C0BA 4R79A 4MLEA 5M1QA 5BPNA 1TKSA 3CD6N 1V4SA 3R6MA 3H46O 3ZYYX 1RFQA 3P39A 3ZX3A 5C12A 3L6QA 1YHQN 1YJ9N 3QBXA 5EX5A 5JLFA 4H0OA 1RDUA 4WCEL 4WQ5C 2DPNA 5LJVA 3CCQN 3DJCA 4O5FA 2NRVA 5M1FA 4ISEA 3OBYA 2E1YA 4H5VA 4BRPA 3OA9A 5KPRA 4JD2B 3O80A 3MDQA 1S22A 3CMAN 2QWQA 4IO9L 1WOQA 3L4QA 1Q18A 4J8FA 3BEXA 4FWNA 2YCHA 3JS6A 5GIPA 3QFUA 5BN9A 3A5MC 2I7PA 2J4RA 3TTDA 3VEXA 1KD1O 4YOYA 1MA9B 2KKZA 4FBWA 3SJHA 1ZC6A 3RSEB 1NMDA 2P9NA 3TSQA 3D2EB 1OKJA 3VETA 2GUPA 2W41A 2QWRA 3SBGA 4AM7A 5GAHP 3CQXA 4H5NA 4GY2B 3WQUA 1O13A 1NWKA 5AFUH 2IVOA 5AQLA 4BRFA 4CZKA 3J7ZO 3M5RA 3VOVA 2A3ZA 4CBUA 4QS9A 4FPBA 4U67L 3NMUA 3QICA 2GWKA 3DAWA 3P38A 1VQ5N 1NGDA 3EZWA 4EO0A 1HKGA 3KZBA 4BRKA 1Q82O 1VQPN 3AY9A 2V51B 2E2QA 5KPTA 3A5NC 4CZFA 4IOCL 3M6GA 1K4IA 3O08A 3M3ZA 3H6EA 5LJWA 3F9MA 4O8UA 5E26A 3VMFB 1K7JA 2BUPA 3O4WA 4A59A 4WYBA 4M7XA 4C23A 1SZ2A 3MN6A 2A41A 3FZLA 3QDKA 2WFBA 2CGLA 3C7NB 1QQMA 3LM9A 4IZ9A 4GV6A 1PVYA 3H3OB 3SBTA 4H0PA 3CCJN 3LDPA 3UKUB 3DXKA 3CCRN 1N8RO 3HSCA 4HVZA 1OVYA 2E2NA 2HF4A 3DWLA 1T6CA 4DHYA 2QW9A 4H5TA 3F2KA 3DXMA 4P77A 1R59O 2E88A 2Q0UA 4YOTA 4JKFA 1NGGA 1KAXA 3E9OA 1C0FA 4K42A 4IWVA 2LN3A 3CETA 4FBKA 3FFKB 3ULEA 5TKYA 2OANA 3G71N 1QVGM 4BRGA 4BQZA 2GX9A 3GG4A 3A8YA 4JAXA 1K4PA 3CF5L 4CZMA 3KWGA 1NGBA 2E8AA 3FZFA 4WQ4C 3U4LA 4BRHA 1E4FT 3E9LA 3P04A 5C10A 1GLAG 2NZTA 1DEJA 3EE8A 1HKBA 3WT0A 4DCHA 4A61A 1BUPA 1BOTO 3G4SN 4BQLA 3KWIA 4YOWA 5AFUA 2YJFA 2P9SB 2QWOA 3O9SA 1X3NA 2HMPA 1NGHA 2ZGZA 4A57A 3CHWA 4XH4A 2HBLA 3I33A 1TYQA 3GOIA 5AZJB 4JK9A 3U9ZA 1M90O 2E1ZA 3GE1A 3CCSN 4KBOA 1GLCG 1BA1A 4CZLA 1KAZA 4FWMA 3D6RA 3SAHA 2P9IA 3Q7CA 4ILHA 3CC4N 4M63C 3ENBA 3WXJA 3FZHA 3TTFA 1VQ4N 2NRZA 5M1OA 1YITN 1VQMN 3CC2N 3S41A 1WUAA 5AQYA 4CZGA 4FOEA 3VEOA 3VEZA 3MIOA 4YOVA 3AGRA 5GIOA 3NVMA 1YJNN 5KPZA 3IUCA 3CJBA 1GLJO 4BR0A 3VERA 2D4WA 3CI5A 2YHWA 1T44A 3VF4A 4BR7A 1VQKN 2D0OA 2RISA 2P9UA 3WXIA 3EL2A 5MLCQ 3EE9A 4BG9A 5ADXH 3OW2M 3D2FA 3OHRA 4FO0A 3ZIIA 4BGBA 4PL8A 3MCPA 3WXLA 1W2BM 3FR0A 3NVKA 2VGMA 1IG8A 2RE2A 4K25A 3I56N 3C65A 1GLLO 2WBNA 5C2FA 4B9QA 3MN7A 4BREA 4K41A 4UY8O 3N4PA 3HRGA 3CERA 4H0TB 4MDBA 4DKWA 2NRTA 2E2PA 1NGEA 4JKCA 4EAHD 5AQSA 4NO7A 3CJCA 3CCUN 5AQHA 5AQPA 1V4TA 5C0YA 4Y0WA 1GLEG 4JKGA 2Q1NA 2ASMA 2QXLA 5HOOA 4NZRM 3SAFA 3GDQA 1HLUA 4CD1A 5BN8A 5JVGL 1HPMA 2CGKA 3O1BA 3P4IA 3MX5A 2IIRA 4FWKA 3HOSA 1BDGA 3O9UA 4H03B 1P8ZA 3AAPA 4JKAA 5CE3A 4FWRA 4I6MA 3ZETA 2FF6A 3CJ1A 3CJ7A 2HBMA 3CJAA 2VCPA 2OTJN 5FPMA 1K4OA 3QMLA 3ID8A 2D0PA 1NGAA 4RTFD 4YDUA 4YOUA 2ASPA 3B8AX 3DXKB 1Z6RA 1XUPO 3TTCA 1SQKA 1NGFA 4MO5A 5DM7L 4A5AA 5AQUA 4FCXA 4MLHA 1S72N 2QWLA 4NLBA 3DXMB 3O9TA 2YX6A 2YHXA 3R3LA 4FWSA 1J6ZA 2F9TA 2F9WA 3E9PA 4FWQA 4IO8A 2QA4N 4E1BA 4BC5A 3R8EA 4FL9A 3MWTA 4YKEA 1KXPA 4ILGB 1NJIO 2EQAA 4OPHA 2A6AA 2F7TA 3ULEB 3MX2A 4ISFA 5AQWA 2NRWA 4JK8A 4FPAA 5AQOA 5JICA 1XC3A 3CQYA 5ADXA 1TUUA 1MWMA 5GAGP 5H1SQ 1QZ6A 3RVCA 2E2OA 3CPEA 3O1WA 3FE1A 3FZMA 3HI0A 3UB5A 4BR4A 1GLFO 1E4GT 4BRLA 3CPWM 3H1VX 2CH5A 4IFEA 1YJWN 3O5BA 3UKRA 4B1ZA 1TUYA 2W40A 2ASOA 3MK6A 1YUWA 1YIJN 1IJJA 5AQIA 1VQ7N 4EHUA 3ATVA 4L3QA 4F9OA 5C15A 4FWPA 2VWBA 1CZAN 4JKHA 3SAGA 1ATRA 2FF3B 5M1KA 3GBTA 3J8AA 1M1KO 4P6PA 2P9KA 2KHOA 3MWPA 1T3VA 1Y64A 1TYQB 4JHDA 4BG8A 1BG3A 5FPDA 3PLAA 5KQ8A 3I55N 1H1VA 2Q97A 5ELZA 3VF2A 4B1WB 5BREA 3ENOA 4CZIA 4DQ8A 3CC7N 2D1KA 4IOXA 2NRXA 2P9IB 1EQYA 1T6DA 3W3DA 1ZXOA 5AQQA 2IVNA 4C1NI 2GEMA 3A5OC 1BWFO 5BRHA 2NNWA 3VF6A 4NLCA 1VQLN 4LC9B 4H5WA 4A5BA 3SMPA 2IVPA 5GADP 5AQJA 3QBWA 3BUZB 4YOXA 2HSTA 3FGUA 2CGJA 3R9PA 3E1YA 5BRFA 2FSNA 2I7NA 2RHKA 2GWJA 4B1YB 5EOYA 4BVOA 1QQNA 5JVHL 4GV9A 2MX1A 1G58A 2GTDA 4BVPA 2P9UB 3LDLA 3LM2A 5E84A 4BRDA 3ZX0A 4EHTA 1PVWA 4HWIA 3D2FB 1RGIA 1K49A 3SLCA 3TU5A 4M7YA 4BRCA 2VGNA 2P9PA 4BY9C 2WC9A 4BGAA 2ZJQL 3WXMB 1JJ2M 5DM6L 3T1IA 3TSUA 1KK9A 5BPLA 5FPEA 4FBQA 1NM1A 3U9DA 4PL7A 4WFBL 4FSVA 1HRUA 2QWMA 2ZWHA 3WUHA 1KQSM 1K8AO 4BR9A 2JWKA 3LDNA 2FXUA 4B1UB 4H0XB 3ID6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VER A;  3VF4 A;  3VEW A;  3VEO A;  3VEZ A;  3TSP A;  3VTI A;  3VF2 A;  3VEN A;  3TTC A;  3TTF A;  3VTH A;  3TSQ A;  3VES A;  3TSU A;  3VET A;  3TTD A;  3VEX A; 
#chains in the Genus database with same CATH topology
 1X9S A;  4BRO A;  1JL2 A;  3BF3 A;  3S3O A;  1NK9 A;  4FJI A;  4XH5 A;  5AZI A;  2HNZ A;  4DTP A;  1CXQ A;  3H1Q A;  4OJR A;  4O55 A;  3V1O A;  3OJU A;  3H45 C;  4R5P A;  2YHY A;  4DSJ A;  2UYT A;  3D7E O;  4P6C A;  4IDH A;  3TAQ A;  3RMC A;  4EP4 A;  5CR4 A;  4FJ5 A;  2QK9 A;  2RIU A;  3O8M A;  4RW6 A;  4ELT A;  3WNF A;  4OLB A;  3MXJ A;  3ZT4 A;  3CIP A;  3A0I X;  4QS7 A;  3SCX A;  5BRD A;  4HTL A;  4FJK A;  3IMX A;  4C1N K;  4J2E A;  4E1J A;  1NJW A;  1DKG D;  4KI6 A;  4FJM A;  4BC2 A;  2HOE A;  2YHA A;  3HPO A;  3EZ5 A;  5KGX A;  4OPJ A;  3JSM A;  4F4K A;  1UOC A;  4FLY A;  4FWO A;  2P9K B;  3KTQ A;  2A1S A;  2FLO A;  1IKV A;  3HP6 A;  3D45 A;  2B5J A;  2WUS A;  3QET A;  1OH7 A;  1LOT B;  3SNN A;  2BH1 A;  1X9J A;  3C95 A;  2VWJ A;  3OYL A;  3IDH A;  4DR6 K;  2V7Z A;  4FW1 A;  1BQM A;  2JLE A;  4FJ8 A;  1S6Q A;  1A5V A;  4H0Y B;  1QQO A;  4P6D A;  4PY5 A;  5AQN A;  3H3N O;  4AM6 A;  2YNH A;  4BRM A;  3M8Q A;  1ZBH A;  1RBT A;  1TL1 A;  3MK5 A;  3BF1 A;  3HYF A;  3CCV N;  2PY5 A;  5FRO A;  4GNI A;  4I9Q A;  4NXM K;  1HJR A;  2W42 A;  4DLE A;  1VQN N;  2D0C A;  1B9F A;  4CBX A;  3D2E A;  1NG9 A;  4PKG A;  4CZE A;  4DQR A;  4X64 K;  2HF3 A;  3QEP A;  3PIP L;  2G8F A;  3HBT A;  2QI2 A;  1JE3 A;  4M3Z A;  1HJO A;  2LXR A;  4B3O A;  3SMS A;  4B9N A;  4CCH A;  1Q7Y O;  2FBX A;  3AO5 A;  1TAQ A;  4H5R A;  4AHS A;  2V7Y A;  1G57 A;  3HOT A;  4EFH A;  1S6P A;  1YTA A;  1NJX A;  3WBM A;  1XEZ A;  1Z26 A;  3LVJ C;  5M1P A;  1N32 K;  4DTU A;  3HVR A;  2XY5 A;  1N6Q A;  1NGC A;  1K8K B;  2E20 A;  1WSJ A;  3F9K A;  3QNO A;  3FZK A;  5KQD A;  3V4I A;  3UKU A;  3EYZ A;  4FOI A;  4DMN A;  1YXQ A;  4B9V A;  1RT2 A;  4IOA L;  1VQ8 N;  1ZBF A;  5BR9 A;  2Q3S A;  1HNZ K;  1BO5 O;  3VA3 A;  4CI6 A;  4JI5 K;  3RR8 A;  4ISG A;  1Y97 A;  2LSN A;  2XO7 A;  3AJE A;  4MDA A;  1U47 A;  3VEY A;  1EO1 A;  4CED A;  4JV5 K;  2BTF A;  4A2A A;  4IKF A;  4FZY A;  4B9S A;  3KIO A;  1MWK A;  2AJQ A;  2ITM A;  3CCE N;  4B1X B;  3G10 A;  2JWL A;  1EWQ A;  2P9N B;  5BPN A;  1TKS A;  1HPZ A;  1VRT A;  5C12 A;  4E19 A;  1YHQ N;  4OKK A;  1WLJ A;  4WQ5 C;  5KI6 A;  3AVC A;  3DJC A;  4KRE A;  2NRV A;  1WSH A;  4BRP A;  3VQP A;  4FJ7 A;  4JD2 B;  4IO9 L;  3NH1 A;  1WOQ A;  3L4Q A;  1JLQ A;  4FWN A;  5GIP A;  3JS6 A;  3A5M C;  2RKI A;  1RTJ A;  2KKZ A;  4FBW A;  1C1A A;  1ZC6 A;  4DSF A;  1NK0 A;  3VQC A;  1OKJ A;  1NFJ A;  3OYM A;  4I9L A;  2X6N A;  1NKB A;  2VG5 A;  4CHP A;  4H5N A;  4HCB A;  4GY2 B;  5K14 A;  4FLV A;  1O13 A;  1WNS A;  5AQL A;  4NCA A;  4CZK A;  3VOV A;  2W6L A;  2NUB A;  4U67 L;  3NMU A;  2GWK A;  1VQ5 N;  3BZK A;  2VWK A;  4EO0 A;  4E7H A;  4DS4 A;  4OGC A;  4BRK A;  5DK5 A;  3KKR A;  3A5N C;  4CZF A;  5C25 A;  2G8K A;  4AHU A;  5HLF A;  3OYB A;  1VSF A;  4W5O A;  4A59 A;  1C0M A;  1VSM A;  3MN6 A;  3QDK A;  1HYS A;  1PVY A;  1QQM A;  3H3O B;  2VQF K;  1SV5 A;  2EHG A;  4H0P A;  3CCJ N;  3SUP A;  1OVY A;  1GOC A;  3V1Q A;  4CF0 A;  3DWL A;  4DHY A;  2QW9 A;  3VQ4 A;  4DTN A;  1NFH A;  3V1R A;  1NGG A;  3JYT A;  1C1B A;  3VN5 A;  2KFN A;  4GKJ K;  3LDS A;  3G71 N;  3GG4 A;  3A8Y A;  3TAB A;  1NGB A;  3FZF A;  4FLX A;  1E4F T;  3SUQ A;  1JXE A;  4A61 A;  1BUP A;  3V9Z A;  3OYJ A;  4HCC A;  1XI1 A;  3OYF A;  2YHB A;  3VQ5 A;  1D9F A;  1X3N A;  1NK6 A;  4DQQ A;  4XH4 A;  3CHW A;  3K5O A;  4OGE A;  1TYQ A;  3GOI A;  1J53 A;  1T03 A;  3CCS N;  4KBO A;  1C0U A;  1BA1 A;  3DMJ A;  2O8B A;  3ASM A;  1I94 K;  3O4N A;  2EH1 A;  3D6R A;  3TAF A;  1JLG A;  3Q7C A;  4CEB A;  3ENB A;  3WXJ A;  1KFD A;  2IC3 A;  3VQD A;  1F21 A;  1VQM N;  1WUA A;  1LWE A;  4CZG A;  2YNI A;  4OLA A;  4M45 A;  1YJN N;  4CE9 A;  2OZM A;  3LPT A;  2QEX N;  4K88 A;  4KTW A;  3VER A;  2D4W A;  4Z0U A;  1RBU A;  4KRF A;  4DSI A;  4LF6 K;  5MLC Q;  1REV A;  3EE9 A;  4BG9 A;  5ADX H;  4G1Q A;  5KTQ A;  4FJX A;  4PL8 A;  1LWF A;  1ASW A;  4K25 A;  1RTH A;  3C65 A;  2WBN A;  3VQA A;  3ZCM A;  4BRE A;  3QIO A;  4K41 A;  3F73 A;  3HRG A;  1JDQ A;  2IS3 A;  1YT3 A;  2E2P A;  4BWM A;  4LD0 A;  4JKC A;  4O4G A;  1YTU A;  4NO7 A;  3OS0 A;  5AQH A;  5AQP A;  4CJL A;  1UAX A;  3KK1 A;  1GLE G;  1L3V A;  2Q1N A;  2OPQ A;  2QXL A;  2UUC K;  4Y1C A;  4NZR M;  4CD1 A;  4DU1 A;  2QXF A;  1VSK A;  4J2D A;  4Q0B A;  3DLE A;  1KRP A;  1EP4 A;  4F3T A;  3O9U A;  3AAP A;  4DV2 K;  1S9G A;  1L3U A;  2HBM A;  1QTM A;  2VCP A;  1G15 A;  4RTF D;  2YKN A;  4KV8 A;  1XUP O;  1EET A;  1SQK A;  1VSJ A;  5DM7 L;  3P5J A;  5AQU A;  3ZT1 A;  1S72 N;  4KPY A;  4NLB A;  3R3L A;  2YX6 A;  1TKU A;  2F9T A;  4CJE A;  1C6V A;  4AHC A;  4BC5 A;  1SL1 A;  2PYL A;  1KXP A;  4M3R A;  5HRP A;  2A6A A;  2UU9 K;  1VSL A;  3ULE B;  5AQW A;  2NRW A;  5AQO A;  4LF7 K;  1RNH A;  3AVH A;  1XC3 A;  2CRQ A;  5ADX A;  3RVC A;  3FE1 A;  4E7L A;  1E4G T;  4N5S A;  4PWD A;  1CZ9 A;  2ASO A;  2Q3V A;  2YNF A;  1ZYQ A;  1YIJ N;  5AQI A;  5JS2 A;  3I0S A;  3ATV A;  3QEV A;  1S1T A;  2O4G A;  3HPH A;  3GBT A;  2X6S A;  1Q8I A;  2P9K A;  1BCO A;  2OCE A;  3PLA A;  1XNR K;  1H1V A;  3HJF A;  1XC9 A;  5ELZ A;  2G8U A;  4QCL A;  1D8Y A;  2D1K A;  2BKY X;  2P9I B;  3HZ7 A;  1OH6 A;  1EQY A;  2IVN A;  4C1N I;  3OVN A;  1BWF O;  2NNW A;  3VF6 A;  3DLK A;  4NLC A;  2IVP A;  4I7F A;  3QBW A;  1RBV A;  2HST A;  3R9P A;  3E1Y A;  2I7N A;  1HC7 A;  3RWU A;  5EOY A;  3CFP A;  4CF2 A;  3RTV A;  3LM2 A;  3LDL A;  4EHT A;  4HWI A;  3D2F B;  1JXB A;  4AHR A;  2HVH A;  1RTD A;  4BY9 C;  2P51 A;  2GTC A;  3RR7 A;  3TAG A;  4FLW A;  4B3R K;  3IG1 A;  5LMN K;  1KQS M;  4FJN A;  3CM5 A;  2JWK A;  3LDN A;  2FXU A;  4B9M A;  4DF4 A;  4H0X B;  3WNH A;  1BIU A;  3ZT0 A;  4RW9 A;  1Q9Y A;  4B3M K;  2BAN A;  3QO9 A;  2UXB K;  2NLX A;  2UUA K;  1A5W A;  2ZJR L;  2FSK A;  2G8I A;  4KH6 A;  2Y1J A;  4C8L A;  1D4X A;  2GV9 A;  3BY5 A;  4E1N A;  1K8K A;  4JEP A;  1TKT A;  5AQZ A;  4FFJ A;  4EP5 A;  3VQE A;  3MXM A;  2A5X A;  2RF2 A;  5AQR A;  4CJS A;  5IT9 O;  4BC3 A;  3ZSO A;  4OPK A;  4FCY A;  4BRQ A;  1IEZ A;  4FJJ A;  3HK2 A;  2HHW A;  1TIG A;  1RT6 A;  3SUN A;  3I8D A;  4PHT X;  4HHT A;  1N36 K;  2HBJ A;  3LAN A;  4RCH A;  1HQE A;  4DSK A;  2ZQB A;  3OJS A;  5JS1 A;  1TL3 A;  4RG8 A;  3TAE A;  3U8X A;  1H4S A;  1N34 K;  1JLB A;  4BE2 A;  2FBT A;  5AR0 A;  3LWM A;  1DT9 A;  3NF7 A;  4NB4 A;  3LS6 A;  4JHD B;  2G8W A;  3E66 A;  2VYP A;  3V9S A;  2IFE A;  2XRI A;  1ESV A;  3DSC A;  2HHQ A;  4UQG A;  3V9U A;  4E1M A;  4ZTF A;  1IKW A;  3K58 A;  1BU6 O;  3LAK A;  2D5R A;  4YFU A;  1T8E A;  3C6H A;  2QWN A;  4DUZ K;  5HP1 A;  3SQ0 A;  1VQO N;  3MCA B;  3O6W A;  5SZT A;  4DFP A;  3DLG A;  4IEE A;  1XMQ K;  3MN5 A;  2IGI A;  3H07 A;  4I2P A;  4CHN A;  1L3S A;  1HMV A;  4CK3 A;  4JD2 A;  3OS2 A;  1ZBI A;  1NJZ A;  2OA8 A;  5JMV A;  1TK8 A;  1VSI A;  3AAR A;  4G9Z A;  4O5B A;  3CJ9 A;  2V52 B;  2ATQ A;  4FXD A;  5I9E B;  4HTU A;  4KHS A;  4YDU C;  1ATS A;  1IG9 A;  3EEQ A;  3IFR A;  2HBK A;  3NFA A;  3VEW A;  3SK3 A;  2XY8 A;  1QS4 A;  3H08 A;  4XH1 A;  4RW7 A;  1JCU A;  4DV7 K;  4JKD A;  1IBL K;  1YVN A;  3TAP A;  4N41 A;  3ITH A;  4WFN L;  3B6O A;  4DTS A;  4CJT A;  3ZEU B;  3K5L A;  4U7B A;  1G99 A;  1DCJ A;  4RWT A;  2ZGY A;  3LDQ A;  5GIN A;  3O9R A;  3P1G A;  3CCL N;  3OY9 A;  3Q7B A;  4H0V B;  3TOE A;  2Q31 A;  4KH4 A;  3OYK A;  2X74 A;  4FZX C;  4IJN A;  1Z05 A;  1MU2 A;  4WF9 L;  3VGL A;  3TSP A;  3OYD A;  1K73 O;  1YI2 N;  4JK7 A;  1NGJ A;  3A2F A;  4IFY A;  3V81 A;  3AVK A;  4Z4H A;  5C42 A;  2BE2 A;  3HZ6 A;  4K43 A;  1TGO A;  3T69 A;  1SNN A;  3KK3 A;  2P5G A;  4CHQ A;  1U2V B;  5TKW A;  4KHY A;  2YJE A;  3ZIH A;  4CJK A;  4HUE A;  1NKE A;  3DRR A;  4TSX A;  4B9U A;  3AVA A;  3CME N;  1RDW X;  3QIP A;  1IV0 A;  3QEI A;  3EN9 A;  4WFA L;  2E5L K;  3KLH A;  1K4L A;  2ZJP L;  1JCF A;  2IAJ A;  3M1F A;  4MO4 A;  1GLB G;  4R79 A;  4MLE A;  5M1Q A;  2XHB A;  1RFQ A;  1XNQ K;  3L6Q A;  4DFK A;  1YJ9 N;  4DV1 K;  1JO0 A;  4DR7 K;  1YVU A;  4H0O A;  2DFE A;  1SUQ A;  3RRH A;  3CCQ N;  1KVB A;  3OBY A;  1NU0 A;  2HND A;  3MDQ A;  1S22 A;  4CGH A;  3CMA N;  3THW B;  2DFH A;  5BN9 A;  3ALY A;  2I7P A;  3G0Z A;  3TTD A;  5J2P A;  1NJY A;  4YOY A;  4DTM A;  1MA9 B;  4DV3 K;  3T19 A;  1I39 A;  3VET A;  2W41 A;  4FM0 A;  2YV0 X;  3SBG A;  4CF1 A;  3LVK B;  5GAH P;  1Y2I A;  3CQX A;  5AFU H;  4M3W A;  4J2B A;  3OYI A;  1SL2 A;  4LSN A;  3DAW A;  3CG7 A;  3VQ8 A;  4CIF A;  1FW6 A;  2E2Q A;  3QIN A;  4FJL A;  4IOC L;  4KTQ A;  3O08 A;  4GKK K;  5LJW A;  3VMF B;  2HW3 A;  2BUP A;  4CFA A;  4CEZ A;  4WYB A;  4M7X A;  4C23 A;  1SZ2 A;  3NAE A;  4BAC A;  1CZB A;  4C8K A;  3OYH A;  3TR8 A;  2HMI A;  3LM9 A;  4IZ9 A;  4HD0 A;  4J2A A;  3HO1 A;  3SBT A;  1WBB A;  3DLR A;  1N8R O;  1T6C A;  4H5T A;  3V9W A;  2Z1I A;  3LZI A;  2E88 A;  2Q0U A;  4DTR A;  3NCI A;  1N33 K;  1KAX A;  2Z1G A;  2UXC K;  1LN4 A;  3ULE A;  2OAN A;  4HVJ A;  2GX9 A;  4CF8 A;  2P5O A;  4MFB A;  3U4L A;  4BRH A;  1NK4 A;  3E9L A;  1GLA G;  1DEJ A;  3WT0 A;  1BOT O;  3AVB A;  3CFO A;  4BQL A;  1O1W A;  4YOW A;  3SQ2 A;  5AFU A;  1Z25 A;  1EWR A;  2P9S B;  4B08 A;  5I3U A;  2QWO A;  4LFB K;  1NGH A;  4HUF A;  2BGG A;  3I33 A;  1BL3 A;  5AZJ B;  3U9Z A;  2E1Z A;  3GE1 A;  4CZL A;  2O4I A;  1KAZ A;  2E4L A;  3DOK A;  1N5Y A;  2G8V A;  2P9I A;  2EK0 A;  3FZH A;  1VQ4 N;  3U3G A;  5M1O A;  3NDK A;  3CC2 N;  5CY4 A;  4FOE A;  2Z1H A;  1KLN A;  3VEO A;  3VEZ A;  4JI7 K;  4YOV A;  3AGR A;  5GIO A;  3NVM A;  5KPZ A;  3CJB A;  3CI5 A;  4BR7 A;  2YHW A;  1T44 A;  2RIS A;  3AA4 A;  1S1X A;  4OX9 K;  4FM2 A;  3OW2 M;  3D2F A;  3O3F A;  3FR0 A;  3VQB A;  3V6D A;  3ISN C;  1H0Y A;  3SUO A;  4UY8 O;  4H0T B;  4FJ9 A;  1HNX K;  4MDB A;  3J7Y P;  4CGD A;  3NF8 A;  4OKE A;  1WBD A;  2Y1B A;  4EAH D;  5AQS A;  5KGW A;  3ZSY A;  3CCU N;  4FK0 A;  3AA3 A;  4CFB A;  5HRN A;  5JVG L;  1X1P A;  3P4I A;  3MX5 A;  1Y9X A;  3AO2 A;  1BDG A;  4H4O A;  3M8P A;  2FF6 A;  3CJ1 A;  3PO4 A;  2OTJ N;  5FPM A;  1ITG A;  1QSY A;  4JI2 K;  1NGA A;  4X62 K;  4YOU A;  2ASP A;  3B8A X;  4JI3 K;  3DXK B;  1RT5 A;  3TTC A;  4MO5 A;  1NGF A;  3NGZ A;  4LH5 A;  2QWL A;  1BQN A;  4IO8 A;  2YHX A;  4FWS A;  1J6Z A;  1U49 A;  1NK8 A;  2QA4 N;  4LF8 K;  2EQA A;  1QHT A;  1WSE A;  4ZTJ A;  5GAG P;  1I3A A;  5H1S Q;  4Y1D A;  3CPE A;  3O1W A;  3FZM A;  3UB5 A;  4BRL A;  4IFE A;  2CH5 A;  3O3H A;  3HP9 A;  2W40 A;  1NK5 A;  2KTQ A;  3QLH A;  4L3Q A;  5T7B A;  4FWP A;  1DTT A;  4JKH A;  1D9D A;  5M1K A;  1RBS A;  1T3V A;  4JHD A;  4CEQ A;  4M3X A;  5KQ8 A;  3I55 N;  1U48 A;  4BWJ A;  1W9H A;  3U6F A;  4DQ8 A;  1H0X A;  3W3D A;  3HVT A;  5AQQ A;  2GEM A;  4M41 A;  3AVL A;  3AVG A;  1VQL N;  4LC9 B;  4H5W A;  5CYM A;  4JS5 A;  1EXQ A;  2FSN A;  2A1R A;  1HRH A;  2MX1 A;  4DR1 K;  1TV6 A;  1A5X A;  2P9U B;  2OYQ A;  1FKP A;  1PVW A;  1RGI A;  3SV3 A;  5IWA K;  2O8D B;  4BRC A;  2BDP A;  4TWA A;  5DM6 L;  3T1I A;  3THV A;  5BPL A;  5FPE A;  1IKY A;  4FBQ A;  3L3V A;  2VQE K;  1HRU A;  4FSV A;  4B1U B;  3J7A P;  4AHT A;  4Z9E A;  5FDL A;  1NGI A;  1EX4 A;  1RT7 A;  3I8B A;  4DWI A;  3GL1 A;  5EY4 A;  3TPQ A;  4DB3 A;  5BPM A;  3KLG A;  3AO3 A;  1S3X A;  1P90 A;  3ZEU A;  5CYQ A;  4BR2 A;  1RT1 A;  4DUY K;  3SQ1 A;  3ZET B;  4JRQ A;  4FVU A;  5M1N A;  2KZZ A;  1R0A A;  1FJG K;  1S1U A;  1XQS C;  3SPZ A;  5F2R A;  4N47 A;  3MMV A;  4FJH A;  3EKS A;  3RMB A;  4FYD A;  4IJA A;  3O3G A;  2CH6 A;  4MQ3 A;  3V9X A;  4LF5 K;  2PFU A;  4CHZ A;  2ZM6 K;  1LAW A;  2E6M A;  4B3T K;  1RTI A;  5AQV A;  4A62 A;  3L4I A;  3ZX2 A;  3KD5 E;  4M3U A;  2D0B A;  2QKK A;  1VQ9 N;  1ATN A;  4OVL A;  4DQI A;  1CXU A;  2KLA A;  3AAQ A;  4W5N A;  3UKR B;  3IAL A;  3L7V A;  1TKD A;  1U2V A;  1RIL A;  3IAB B;  1WSF A;  4GV3 A;  1U04 A;  3KHY A;  4XEI A;  3T3F A;  4K8Z A;  3NHG A;  3CCM N;  4NYN A;  2FBY A;  2XY6 A;  3LL3 A;  4IEI A;  4P8E A;  1QZ5 A;  4CBW A;  1K6Y A;  3WQT A;  2WTU A;  2QM1 A;  2WOM A;  3FLC O;  1TVR A;  3HL8 A;  3R1X A;  4Z4C A;  3RMD A;  1SKR A;  5FLX O;  1BHL A;  5SWM A;  1QSL A;  3HT3 A;  5J1E A;  3ZIG A;  3VEN A;  3VEV A;  3A5L C;  1VAZ A;  1QE1 A;  1HKC A;  4CEF A;  4WQ4 A;  3MED A;  4DV4 K;  4BRN A;  1NJ8 A;  3THW A;  1XMO K;  4CGG A;  1XWL A;  1K9M O;  2Z1J A;  4E7I A;  2OPP A;  3NE6 A;  2O8F B;  5HRS A;  3CXC M;  4CFD A;  2PBD A;  3HM8 A;  3DLL L;  4CZH A;  4QS8 A;  2OPR A;  4AF1 A;  4CEE A;  4DFJ A;  4PKI A;  4BRI A;  3TAM A;  4FWL A;  4NXN K;  5B8H A;  5GAE P;  3MGZ A;  4IDK A;  5F0X A;  4DV5 K;  4B8A B;  5C2D A;  5EXW A;  1U4B A;  3WEE B;  1YF5 L;  3BGR A;  1UDV A;  3K57 A;  3AA2 A;  4ILJ A;  2FSJ A;  3L2Q A;  4KHN A;  2UUB K;  1T7P A;  4OLF A;  3BP8 A;  3VTI A;  5JLH A;  4IG0 A;  1W97 L;  5CZ1 A;  4KB1 A;  1H4Q A;  4CJ3 A;  2GEL A;  3S9H A;  3M8R A;  2QTD A;  4IXC A;  4FLZ A;  2KW4 A;  4JNE A;  5CZ2 A;  5HBM A;  3L2W A;  2KQ2 A;  5HRO A;  3K5M A;  2P9L B;  4O8K A;  5KRT A;  3F5T A;  4OO1 J;  1X3M A;  4KTZ A;  4LF4 K;  4K8X A;  4PKH A;  3LAM A;  2QKB A;  2Q0R A;  1KAY A;  1GLD G;  4N56 A;  2DFF A;  4OPA A;  4KH5 A;  3QEW A;  2P9S A;  4FZZ A;  1C0G A;  3NBP A;  4YOR A;  1QQC A;  4CK1 A;  4ID1 A;  2OTL N;  3VES A;  1DGK N;  4NCX A;  5AZJ A;  4P8J A;  5AQM A;  3C0B A;  4CHO A;  3K59 A;  3CD6 N;  4XIU A;  1V4S A;  3H46 O;  3VQ6 A;  3ZYY X;  3P39 A;  3ZX3 A;  2I5J A;  3QBX A;  5EX5 A;  5JLF A;  1RDU A;  3SI6 A;  2DPN A;  4O5F A;  1S1V A;  2E1Y A;  4H5V A;  1IBM K;  1HNV A;  4CJ5 A;  3BZC A;  2B4J A;  4K86 A;  4DR3 K;  4J8F A;  2HHV A;  3BEX A;  2YCH A;  5LL6 Z;  2J4R A;  4ICL A;  4FLT A;  3VEX A;  2E6L A;  1KD1 O;  2R7Y A;  3B6P A;  2H9U A;  1VM0 A;  2B6A A;  3RSE B;  1NMD A;  2P9N A;  3KJV A;  4KHP K;  4NCG A;  4AM7 A;  4BDZ A;  3AO4 A;  1KVA A;  3MEG A;  5KRS A;  1NWK A;  4BRF A;  1II7 A;  3J7Z O;  4CBU A;  2A3Z A;  1FXX A;  4QOZ B;  4FPB A;  3AO1 A;  1B92 A;  3QIC A;  3OTO K;  4GVM A;  1NGD A;  3EZW A;  1HKG A;  4LH4 A;  3ZT2 A;  3VQQ A;  1OH8 A;  1OH5 A;  1VQP N;  2V51 B;  5KPT A;  4BE1 A;  1C1C A;  3MEC A;  3M6G A;  1K4I A;  1VSD A;  3LP2 A;  3H6E A;  3SZ2 A;  1K7J A;  1VSH A;  2WFB A;  3C7N B;  2L8Y A;  3ZSV A;  3LDP A;  3PX0 A;  3DXK A;  3CCR N;  3HSC A;  3PSF A;  2E2N A;  3MAQ A;  3ZLJ A;  3F2K A;  3WNG A;  1R59 O;  4CER A;  4JKF A;  4CJU A;  3E9O A;  1C0F A;  3CET A;  4FBK A;  5TKY A;  3U3Y A;  1PAV A;  4YY3 K;  3L3U A;  3VQ7 A;  3ZSQ A;  4BQZ A;  3OYA A;  3CF5 L;  4CZM A;  3LP0 A;  1VSE A;  4B9L A;  1S8E A;  5BR8 K;  4IFV A;  2NZT A;  3EE8 A;  1HKB A;  4DCH A;  3SQ4 A;  3KKS A;  3G4S N;  4YNQ A;  4DTO A;  3K0S A;  3MXI A;  2PZS A;  2HMP A;  3PY8 A;  4A57 A;  3QER A;  2HBL A;  2YKM A;  4JK9 A;  3OYG A;  1M90 O;  4EZ6 A;  1KFS A;  4E89 A;  3CC4 N;  4M63 C;  2FC0 A;  4KB0 A;  3AV9 A;  2NRZ A;  4DQP A;  3S41 A;  1X9W A;  2IOC A;  4BR0 A;  1GLJ O;  3VF4 A;  4F2R A;  2O8C B;  1JLE A;  2P9U A;  3WXI A;  3TI0 A;  3EL2 A;  2GUI A;  4K0K K;  3OHR A;  4FO0 A;  3ZII A;  4PQU A;  3WXL A;  1RBR A;  4DU4 A;  1W2B M;  2O8D A;  3NVK A;  2VGM A;  1IG8 A;  4M3Y A;  2RE2 A;  1GLL O;  3AVM A;  5C2F A;  4B9Q A;  3IS9 A;  3CER A;  1SKS A;  2KFZ A;  3CQ8 A;  1CLQ A;  4DKW A;  2NRT A;  2HNY A;  1LV5 A;  1V4T A;  5C0Y A;  1NOZ A;  4Y0W A;  1J54 A;  3AVF A;  3ZSX A;  1S9E A;  2ASM A;  2XY7 A;  3DI6 A;  3GDQ A;  1HLU A;  5BN8 A;  3PO5 A;  1HPM A;  2CGK A;  4DV6 K;  4H8K A;  1P8Z A;  5CE3 A;  1C0T A;  3ZET A;  3C6U A;  1D5A A;  3QML A;  3QEX A;  4W5R A;  3CFR A;  3ID8 A;  3ZT3 A;  3M8S A;  1KVC A;  1GOB A;  3J80 O;  1BGX T;  1NMN A;  3ULD A;  1H4T A;  3TAN A;  4FCX A;  4MLH A;  1RDA A;  3PV8 A;  4C8M A;  3DXM B;  3AVI A;  3QNN A;  4E1B A;  4C8O A;  4FL9 A;  3MWT A;  4YKE A;  1NJI O;  2F7T A;  5C24 A;  3MX2 A;  4LFC K;  3VQ9 A;  1OVQ A;  4FPA A;  5JIC A;  4NYF A;  1MWM A;  1QZ6 A;  3FFI A;  3K2P A;  3CPW M;  4DF8 A;  3UKR A;  3THY B;  3IAB A;  1VQ7 N;  4F9O A;  1CZA N;  3SAG A;  4F3O A;  3J8A A;  4P6P A;  3MWP A;  1Y64 A;  5FPD A;  3T1A A;  1UA0 A;  4Q15 A;  3L8B A;  3I0R A;  2HHS A;  1DLO A;  2GBZ A;  3ENO A;  4CZI A;  4CJV A;  3CC7 N;  4IOX A;  3THX B;  2O8E B;  1T6D A;  1ZXO A;  4Z4I A;  3IRX A;  4ELU A;  1W0H A;  3A5O C;  4E3S A;  4JLH A;  2IDO A;  3T1Y K;  4O44 A;  4B3S K;  3SMP A;  5AQJ A;  3BUZ B;  2UXD K;  3FGU A;  1L5U A;  4FW2 A;  1IH7 A;  2RHK A;  3NH2 A;  2YNG A;  4F2S A;  2GWJ A;  4B1Y B;  3PSI A;  1QQN A;  4KFB A;  4CJP A;  2GTD A;  4EZ9 A;  1RDD A;  1K49 A;  1RDB A;  3SLC A;  5J2N A;  4Q5V A;  5I42 A;  2O8F A;  2VGN A;  2WC9 A;  4BGA A;  3WXM B;  3TSU A;  1WN7 A;  3L2V A;  1KK9 A;  4W5Q A;  1NM1 A;  4PL7 A;  4WFB L;  1HR0 K;  3WUH A;  4CEC A;  1K8A O;  4L8R B;  2RN2 A;  1VQ6 N;  3S3M A;  1HYZ A;  5AQG A;  4JKG B;  5AJ3 K;  2JGU A;  1WAF A;  2VG6 A;  4WQ5 A;  3VTH A;  3DM2 A;  2HHH K;  3QFP A;  5CHI A;  3WEE A;  4KI4 A;  2EX3 A;  3G6E N;  1BIZ A;  5LY3 A;  1E3M A;  1U45 A;  4A2B A;  4BDY A;  3ZSZ A;  4JI1 K;  4I6M B;  1W7A A;  3WXK A;  5F1X A;  3BDP A;  3OYN A;  1SAZ A;  3O4Q A;  2NRH A;  3SV4 A;  1LCU A;  5HL7 L;  5EU7 A;  4GVE A;  4KHQ A;  3P83 D;  4RW8 A;  2OZS A;  3MN9 A;  4YHH K;  2P9L A;  4BE0 A;  4CVN E;  3AVN A;  2HHU A;  4CGJ A;  3EKU A;  1BI4 B;  1QHA A;  4JI8 K;  2A42 A;  1YAG A;  1BIS A;  3QKB A;  2YI1 A;  5A2Q O;  3ZSW A;  2EWS A;  3HTV A;  4CZJ A;  3ZIE A;  5FPN A;  5J2M A;  3DOL A;  1HUX A;  3P31 A;  3LPU A;  3DLH A;  3LP3 A;  3K9K A;  4JKB A;  3KK7 A;  1B9D A;  3UIQ A;  1T05 A;  4LFA K;  2Q2R A;  1ILY A;  3KLE A;  1ZBS A;  3ENH A;  2Q36 A;  2QWP A;  1BCM A;  1NBW A;  4Z94 A;  1SKW A;  1EKE A;  4CJ4 A;  3OBW A;  2HB5 A;  4YDQ A;  1JCE A;  3LDO A;  3G25 A;  2P9B A;  3PIO L;  4V19 S;  4BC4 A;  3MEE A;  1KC8 O;  3LZJ A;  1SS6 A;  3UE5 A;  2PAV A;  4EIA A;  4B9T A;  3L0Q A;  1U6Z A;  4CJ7 A;  4O0I A;  2Y1I A;  2M71 A;  3EO3 A;  4B1V A;  3KLF A;  3C6A A;  4DLG A;  3K9J A;  5AQK A;  4K87 A;  1WB9 A;  2PYJ A;  3DLB A;  1Q81 O;  3RSE A;  3W0L A;  3VGM A;  3CM6 A;  4GMJ B;  4AHV A;  4GW6 A;  3N4Q A;  2P9P B;  5EVZ A;  3NH0 A;  3L2R A;  4WI1 A;  4JN4 A;  1BA0 A;  5D3G A;  2VG7 A;  1NLV A;  3ZSR A;  3AGK A;  2AA4 A;  4FVM A;  3OYE A;  4BRA A;  1MDU B;  3JXU A;  5AZI B;  4CHY A;  1SL0 A;  1NJ6 A;  4RW4 A;  2FBV A;  1QVF M;  5AQX A;  4CJF A;  4X65 K;  2A40 A;  3VPZ A;  1LW2 A;  2AP1 A;  4DR2 K;  3LQU A;  1IBK K;  1DTQ A;  3C7N A;  1Q86 O;  3VGK A;  2H3G X;  4I14 A;  5AQT A;  3IKM A;  2G8H A;  4F8R A;  2A2Y A;  1GOA A;  4N76 A;  2DTU A;  1KSP A;  4AQY K;  4CJW A;  4PA1 A;  1JL1 A;  4E0D A;  1NK7 A;  3KVG A;  4E7K A;  4ZHR A;  4X66 K;  4M42 A;  2ZF5 O;  1J5O A;  3LRJ A;  3HPG A;  3HST B;  3O9Q A;  3ATU A;  1JCG A;  2KZM A;  1LW0 A;  4BR5 A;  3QB0 A;  1HX1 A;  1ASV A;  4JKE A;  4NZT M;  4CD3 A;  5AQF A;  5LMU K;  3T7Z A;  3S3N A;  4I2Q A;  4DU3 A;  2NRR A;  3TWH A;  3R6M A;  1VRU A;  4DR4 K;  1TKZ A;  4O0J A;  4WCE L;  3JAM O;  5LJV A;  3AA5 X;  5M1F A;  4ISE A;  4CES A;  2X78 A;  3PX4 A;  3OA9 A;  5KPR A;  3O80 A;  5HRR A;  2QWQ A;  3AVJ A;  1Q18 A;  2O8C A;  4JYA K;  3QFU A;  4CW7 B;  1X9M A;  4DTX A;  4HUG A;  4KHW A;  3SJH A;  3TSQ A;  3D2E B;  1ZBL A;  2GUP A;  2QWR A;  1IO2 A;  3LWL A;  2HVI A;  2W6K A;  3J81 O;  4KHU A;  3WQU A;  4CIG A;  4E7J A;  2IVO A;  3M5R A;  1LAV A;  4QS9 A;  1S5J A;  4CIE A;  3P38 A;  1TKX A;  4DSL A;  2ZD1 A;  3PX6 A;  3KZB A;  1Q82 O;  3AY9 A;  4H4M A;  1UA1 A;  3VA0 A;  3M3Z A;  3L2U A;  4JI6 K;  4LF9 K;  2HHX A;  3F9M A;  4O8U A;  1NH9 A;  5E26 A;  2HHT A;  3C6T A;  1WSG A;  3O4W A;  3SJJ A;  2A41 A;  3FZL A;  4GV6 A;  2CGL A;  3HXM A;  3UKU B;  4HVC A;  4HVZ A;  2HF4 A;  1QSS A;  1KCF A;  4P77 A;  3DXM A;  5FRM A;  1S1W A;  4YOT A;  2DY4 A;  3HM9 A;  1NKC A;  1L3T A;  4ELV A;  4K42 A;  4IWV A;  3SPY A;  2LN3 A;  3PUF A;  3FFK B;  2ETJ A;  1QVG M;  1JLA A;  4AIL C;  4BRG A;  4JAX A;  2D0A A;  1K4P A;  3KWG A;  2E8A A;  4WQ4 C;  5C10 A;  3P04 A;  1HYV A;  3KK2 A;  1VK0 A;  3NF6 A;  3THY A;  3KWI A;  3DRP A;  2YJF A;  4FK4 A;  3IAY A;  3O9S A;  3DSD A;  4LY7 A;  2ZGZ A;  1WSI A;  4CEA A;  1FKO A;  1GLC G;  3QES A;  3LAL A;  1RT4 A;  4FWM A;  4W5T A;  1NOY A;  3SAH A;  4FM1 A;  4ILH A;  3THX A;  4FK2 A;  2O8E A;  3TTF A;  1JLF A;  2F4V K;  3CYM A;  4B8C A;  1YIT N;  5AQY A;  1LWC A;  3MIO A;  1Q9X A;  4Z4F A;  2F8T A;  1NJ5 A;  5E41 A;  4Z4E A;  3IUC A;  4DSE A;  1NNE A;  1VQK N;  4BDP A;  2D0O A;  4JI0 K;  1RDC A;  4DR5 K;  4IBN A;  4BGB A;  4Z4G A;  2RPI A;  4M3T A;  3MCP A;  1VHX A;  1VR4 A;  1RT3 A;  4KAZ A;  3I56 N;  4OKJ A;  3MN7 A;  1JKH A;  4FLU A;  3N4P A;  3RRG A;  1IKX A;  1XHX A;  4CJQ A;  1NGE A;  4DG1 A;  3CJC A;  3WNE A;  4CK2 A;  4JKG A;  3OS1 A;  4WE1 A;  5HOO A;  3SAF A;  1J5E K;  3O1B A;  4NCB A;  1TAU A;  4JS4 A;  2IIR A;  1UWB A;  1ZBU A;  4FWK A;  3HOS A;  4H03 B;  4JKA A;  3DRS A;  4FWR A;  4I6M A;  3CJ7 A;  4CGF A;  3CJA A;  1K4O A;  2ITG A;  3C94 A;  2D0P A;  4YDU A;  1Z6R A;  3TAR A;  1HNW K;  2Z7C A;  4A5A A;  4QAG A;  3O9T A;  4FWQ A;  3E9P A;  2F9W A;  3LP1 A;  4CFC A;  3R8E A;  4ILG B;  1FK9 A;  4OPH A;  1BI4 A;  4ISF A;  1RQ8 A;  1TK5 A;  4JK8 A;  4IG3 A;  3CQY A;  1WAJ A;  1TUU A;  2OPS A;  2E2O A;  3HI0 A;  4BR4 A;  3NGI A;  1GLF O;  1RCH A;  3H1V X;  1YJW N;  1KTQ A;  3O5B A;  4B1Z A;  1TUY A;  2WON A;  2F96 A;  3KD1 E;  3MK6 A;  1YUW A;  1IJJ A;  3RMA A;  4JRP A;  4CF9 A;  4KKO A;  5C15 A;  2P1J A;  2VWB A;  1TK0 A;  1ATR A;  2FF3 B;  3U6Y A;  1M1K O;  2KHO A;  5J2Q A;  2F8S A;  1TYQ B;  4BG8 A;  3SYZ A;  1BG3 A;  5FRN A;  3T1H K;  1NJ2 A;  2Q97 A;  4B1W B;  3VF2 A;  5BRE A;  2O8B B;  1NJ1 A;  2NRX A;  3E01 A;  1JLC A;  4DTJ A;  1J9A A;  4DFM A;  5BRH A;  4AH9 A;  4A5B A;  5GAD P;  4JI4 K;  3D0P A;  5DMR A;  4CGI A;  4PUO A;  4YOX A;  2CGJ A;  5BRF A;  3K5N A;  3EY1 A;  4FJG A;  4BVO A;  5JVH L;  4GV9 A;  4DS5 A;  1G58 A;  4BVP A;  5E84 A;  4DV0 K;  4BRD A;  3ZX0 A;  4CEO A;  2ZE2 A;  3DYA A;  3TU5 A;  4KO0 A;  4M7Y A;  3NF9 A;  4C8N A;  1ASU A;  2P9P A;  2ZJQ L;  3NGY A;  1KLM A;  1JJ2 M;  1XHZ A;  4LSL A;  4DQS A;  3OYC A;  4CJR A;  1HQU A;  3U9D A;  4ID5 A;  2QWM A;  2ZWH A;  1HNI A;  4BR9 A;  3KLI A;  4EHU A;  3ID6 A; 
#chains in the Genus database with same CATH homology
 5AQG A;  4JKG B;  4BRO A;  3BF3 A;  1NGI A;  4WQ5 A;  3VTH A;  3QFP A;  5CHI A;  3WEE A;  4XH5 A;  3I8B A;  5AZI A;  3GL1 A;  5EY4 A;  3TPQ A;  4DB3 A;  3G6E N;  2NLX A;  5BPM A;  5LY3 A;  3H1Q A;  2ZJR L;  1S3X A;  2FSK A;  1P90 A;  3ZEU A;  4A2B A;  4KH6 A;  4BR2 A;  1D4X A;  4I6M B;  3ZET B;  3H45 C;  2YHY A;  3WXK A;  5F1X A;  1K8K A;  4JEP A;  4FVU A;  5M1N A;  5AQZ A;  1SAZ A;  1XQS C;  2UYT A;  3D7E O;  5F2R A;  4IDH A;  4FFJ A;  4P6C A;  2NRH A;  3MMV A;  1LCU A;  5HL7 L;  2A5X A;  4GVE A;  5AQR A;  5CR4 A;  2RIU A;  3O8M A;  4BC3 A;  3EKS A;  3MN9 A;  4IJA A;  2CH6 A;  4BRQ A;  2P9L A;  1IEZ A;  2PFU A;  3EKU A;  2QEX N;  1QHA A;  3CIP A;  5AQV A;  4A62 A;  2A42 A;  3A0I X;  1YAG A;  3L4I A;  4QS7 A;  3ZX2 A;  4PHT X;  5BRD A;  4HTL A;  3IMX A;  2HBJ A;  4C1N K;  2YI1 A;  1ATN A;  4E1J A;  1VQ9 N;  1DKG D;  4RCH A;  2EWS A;  3HTV A;  2KLA A;  3ZIE A;  4CZJ A;  5FPN A;  1HUX A;  4BC2 A;  3AAQ A;  3P31 A;  2HOE A;  3UKR B;  3L7V A;  1U2V A;  3U8X A;  4GV3 A;  3KHY A;  3K9K A;  4XEI A;  4JKB A;  3KK7 A;  3CCM N;  5AR0 A;  1DT9 A;  4FWO A;  2P9K B;  4NB4 A;  3LS6 A;  2FLO A;  4JHD B;  2Q2R A;  3LL3 A;  3E66 A;  2VYP A;  1ZBS A;  4IEI A;  1ILY A;  3ENH A;  2Q36 A;  1ESV A;  2WUS A;  1LOT B;  4P8E A;  2QWP A;  1QZ5 A;  4CBW A;  1NBW A;  4Z94 A;  3WQT A;  2BH1 A;  1X9J A;  2QM1 A;  3R1X A;  3FLC O;  3OBW A;  3IDH A;  2V7Z A;  1JCE A;  1BU6 O;  3LDO A;  3G25 A;  3C6H A;  2P9B A;  3PIO L;  3ZIG A;  2QWN A;  3VEN A;  4BC4 A;  3VEV A;  3A5L C;  1VAZ A;  1VQO N;  4H0Y B;  1KC8 O;  1QQO A;  4P6D A;  3MCA B;  1HKC A;  5AQN A;  1SS6 A;  3H3N O;  3O6W A;  3UE5 A;  4AM6 A;  2PAV A;  4BRM A;  4IEE A;  4EIA A;  3MN5 A;  3H07 A;  3MK5 A;  4WQ4 A;  3L0Q A;  1U6Z A;  4BRN A;  3BF1 A;  4CJ7 A;  3CCV N;  4JD2 A;  3EO3 A;  4B1V A;  5JMV A;  3C6A A;  4GNI A;  3AAR A;  1K9M O;  4G9Z A;  3CJ9 A;  2V52 B;  1VQ6 N;  3K9J A;  5AQK A;  1VQN N;  5I9E B;  1Q81 O;  3RSE A;  3W0L A;  4YDU C;  3VGM A;  4CBX A;  1ATS A;  3D2E A;  3IFR A;  2P9P B;  3N4Q A;  4PKG A;  5EVZ A;  4CZE A;  2HF3 A;  3CXC M;  1TKU A;  2PBD A;  2HBK A;  3HM8 A;  4JN4 A;  1BA0 A;  3PIP L;  4CZH A;  3DLL L;  3HBT A;  4QS8 A;  2QI2 A;  4AF1 A;  3VEW A;  3SK3 A;  1HJO A;  1NLV A;  3AGK A;  4XH1 A;  3SMS A;  4PKI A;  2AA4 A;  4BRI A;  1JCU A;  1Q7Y O;  4FWL A;  5B8H A;  4JKD A;  5GAE P;  3MGZ A;  5F0X A;  5C2D A;  1YVN A;  5EXW A;  4H5R A;  4BRA A;  1MDU B;  3JXU A;  5AZI B;  3WEE B;  2V7Y A;  1G57 A;  1YF5 L;  3HOT A;  4WFN L;  4EFH A;  4ILJ A;  5M1P A;  1XEZ A;  2FSJ A;  3ZEU B;  4U7B A;  1G99 A;  1QVF M;  5AQX A;  4RWT A;  2A40 A;  2ZGY A;  3LDQ A;  3VPZ A;  3O9R A;  5GIN A;  1NGC A;  1K8K B;  3CCL N;  3BP8 A;  3VTI A;  2AP1 A;  2E20 A;  3Q7B A;  5JLH A;  3LQU A;  4H0V B;  1W97 L;  3C7N A;  2Q31 A;  4KH4 A;  1Q86 O;  3VGK A;  2GEL A;  2H3G X;  4I14 A;  3FZK A;  5KQD A;  3UKU A;  2QTD A;  4IJN A;  4FOI A;  4IXC A;  5AQT A;  1YXQ A;  4JNE A;  3IKM A;  4IOA L;  1Z05 A;  1VQ8 N;  4WF9 L;  2P9L B;  3TSP A;  3VGL A;  5BR9 A;  1K73 O;  4O8K A;  1BO5 O;  1YI2 N;  3F5T A;  4JK7 A;  3KVG A;  1NGJ A;  4CI6 A;  4OO1 J;  1X3M A;  4ISG A;  3AJE A;  4MDA A;  3HZ6 A;  4K43 A;  3T69 A;  3VEY A;  1EO1 A;  1SNN A;  4PKH A;  2BTF A;  2ZF5 O;  3LRJ A;  1U2V B;  2Q0R A;  3O9Q A;  3ATU A;  5TKW A;  1KAY A;  4A2A A;  1GLD G;  1JCG A;  3ZIH A;  2YJE A;  4BR5 A;  3QB0 A;  1HX1 A;  4OPA A;  4KH5 A;  2P9S A;  1MWK A;  4JKE A;  1C0G A;  4YOR A;  4NZT M;  4CD3 A;  3CME N;  1RDW X;  2ITM A;  3CCE N;  5AQF A;  4B1X B;  3EN9 A;  4WFA L;  2OTL N;  3T7Z A;  3VES A;  1DGK N;  2JWL A;  1K4L A;  2ZJP L;  5AZJ A;  1JCF A;  2NRR A;  4P8J A;  3M1F A;  2P9N B;  4MO4 A;  5AQM A;  1GLB G;  3C0B A;  4R79 A;  4MLE A;  5M1Q A;  5BPN A;  1TKS A;  3CD6 N;  1V4S A;  3R6M A;  3H46 O;  3ZYY X;  1RFQ A;  3P39 A;  3ZX3 A;  5C12 A;  3L6Q A;  1YHQ N;  1YJ9 N;  3QBX A;  5EX5 A;  5JLF A;  4H0O A;  1RDU A;  4WCE L;  4WQ5 C;  2DPN A;  5LJV A;  3CCQ N;  3DJC A;  4O5F A;  2NRV A;  5M1F A;  4ISE A;  3OBY A;  2E1Y A;  4H5V A;  4BRP A;  3OA9 A;  5KPR A;  4JD2 B;  3O80 A;  3MDQ A;  1S22 A;  3CMA N;  2QWQ A;  4IO9 L;  1WOQ A;  3L4Q A;  1Q18 A;  4J8F A;  3BEX A;  4FWN A;  2YCH A;  3JS6 A;  5GIP A;  3QFU A;  5BN9 A;  3A5M C;  2I7P A;  2J4R A;  3TTD A;  3VEX A;  1KD1 O;  4YOY A;  1MA9 B;  2KKZ A;  4FBW A;  3SJH A;  1ZC6 A;  3RSE B;  1NMD A;  2P9N A;  3TSQ A;  3D2E B;  1OKJ A;  3VET A;  2GUP A;  2W41 A;  2QWR A;  3SBG A;  4AM7 A;  5GAH P;  3CQX A;  4H5N A;  4GY2 B;  3WQU A;  1O13 A;  1NWK A;  5AFU H;  2IVO A;  5AQL A;  4BRF A;  4CZK A;  3J7Z O;  3M5R A;  3VOV A;  2A3Z A;  4CBU A;  4QS9 A;  4FPB A;  4U67 L;  3NMU A;  3QIC A;  2GWK A;  3DAW A;  3P38 A;  1VQ5 N;  1NGD A;  3EZW A;  4EO0 A;  1HKG A;  3KZB A;  4BRK A;  1Q82 O;  1VQP N;  3AY9 A;  2V51 B;  2E2Q A;  5KPT A;  3A5N C;  4CZF A;  4IOC L;  3M6G A;  1K4I A;  3O08 A;  3M3Z A;  3H6E A;  5LJW A;  3F9M A;  4O8U A;  5E26 A;  3VMF B;  1K7J A;  2BUP A;  3O4W A;  4A59 A;  4WYB A;  4M7X A;  4C23 A;  1SZ2 A;  3MN6 A;  2A41 A;  3FZL A;  3QDK A;  2WFB A;  2CGL A;  3C7N B;  1QQM A;  3LM9 A;  4IZ9 A;  4GV6 A;  1PVY A;  3H3O B;  3SBT A;  4H0P A;  3CCJ N;  3LDP A;  3UKU B;  3DXK A;  3CCR N;  1N8R O;  3HSC A;  4HVZ A;  1OVY A;  2E2N A;  2HF4 A;  3DWL A;  1T6C A;  4DHY A;  2QW9 A;  4H5T A;  3F2K A;  3DXM A;  4P77 A;  1R59 O;  2E88 A;  2Q0U A;  4YOT A;  4JKF A;  1NGG A;  1KAX A;  3E9O A;  1C0F A;  4K42 A;  4IWV A;  2LN3 A;  3CET A;  4FBK A;  3FFK B;  3ULE A;  5TKY A;  2OAN A;  3G71 N;  1QVG M;  4BRG A;  4BQZ A;  2GX9 A;  3GG4 A;  3A8Y A;  4JAX A;  1K4P A;  3CF5 L;  4CZM A;  3KWG A;  1NGB A;  2E8A A;  3FZF A;  4WQ4 C;  3U4L A;  4BRH A;  1E4F T;  3E9L A;  3P04 A;  5C10 A;  1GLA G;  2NZT A;  1DEJ A;  3EE8 A;  1HKB A;  3WT0 A;  4DCH A;  4A61 A;  1BUP A;  1BOT O;  3G4S N;  4BQL A;  3KWI A;  4YOW A;  5AFU A;  2YJF A;  2P9S B;  2QWO A;  3O9S A;  1X3N A;  2HMP A;  1NGH A;  2ZGZ A;  4A57 A;  3CHW A;  4XH4 A;  2HBL A;  3I33 A;  1TYQ A;  3GOI A;  5AZJ B;  4JK9 A;  3U9Z A;  1M90 O;  2E1Z A;  3GE1 A;  3CCS N;  4KBO A;  1GLC G;  1BA1 A;  4CZL A;  1KAZ A;  4FWM A;  3D6R A;  3SAH A;  2P9I A;  3Q7C A;  4ILH A;  3CC4 N;  4M63 C;  3ENB A;  3WXJ A;  3FZH A;  3TTF A;  1VQ4 N;  2NRZ A;  5M1O A;  1YIT N;  1VQM N;  3CC2 N;  3S41 A;  1WUA A;  5AQY A;  4CZG A;  4FOE A;  3VEO A;  3VEZ A;  3MIO A;  4YOV A;  3AGR A;  5GIO A;  3NVM A;  1YJN N;  5KPZ A;  3IUC A;  3CJB A;  1GLJ O;  4BR0 A;  3VER A;  2D4W A;  3CI5 A;  2YHW A;  1T44 A;  3VF4 A;  4BR7 A;  1VQK N;  2D0O A;  2RIS A;  2P9U A;  3WXI A;  3EL2 A;  5MLC Q;  3EE9 A;  4BG9 A;  5ADX H;  3OW2 M;  3D2F A;  3OHR A;  4FO0 A;  3ZII A;  4BGB A;  4PL8 A;  3MCP A;  3WXL A;  1W2B M;  3FR0 A;  3NVK A;  2VGM A;  1IG8 A;  2RE2 A;  4K25 A;  3I56 N;  3C65 A;  1GLL O;  2WBN A;  5C2F A;  4B9Q A;  3MN7 A;  4BRE A;  4K41 A;  4UY8 O;  3N4P A;  3HRG A;  3CER A;  4H0T B;  4MDB A;  4DKW A;  2NRT A;  2E2P A;  1NGE A;  4JKC A;  4EAH D;  5AQS A;  4NO7 A;  3CJC A;  3CCU N;  5AQH A;  5AQP A;  1V4T A;  5C0Y A;  4Y0W A;  1GLE G;  4JKG A;  2Q1N A;  2ASM A;  2QXL A;  5HOO A;  4NZR M;  3SAF A;  3GDQ A;  1HLU A;  4CD1 A;  5BN8 A;  5JVG L;  1HPM A;  2CGK A;  3O1B A;  3P4I A;  3MX5 A;  2IIR A;  4FWK A;  3HOS A;  1BDG A;  3O9U A;  4H03 B;  1P8Z A;  3AAP A;  4JKA A;  5CE3 A;  4FWR A;  4I6M A;  3ZET A;  2FF6 A;  3CJ1 A;  3CJ7 A;  2HBM A;  3CJA A;  2VCP A;  2OTJ N;  5FPM A;  1K4O A;  3QML A;  3ID8 A;  2D0P A;  1NGA A;  4RTF D;  4YDU A;  4YOU A;  2ASP A;  3B8A X;  3DXK B;  1Z6R A;  1XUP O;  3TTC A;  1SQK A;  1NGF A;  4MO5 A;  5DM7 L;  4A5A A;  5AQU A;  4FCX A;  4MLH A;  1S72 N;  2QWL A;  4NLB A;  3DXM B;  3O9T A;  2YX6 A;  2YHX A;  3R3L A;  4FWS A;  1J6Z A;  2F9T A;  2F9W A;  3E9P A;  4FWQ A;  4IO8 A;  2QA4 N;  4E1B A;  4BC5 A;  3R8E A;  4FL9 A;  3MWT A;  4YKE A;  1KXP A;  4ILG B;  1NJI O;  2EQA A;  4OPH A;  2A6A A;  2F7T A;  3ULE B;  3MX2 A;  4ISF A;  5AQW A;  2NRW A;  4JK8 A;  4FPA A;  5AQO A;  5JIC A;  1XC3 A;  3CQY A;  5ADX A;  1TUU A;  1MWM A;  5GAG P;  5H1S Q;  1QZ6 A;  3RVC A;  2E2O A;  3CPE A;  3O1W A;  3FE1 A;  3FZM A;  3HI0 A;  3UB5 A;  4BR4 A;  1GLF O;  1E4G T;  4BRL A;  3CPW M;  3H1V X;  2CH5 A;  4IFE A;  1YJW N;  3O5B A;  3UKR A;  4B1Z A;  1TUY A;  2W40 A;  2ASO A;  3MK6 A;  1YUW A;  1YIJ N;  1IJJ A;  5AQI A;  1VQ7 N;  4EHU A;  3ATV A;  4L3Q A;  4F9O A;  5C15 A;  4FWP A;  2VWB A;  1CZA N;  4JKH A;  3SAG A;  1ATR A;  2FF3 B;  5M1K A;  3GBT A;  3J8A A;  1M1K O;  4P6P A;  2P9K A;  2KHO A;  3MWP A;  1T3V A;  1Y64 A;  1TYQ B;  4JHD A;  4BG8 A;  1BG3 A;  5FPD A;  3PLA A;  5KQ8 A;  3I55 N;  1H1V A;  2Q97 A;  5ELZ A;  3VF2 A;  4B1W B;  5BRE A;  3ENO A;  4CZI A;  4DQ8 A;  3CC7 N;  2D1K A;  4IOX A;  2NRX A;  2P9I B;  1EQY A;  1T6D A;  3W3D A;  1ZXO A;  5AQQ A;  2IVN A;  4C1N I;  2GEM A;  3A5O C;  1BWF O;  5BRH A;  2NNW A;  3VF6 A;  4NLC A;  1VQL N;  4LC9 B;  4H5W A;  4A5B A;  3SMP A;  2IVP A;  5GAD P;  5AQJ A;  3QBW A;  3BUZ B;  4YOX A;  2HST A;  3FGU A;  2CGJ A;  3R9P A;  3E1Y A;  5BRF A;  2FSN A;  2I7N A;  2RHK A;  2GWJ A;  4B1Y B;  5EOY A;  4BVO A;  1QQN A;  5JVH L;  4GV9 A;  2MX1 A;  1G58 A;  2GTD A;  4BVP A;  2P9U B;  3LDL A;  3LM2 A;  5E84 A;  4BRD A;  3ZX0 A;  4EHT A;  1PVW A;  4HWI A;  3D2F B;  1RGI A;  1K49 A;  3SLC A;  3TU5 A;  4M7Y A;  4BRC A;  2VGN A;  2P9P A;  4BY9 C;  2WC9 A;  4BGA A;  2ZJQ L;  3WXM B;  1JJ2 M;  5DM6 L;  3T1I A;  3TSU A;  1KK9 A;  5BPL A;  5FPE A;  4FBQ A;  1NM1 A;  3U9D A;  4PL7 A;  4WFB L;  4FSV A;  1HRU A;  2QWM A;  2ZWH A;  3WUH A;  1KQS M;  1K8A O;  4BR9 A;  2JWK A;  3LDN A;  2FXU A;  4B1U B;  4H0X B;  3ID6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...