3TTDA

Crystal structure of e. coli hypf with amp-cpp and carbamoyl phosphate
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
647
structure length
647
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 211
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttdA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttdA01
3VESA 3VEWA 3TTFA 3TSUA 3VERA 3TSPA 3TTDA 3VTIA 3VEXA 3VEOA 3VF2A 3VETA 3TTCA 3TSQA 3VENA 3VEZA 3VF4A 3VTHA
chains in the Genus database with same CATH superfamily
1YF5L 3KKRA 1BU6O 4CJRA 3MWTA 4X65K 3TAEA 3FGUA 2HHTA 3MXMA 2HHSA 3QNNA 1TK8A 5ADXH 2W42A 2XY8A 1XC3A 3SQ1A 1ZBIA 1YAGA 3BZKA 4EHTA 1TKXA 1BG3A 4CK3A 5IWAK 2BKYX 4LC9B 4E7KA 3ZSOA 1KK9A 5HRNA 3HPHA 4JV5K 4CGHA 3WEEB 2Q0RA 4CHZA 2Q3VA 4IKFA 2QK9A 4BVOA 1HKBA 3OYNA 1JO0A 1WSHA 1X1PA 4JI2K 1VAZA 3EN9A 5CE3A 3VESA 3MN7A 4Q15A 3JSMA 5AQZA 3LM9A 3LAMA 5TKWA 2VWBA 2QKBA 4K41A 4PY5A 1TKTA 3HTVA 2P9LA 4CIGA 1CZAN 4YOXA 1QHTA 2P1JA 4A5BA 3I8BA 3LANA 1IO2A 2P9PA 2G8VA 4CJQA 4MO5A 4OLAA 5AQGA 5K14A 1SQKA 4CJ5A 1Q86O 1NJ8A 3U3GA 4KI4A 2LXRA 2VWJA 1JLBA 1Q82O 4FSVA 2OA8A 3O3HA 3FFIA 3C0BA 1Q7YO 3TWHA 3AGKA 3HPGA 3ATUA 3AO4A 4X66K 1G15A 2OZMA 2HVHA 4LF5K 4CEZA 4ELTA 2NRHA 5C0YA 1C6VA 3AA3A 3LDPA 3WNEA 3E1YA 1WBDA 2EQAA 1NK4A 2AJQA 1X3NA 4CEOA 1FJGK 4CHNA 4M3RA 3TU5A 3VGLA 3J8AA 4FVUA 2UUAK 5KGWA 1NJWA 1JLAA 1VSDA 4AILC 1NM1A 1D9FA 1RBVA 5HLFA 4DV5K 1FKPA 2FSJA 4BRAA 1LV5A 4B3MK 4H0XB 1K73O 3NVKA 4GKKK 4B9LA 4P8JA 2G8HA 4ISEA 4RW7A 4UQGA 3O8MA 2A1SA 4CBWA 1X9WA 4ELVA 3IG1A 1HYVA 4EZ6A 3CFOA 4FYDA 4A2BA 1MWMA 3CXCM 3E9PA 3KLHA 1WNSA 2KTQA 4H4OA 3AVKA 5CZ1A 4N47A 4CEBA 1BOTO 5JS1A 1NGDA 4H03B 4A59A 3CCQN 1GLBG 4B9MA 1Q81O 2CGJA 1D4XA 3CCMN 2BE2A 4WFNL 3WXLA 1T6DA 4IDHA 4LFCK 3SQ0A 3ENHA 3PUFA 2Z7CA 4W5QA 4E1MA 2ZF5O 4O44A 4NCGA 1QQMA 2DFFA 4DV6K 3SUQA 3OYAA 1BQNA 5J2PA 1HQEA 3WXKA 1SKSA 2NLXA 1XWLA 1QQNA 4PKGA 3ZSQA 3F2KA 3GG4A 3R8EA 3UKRA 4A57A 3MCAB 4E7IA 2P9IB 3CPEA 3GL1A 2UXCK 4GW6A 1C0GA 5BN9A 3OYLA 1OH7A 2WOMA 4FWSA 1KAZA 4DR7K 3HVRA 4BRMA 4JI5K 4JKBA 2RKIA 3L2WA 4JRQA 5HBMA 1VQ5N 3AY9A 2E2QA 3CETA 4FWPA 4FWQA 3UKUB 4OGEA 3R3LA 3F73A 4FLXA 4KH4A 3MX5A 2YHBA 1CLQA 1RGIA 5EU7A 1H4TA 3T3FA 3M3ZA 1NKBA 4HHTA 3T19A 4XEIA 2P9SB 4O8KA 3WXJA 4E7LA 1BI4A 3TARA 1GLDG 1W9HA 1U2VA 3V6DA 3QFUA 5J2NA 3AAPA 3KLIA 1J9AA 2QXLA 4BGBA 2RN2A 4W5NA 3FFKB 4BQZA 1T8EA 2IDOA 3DWLA 4L3QA 3VQ6A 4O0JA 3MEDA 2YNHA 5EXWA 3MK6A 1BCMA 5M1PA 4CHQA 4W5OA 4DG1A 1D8YA 2EH1A 5KQDA 3O1BA 4NO7A 1KC8O 4FJNA 1VQNN 1JXEA 3L3UA 2E2PA 4FJ8A 3CG7A 2QTDA 3THXB 4NCAA 4DF8A 3H45C 4KFBA 1WUAA 4IG3A 1RFQA 1SV5A 4C1NI 2Q0UA 3O9RA 3OYGA 2KW4A 4QS8A 2YI1A 5E84A 2O8DA 2Q1NA 2GUIA 4B08A 3HRGA 3BDPA 1ZBHA 1T7PA 3QETA 4B3RK 3FZMA 5GADP 3AO2A 1II7A 4KHUA 4OPKA 4DQRA 2V52B 3K2PA 1ZBLA 5AQWA 3THWA 3ULEA 3D2FB 3NH1A 3CCLN 1ITGA 3MWPA 3LDLA 1A5VA 4IJAA 3TI0A 4FJKA 3LWMA 5AQUA 3QFPA 1HJOA 3MN6A 4J2AA 3D2EB 4YOUA 1RTHA 1YJNN 5J2MA 3HYFA 1NJ1A 2OPQA 3RRHA 3T1YK 3EEQA 4BR7A 3OHRA 1VSFA 3OY9A 2NRXA 2E88A 2JGUA 4YKEA 3CCSN 4DV7K 1Q8IA 1K6YA 2HNYA 1J6ZA 1HYZA 5AZJB 3SUNA 2A6AA 3T1AA 3ID6A 3J80O 5SWMA 3HOSA 3O08A 4CEQA 2IGIA 3AVBA 1HX1A 1NOZA 4CBXA 4JI1K 4CGIA 3CCRN 4A61A 3M8QA 4RG8A 4JHDB 5I3UA 3H07A 4BRGA 3HVTA 1WLJA 1RBTA 3DLRA 3J7AP 4DFMA 2Y1JA 4FCYA 5JLFA 3NH0A 4WQ4A 4CECA 4YOVA 4JK9A 4O8UA 3HT3A 4OKJA 1J5OA 2MX1A 4KTZA 2VYPA 3KWIA 3LPTA 5KPZA 1IBMK 4CK1A 1P90A 3AVFA 4GVEA 5GAEP 2FBTA 4HTLA 3VQCA 2PYLA 2G8WA 4CW7B 4AHUA 5BR9A 3ZSWA 5FPEA 3ZX2A 4LF4K 1HRHA 1KVAA 3LDSA 3M8RA 1BWFO 3SI6A 1O13A 1REVA 1QQCA 4BE1A 2HW3A 4CK2A 1SAZA 2E5LK 3RWUA 3QBWA 4GV9A 4HD0A 4KKOA 2FXUA 3J7YP 3TAMA 5BREA 1CZBA 4EAHD 3JS6A 3SQ4A 3O9SA 3M6GA 5CZ2A 3U6YA 4H0TB 2P9KA 3S3MA 2IIRA 3IRXA 2XHBA 5C10A 1K4IA 3IMXA 2ZJQL 5AQMA 4HVCA 4RTFD 5AQOA 1EKEA 3DOLA 3CJBA 2DFHA 3VETA 1HNIA 4CGDA 2ZWHA 1VRUA 3ZIGA 3ZETB 4BRQA 2I7PA 2FBYA 5GAHP 4KPYA 4HWIA 4CZGA 1TVRA 1JE3A 1IBLK 2GEMA 3SNNA 1KSPA 3TAGA 4M3UA 1WAJA 3ZX0A 2DPNA 2O8EB 3EL2A 3ZX3A 5LL6Z 4BC3A 1NBWA 4OGCA 4OJRA 1PVYA 1VSIA 2OTJN 4Y0WA 3VQPA 4FLYA 1WSIA 1RBSA 3IDHA 4DTXA 2VCPA 1QHAA 4RCHA 2KFZA 4FM2A 5BRDA 1U47A 2HHQA 4FLWA 4BRIA 4O4GA 2FSNA 2WFBA 1RBUA 5FDLA 1DGKN 4GKJK 1BA1A 3TAPA 5BPNA 1LCUA 2P9NA 3NHGA 1S9GA 3LVJC 4DWIA 2HSTA 3CC4N 1WOQA 3R1XA 4DHYA 3S9HA 4F2RA 1WSEA 4OX9K 4WQ5A 4JRPA 5HRRA 3ENBA 4CHOA 4AHTA 4CD1A 4B1WB 4N41A 1RT2A 4KRFA 5M1NA 3O5BA 3HK2A 4IEEA 1H0YA 5LJWA 4DB3A 1U49A 5M1QA 3THYA 1LAWA 3KD1E 3HJFA 2OPRA 2IAJA 1VQ8N 1OVYA 2QM1A 1QSYA 4H5TA 2W41A 4JI6K 3MGZA 3KVGA 3DLBA 1NJ5A 4NLBA 1RILA 2G8IA 4CEAA 3IALA 3DSCA 4DU3A 5C2FA 1VQ6N 3NGIA 1NJ6A 2V7ZA 2F7TA 4CGFA 3TTCA 4OPHA 1K8KA 4OLFA 4P6CA 1ATNA 3ISNC 1IJJA 2BGGA 4KB1A 4LD0A 4J2DA 3LAKA 4M7YA 3OYCA 4KHQA 3HSTB 1EETA 3IAYA 3RSEB 5AQSA 3OVNA 4IG0A 1CXUA 2IVOA 5J2QA 2BH1A 3BF3A 3HZ6A 4XIUA 3CMEN 4BACA 3MIOA 4IEIA 4W5RA 3P1GA 2HBLA 2QWOA 1SL1A 5SZTA 1YTAA 3PLAA 1VSEA 3MN9A 3K0SA 3ZT2A 2BDPA 4B3TK 1OKJA 2P9UA 1NG9A 4LF9K 4JKHA 4DU1A 4ILHA 4NZTM 3HM9A 5JS2A 3UE5A 3TAQA 2YX6A 3VF4A 3O9UA 3M8SA 2V51B 4ISGA 4E3SA 4KHWA 1DT9A 4P8EA 4M3XA 2Y1IA 1GLLO 3LP3A 1HNWK 4YOTA 1Z6RA 4B8AB 3AA4A 4CE9A 3ZLJA 1M90O 4DQ8A 4L8RB 1HC7A 2PZSA 3LZJA 3KJVA 3DJCA 1LWEA 4JKDA 2E6MA 5C25A 1KRPA 1HJRA 1NJ2A 1XEZA 3ZT0A 5AFUA 4NXMK 1RDBA 2PBDA 1NGBA 1KLNA 4DMNA 4GVMA 3EYZA 2UXDK 1TV6A 2G8KA 2Q97A 3ZSXA 4EHUA 1F21A 1BO5O 3L8BA 3LRJA 3CF5L 3ENOA 1TK5A 1NK7A 4CZEA 3QLHA 3DM2A 2O8CA 3AVHA 3VQ9A 2HF3A 4FLVA 1XQSC 1K4OA 3ZIIA 1VR4A 3S41A 3G10A 3VERA 1XI1A 1FW6A 1R0AA 4Z94A 4C8LA 4ISFA 3L2QA 3MXIA 1YUWA 3O80A 5AQHA 2HHWA 4I9QA 4B9UA 3MK5A 1K8AO 1CXQA 3VF6A 2YNGA 3ZCMA 1I94K 2ZE2A 3KLGA 3QINA 3I55N 3TAFA 1S9EA 1KVCA 2P9LB 4O5BA 3WEEA 3ZSVA 4ILJA 3C6AA 4M63C 1HYSA 1Y2IA 4Z0UA 2OPSA 2P9PB 2Y1BA 4CJFA 2NZTA 3CIPA 2KKZA 4CFDA 4Q5VA 3H08A 3VEZA 1T6CA 1YTUA 1OH5A 1DTQA 3KLEA 2KHOA 3NH2A 2OPPA 4B1UB 3AAQA 3ULDA 3AO1A 3U6FA 1ASWA 1LW0A 5I42A 3NVMA 4BDPA 3C7NA 1NKEA 3DXMA 4BRNA 1NGAA 3B6PA 3TTFA 3D6RA 3MCPA 3G71N 2P51A 3CCEN 4DSKA 2QXFA 4DF4A 4DLEA 3G0ZA 3SUOA 3KK7A 2P5OA 4OO1J 3VQAA 2DTUA 2YNFA 2I5JA 4HUFA 4H5NA 4HUEA 3V4IA 1XMQK 1C0UA 1JL2A 3NGZA 3OS0A 4Z4GA 3N4PA 4H5WA 3CERA 4HVZA 3AVJA 4M3ZA 4IOAL 3TANA 3TR8A 1BISA 1RDUA 2BANA 4BR9A 5CR4A 1Q9YA 5KRTA 1NMDA 2A42A 5EOYA 1W7AA 3L2UA 4CZKA 1GOAA 4I7FA 3L2RA 3VEYA 3DI6A 4DSEA 1NKCA 3OYMA 1WAFA 3P31A 3JXUA 2Z1IA 3QEIA 5HROA 3UB5A 4K42A 2O8BA 1MWKA 4DR6K 1TKUA 1BUPA 5JMVA 3DXKA 4YHHK 3NAEA 3ZYYX 1KLMA 1N5YA 3IUCA 1KXPA 4E7JA 2YCHA 4JKEA 3CFRA 5FLXO 1LW2A 3ASMA 4OPJA 3LDOA 1YJWN 1Z26A 3VMFB 1YITN 2HF4A 3SLCA 1U04A 3ZT1A 4DKWA 4FZZA 5KQ8A 3CC7N 1YVNA 2Z1GA 2VGNA 1A5XA 1ATSA 4K8XA 4BE2A 2Q3SA 4R5PA 1HQUA 2E8AA 2HBKA 1W0HA 4I2QA 4ZTFA 1MDUB 3UKRB 1TYQA 4DLGA 2Q31A 1EWQA 2GBZA 3THVA 3E01A 1HMVA 4RW4A 3SCXA 2ZD1A 1DTTA 2WUSA 2QEXN 4LF7K 3D45A 1ATRA 4CJPA 4YY3K 3K5OA 2V7YA 1SUQA 3VEVA 1JCEA 4B9TA 1S6PA 4JS5A 2RHKA 3DLHA 1RTIA 2HB5A 3CQYA 3KKSA 1YHQN 4BG9A 4FJGA 1TKDA 1C0FA 1T44A 4CJWA 5C2DA 4YNQA 4QS9A 4BQLA 3DYAA 1H4QA 5FPNA 4CIEA 4E1NA 1VQON 5FRNA 1UAXA 1N6QA 2D5RA 2CGLA 3V1OA 1X9MA 3EKSA 1WB9A 1L5UA 3PO4A 1RNHA 4C8KA 2IFEA 4XH4A 3RR7A 4JD2A 2YKMA 3NF6A 4YFUA 4K88A 4DS4A 5GIPA 1S72N 4Z4IA 1BI4B 3DMJA 4M41A 1U2VB 3PIOL 3PIPL 3KZBA 4BDZA 3OA9A 4E1BA 5TKYA 5GIOA 3L4QA 3A0IX 2NRWA 4ZHRA 3U4LA 4F2SA 4DTOA 1BGXT 3NCIA 4H5VA 1E4GT 1IH7A 3KK3A 4MDBA 1WSGA 4JNEA 3LZIA 2F96A 3AO3A 4E19A 4BC5A 1ASVA 3IKMA 5BPMA 5IT9O 4J8FA 4DFPA 3AV9A 1NOYA 1KTQA 1KD1O 2QKKA 1IBKK 4HCCA 2ITMA 4IJNA 3AJEA 4DV0K 1TKSA 4FVMA 1XMOK 3F9KA 1NK5A 3U9ZA 3QB0A 4FK0A 4IZ9A 2O8DB 1NJIO 3E9OA 1LWFA 1S1XA 3TPQA 4HCBA 2EWSA 1IKWA 2IOCA 3VTHA 5AQXA 4DR1K 2HMPA 3ZSYA 3THWB 1SL2A 1WN7A 3AVNA 4DTRA 3S3NA 4FXDA 1PAVA 3PSFA 3ULEB 3SBGA 3OYKA 4Y1CA 2E2OA 1E4FT 1BCOA 3PSIA 1IV0A 2ITGA 4DR3K 5LJVA 1UA1A 4FWLA 4FM1A 4M3YA 2IVPA 1S5JA 5I9EB 1Q18A 5CYMA 4I9LA 3SPZA 4FLZA 4WQ4C 1LOTB 2ASOA 1O1WA 4K0KK 4ID5A 5BN8A 2BUPA 1H0XA 1H4SA 4RW6A 3RMDA 4PKIA 1Y97A 3SUPA 2A3ZA 4IO9L 5FPDA 3J81O 4R79A 4LFAK 3VENA 2QWPA 4CJVA 2F4VK 4BRLA 3FLCO 3TSPA 1PVWA 4DR4K 3H1VX 2Q2RA 4OVLA 2B5JA 3O6WA 2H9UA 4DUZK 1RT4A 3H1QA 3TABA 2RE2A 4CF9A 3NFAA 4DQQA 1GLAG 4FJ7A 2P9BA 1HRUA 1NNEA 1K49A 4RW9A 4HVJA 1X9SA 2AA4A 1V4TA 1W97L 5A2QO 3I56N 1S1VA 3M8PA 1BL3A 3HM8A 1QE1A 4WFBL 3OS2A 1LWCA 4Y1DA 3EO3A 4GY2B 1IG9A 3S3OA 1I3AA 5AQIA 3AGRA 1VSKA 4EP5A 3M5RA 3NF8A 4YOWA 4ZTJA 5LMUK 4NB4A 5DM7L 1JL1A 4BY9C 3DRSA 5D3GA 2IVNA 1S1TA 4CIFA 3VA0A 4CESA 4CVNE 3NF7A 2EHGA 3CD6N 4DV4K 1B92A 4WYBA 4W5TA 3H46O 2HBJA 3LS6A 1K4LA 2CRQA 2F9TA 2OANA 2D0CA 3QNOA 5GINA 1SNNA 5AQLA 4AHVA 1S1WA 2J4RA 4A5AA 3F5TA 3CQXA 4AM7A 2VG5A 3K58A 1D9DA 2M71A 2BTFA 4CFCA 4DS5A 1VSMA 4O5FA 2CGKA 4FWNA 2H3GX 3BEXA 3SAFA 1VHXA 3KWGA 5F2RA 4CERA 3QO9A 2GUPA 1LN4A 2P9KB 3CQ8A 1YXQA 3K57A 1T05A 3DLKA 3QEVA 3OYBA 1QSLA 3QIOA 2QWQA 1NJYA 3MEEA 3JYTA 2QA4N 3NE6A 1TIGA 1TAQA 4EP4A 1RDCA 4FW1A 2Z1HA 2D0AA 4CZLA 5KRSA 2GX9A 3V9UA 4IOCL 3LVKB 4WQ5C 1GOCA 2F8SA 2QI2A 2F8TA 1GLFO 4DV2K 4JI8K 1ASUA 3O3FA 3HI0A 2E2NA 1RQ8A 1UDVA 3EKUA 2FLOA 5KTQA 2XO7A 1NFHA 4RWTA 1QTMA 4ELUA 1EQYA 5J1EA 4KTQA 4B8CA 1NGFA 1TUUA 4H0OA 3OYDA 4JN4A 3HOTA 4HTUA 4KI6A 4BWJA 3I0RA 3EE8A 3A2FA 4QS7A 2NUBA 3SBTA 1HKCA 5JVHL 1X3MA 3P04A 3P5JA 4E0DA 4LSLA 5AQKA 3LALA 2IS3A 2P9NB 3MX2A 4YDUC 1NJXA 4FW2A 2PFUA 4F4KA 1QQOA 2RPIA 4KHPK 3AO5A 3JAMO 1JLFA 1RT5A 3CCVN 1U48A 4FJ9A 1TK0A 3F9MA 1HPMA 1ILYA 1JDQA 4BRPA 5CYQA 3VQ8A 4O55A 2QWRA 2HNDA 3O9TA 1KCFA 4HUGA 1J53A 4FJHA 3CJ9A 2JWKA 3SJHA 1RDWX 3CJ7A 5AZIA 5M1KA 3KD5E 4KREA 3THYB 1OH6A 2B6AA 4FL9A 3K9JA 5F1XA 3O3GA 1UWBA 1R59O 5T7BA 4OPAA 4BRKA 3W0LA 2O8FA 1UA0A 4I6MA 5AFUH 1QVFM 4DV3K 4AH9A 1CZ9A 3ZEUA 1NLVA 3SV4A 4FJLA 1WSFA 4CF1A 3VPZA 5E26A 5ELZA 2D0BA 3IFRA 1XUPO 3LM2A 5HL7L 1HR0K 1K8KB 5BR8K 2DFEA 3P38A 1T03A 2VQFK 2UUBK 3RR8A 3ZT3A 4FJJA 1TKZA 4QAGA 3HO1A 4JKGA 4JLHA 1LAVA 2OCEA 3ATVA 5DM6L 3MEGA 5GAGP 4KTWA 4GV3A 4YDUA 1S1UA 4DTUA 2YKNA 4IFYA 3VTIA 2VWKA 3EE9A 3WXIA 5KI6A 4DSFA 3WQUA 3OBWA 3AVGA 2OTLN 4JAXA 3L2VA 3A5OC 3V9ZA 2XY6A 4IO8A 3CCUN 3VQBA 3HBTA 3C94A 4FWRA 1HPZA 2P9UB 3BUZB 2NRRA 3U9DA 1N33K 3IABA 4JKCA 4CZHA 2FBVA 4DTSA 3PO5A 3O9QA 1YVUA 4KV8A 3LPUA 3DLGA 3MECA 4E1JA 4LF8K 3L3VA 1VQMN 4YORA 5HOOA 1NK6A 4DFJA 3T1HK 1DLOA 2L8YA 1N36K 1YT3A 3ZSZA 3V9SA 4B3SK 1L3TA 4KB0A 4QOZB 5M1OA 4CGJA 4BROA 5EY4A 4CI6A 4C1NK 4PWDA 1C1BA 3P4IA 1VQPN 3FR0A 3PY8A 3OYHA 4KHNA 3SMPA 4CCHA 4DFKA 1NGJA 1ZXOA 1VQ7N 2E20A 3I0SA 4IDKA 3C6UA 1OH8A 4H4MA 3EZ5A 4CBUA 2O8CB 3ZSRA 4XH1A 3VQQA 4F9OA 1RT7A 3NF9A 3O4NA 1NGIA 5FROA 1SL0A 1M1KO 4FZYA 1KVBA 1GOBA 4JK8A 2VG6A 2HHHK 3FZHA 5AQRA 3U8XA 3CHWA 4IFEA 1QZ6A 3I33A 5B8HA 1NJZA 3DAWA 4KAZA 4WFAL 3CCJN 2KFNA 3VOVA 1W2BM 4CFAA 3VQ4A 4Z4FA 4WE1A 4PKHA 2YJEA 2DY4A 4NYFA 4PUOA 2D0OA 3BZCA 4MDAA 1K9MO 3Q7CA 3BGRA 5C42A 2B4JA 2VG7A 1VSLA 5F0XA 4AHCA 2ZJRL 1RCHA 4H0PA 1FK9A 2W40A 3H3NO 4M3TA 5LMNK 2HMIA 3PX6A 4UY8O 4C8MA 3SZ2A 4DSIA 1ZBFA 3K5LA 4JI4K 3C7NB 4FBQA 2D1KA 3DXMB 4K87A 4I14A 5AQVA 1JJ2M 2ZQBA 4FO0A 2GV9A 1EO1A 4E89A 4X64K 4PA1A 4CHYA 1SZ2A 2YNIA 3DLEA 3R9PA 3ZT4A 2Q36A 2XY7A 3SJJA 5CHIA 4X62K 3MDQA 5ADXA 1GLEG 2GELA 4Q0BA 4PHTX 3SAGA 3AVLA 4JKAA 4EFHA 4A62A 3V1QA 4WF9L 3MXJA 1E3MA 1V4SA 2E1ZA 3HXMA 3L6QA 4Z9EA 1KFDA 1VQ9N 2W6KA 4AF1A 4DR2K 1RT6A 4YDQA 2ATQA 1JLGA 4Z4CA 3VN5A 1RT1A 3QEWA 1WBBA 5DK5A 4IXCA 3OYEA 1NWKA 3AVCA 1Z25A 3AA5X 1Y64A 1NFJA 4K86A 4BDYA 3LQUA 2XRIA 2UXBK 4F8RA 3WNGA 4FJMA 2GTDA 3QIPA 3PV8A 2O8BB 5CY4A 1EXQA 1VSHA 1BIUA 2KQ2A 3DXKB 3H3OB 4FZXC 3B8AX 1YIJN 3G4SN 1BQMA 2QWLA 4BC2A 3VEOA 2A41A 1L3SA 3RVCA 2F9WA 3A5LC 4CZIA 4J2EA 5AJ3K 3BY5A 4Z4EA 3L0QA 4IWVA 2OYQA 4U7BA 1BA0A 1DCJA 3MAQA 5KPTA 5JVGL 4DSJA 1L3VA 4MO4A 3GOIA 4CF0A 1TYQB 2GWJA 5BRHA 3OS1A 5BRFA 4DSLA 3OJUA 2E4LA 3SYZA 3VF2A 3AA2A 2QWNA 3NBPA 3EZWA 1IEZA 3WT0A 4V19S 3FE1A 1JKHA 1S6QA 2UYTA 4H5RA 2GWKA 3MMVA 4MQ3A 2HHUA 4FBKA 3OYFA 4FJIA 4C23A 3HSCA 4O0IA 3J7ZO 4OLBA 1GLJO 3TSUA 1EX4A 2LSNA 3VQ5A 3WNHA 4FWMA 3HP6A 5HRSA 5AQTA 4BR2A 4CJUA 1NMNA 2A1RA 2ZGZA 2P9IA 4B1VA 5C12A 3VA3A 3QICA 4JD2B 3GDQA 3WQTA 4NCXA 4FWKA 4AHRA 3D0PA 4DQPA 5JICA 3C65A 4GNIA 3KTQA 3T7ZA 4F3OA 4MLHA 1ZYQA 2HHXA 1P8ZA 1G99A 1HNVA 4LY7A 1RT3A 2FF6A 5AQNA 3V9WA 3KIOA 1VQLN 4XH5A 4DU4A 1Y9XA 3T1IA 4J2BA 1GLCG 3ZIHA 3O1WA 4EO0A 3QBXA 1G57A 3SAHA 2X78A 3L7VA 3UKUA 3ID8A 2O4GA 1N34K 4DTMA 2D4WA 3QESA 1J5EK 4AHSA 3OYIA 2P9SA 4CZJA 2YJFA 4B3OA 1XNRK 2ETJA 4OKEA 3VGMA 4IBNA 1EWRA 4PL7A 3SPYA 2E6LA 4LF6K 1IKVA 3C6HA 2AP1A 3GE1A 3CM5A 4TSXA 5EX5A 4MFBA 4BRDA 3PX0A 5FRMA 2WBNA 5M1FA 4K43A 3RRGA 4N56A 1K7JA 3RMCA 3EY1A 4CJLA 3A5NC 3NGYA 2X6NA 4CEEA 2NRTA 2ZGYA 1K4PA 4DCHA 4Z4HA 4CJEA 4KBOA 3QMLA 4CJSA 4FWOA 1XHXA 3V1RA 1NGEA 2PYJA 2NRVA 3HZ7A 3C95A 3THXA 1HLUA 3M1FA 3TTDA 3MN5A 1JCGA 1ZBUA 1MA9B 5MLCQ 4WCEL 4KO0A 5JLHA 3K5MA 3LDNA 1NK8A 4IOXA 5H1SQ 4CD3A 4DUYK 5AQQA 2E1YA 1RBRA 4BG8A 3VQDA 1NGCA 3O4QA 1UOCA 1T3VA 4PQUA 3LL3A 1S3XA 1FXXA 4CFBA 4DV1K 4FBWA 2WONA 3G25A 1KAXA 4TWAA 4CJ7A 4JI7K 3C6TA 2OZSA 1DKGD 3D2FA 2RISA 4B9VA 4C8OA 4CZFA 2ZM6K 5AQPA 3QEXA 2EK0A 4M7XA 3D2EA 4P77A 5AQYA 4FPBA 3OBYA 4JI0K 3TOEA 3Q7BA 4A2AA 1XHZA 3DOKA 1N8RO 2JWLA 3RMBA 4LH5A 2A5XA 4KH5A 3FZKA 1EP4A 4LH4A 4BC4A 4H8KA 4C8NA 2CH6A 3GBTA 3NMUA 4E7HA 3P39A 4IFVA 4BRCA 5AZJA 4AM6A 1NU0A 3VGKA 2EX3A 1B9DA 4CJ4A 5FPMA 1B9FA 3WBMA 1DEJA 4CF8A 4KHSA 1NGGA 4G1QA 4JI3K 4NXNK 5HP1A 3CJ1A 4JK7A 1X9JA 5BPLA 1NK0A 1QS4A 4M45A 2UU9K 3DLLL 4B9QA 4BRFA 4JHDA 4AQYK 4N76A 4ID1A 3NDKA 5DMRA 3AVAA 3ZIEA 3B6OA 1N32K 3SK3A 1HKGA 4FOIA 3WUHA 1NGHA 1KQSM 3V9XA 1C1AA 2P5GA 1VM0A 3A5MC 2A2YA 3OTOK 5LY3A 3KK2A 4K25A 3QEPA 3CI5A 3RTVA 1I39A 4FK2A 1TUYA 2W6LA 1TAUA 2XY5A 2NRZA 1IG8A 1ESVA 2YHWA 3O4WA 4GV6A 4G9ZA 5KPRA 2O4IA 3CFPA 1IKXA 1RTDA 4DR5K 3PX4A 2ASMA 1BHLA 4EZ9A 1Z05A 4LFBK 1J54A 1JCUA 3WNFA 3DSDA 3VQEA 2IC3A 4BREA 1QVGM 3V81A 4BR5A 1JCFA 3BP8A 1KFSA 4QCLA 1KAYA 1XNQK 4WI1A 1SS6A 3QKBA 4OKKA 3LP0A 3LDQA 3W3DA 3E9LA 1TL3A 4ILGB 1RTJA 4NCBA 1JXBA 3IS9A 4H0YB 4CGGA 2G8UA 1TL1A 3QERA 4P6PA 1FKOA 1RDDA 1BDGA 3SMSA 4DTJA 3SV3A 1QZ5A 3L4IA 3KHYA 3WXMB 4BGAA 3T69A 4FLUA 3HP9A 3ALYA 4CZMA 3P83D 1U6ZA 4CEFA 4DQSA 1YI2N 4B9SA 3CPWM 4F3TA 3OJSA 3DRRA 4JEPA 3ITHA 3G6EN 3AVMA 3ZETA 3N4QA 4GMJB 4KHYA 4YOYA 1NH9A 5AQJA 1QSSA 2LN3A 1H1VA 3CJAA 2PAVA 1JLEA 2HHVA 2FSKA 2GTCA 4FK4A 2O8EA 4M42A 4B1XB 4CEDA 1U4BA 4B1ZA 2VQEK 2VGMA 2HVIA 1WSJA 4BVPA 1BIZA 3OYJA 2HNZA 4FOEA 5AZIB 4FCXA 4BRHA 3K5NA 1TGOA 5KGXA 1VQKN 2D0PA 2PY5A 4FPAA 3SQ2A 5E41A 1D5AA 4NZRM 4NYNA 2YV0X 2I7NA 4LSNA 4FJXA 4PL8A 2YHAA 2O8FB 4H0VB 4I6MB 3K59A 1SKWA 2A40A 4FM0A 3HPOA 3ZEUB 4CJTA 3VEWA 3CC2N 3E66A 1Q9XA 2ASPA 2JLEA 1JLCA 4RW8A 2HOEA 1RDAA 5C15A 1C0TA 2WTUA 4JKGB 2KZMA 4JKFA 2KZZA 2X6SA 1S22A 2RIUA 3A8YA 3U3YA 4BE0A 3LWLA 5C24A 2CH5A 4DTPA 1ZC6A 4JYAK 3BF1A 1HUXA 1HNXK 1XC9A 4P6DA 2YHXA 4CJ3A 1OVQA 3R6MA 2Z1JA 1U45A 4ICLA 3UIQA 1C1CA 4KH6A 4BR4A 1YJ9N 4JS4A 4B9NA 4M3WA 2KLAA 3CYMA 4B1YB 2FC0A 3KLFA 4BWMA 4DTNA 5AR0A 3TSQA 3HL8A 2YHYA 2X74A 2FBXA 3H6EA 2WC9A 4CJKA 4N5SA 4FLTA 3OW2M 3CMAN 3IABB 1JLQA 4EIAA 2UUCK 3RSEA 1VQ4N 5EVZA 1MU2A 3AARA 1C0MA 4NLCA 4FFJA 2FF3B 2QW9A 1NK9A 1VSJA 1L3UA 4BR0A 3CM6A 3FZFA 3D7EO 3AVIA 4I2PA 1G58A 3LP1A 3QDKA 3DRPA 5HRPA 2ZJPL 1SKRA 2NNWA 4U67L 3RMAA 2RF2A 4FJ5A 1HNZK 1S8EA 3FZLA 1IKYA 3CJCA 1VK0A 3VEXA 2QWMA 1A5WA 5AQFA 3K9KA 4CHPA 3KK1A 2G8FA 3VQ7A 1ZBSA 2R7YA 3LP2A 4MLEA 4K8ZA 1VRTA 2HBMA 4CF2A 3I8DA 4DQIA
chains in the Genus database with same CATH topology
2IVPA 3RVCA 1YF5L 2F9WA 3A5LC 1BU6O 3MWTA 4CZIA 3FGUA 5I9EB 2GEMA 1Q18A 5ADXH 4WQ4C 3L0QA 3ZX0A 1LOTB 2ASOA 4IWVA 1XC3A 5BN8A 2BUPA 2DPNA 4U7BA 1BA0A 1YAGA 3EL2A 4PKIA 3ZX3A 2A3ZA 4IO9L 4BC3A 1NBWA 4EHTA 5FPDA 1PVYA 2OTJN 5KPTA 5JVGL 4Y0WA 4R79A 1BG3A 4MO4A 3GOIA 3IDHA 3VENA 2VCPA 1QHAA 2QWPA 4RCHA 1TYQB 2GWJA 4LC9B 5BRHA 5BRFA 4BRLA 3FLCO 3TSPA 5BRDA 3VF2A 1PVWA 4BRIA 2FSNA 2WFBA 3H1VX 1KK9A 2QWNA 1DGKN 2Q2RA 3O6WA 3EZWA 1IEZA 1BA1A 3WT0A 3H1QA 5BPNA 1LCUA 3FE1A 2RE2A 2P9NA 3WEEB 2UYTA 4H5RA 1GLAG 2GWKA 3MMVA 2P9BA 2Q0RA 1HRUA 1K49A 4FBKA 2HSTA 4BVOA 3CC4N 1WOQA 2AA4A 1V4TA 3R1XA 4C23A 4DHYA 1W97L 1HKBA 3HSCA 3I56N 3J7ZO 1GLJO 3HM8A 3TSUA 4WQ5A 4WFBL 1VAZA 3EO3A 3ENBA 4GY2B 3EN9A 4CD1A 5CE3A 4FWMA 5AQIA 3VESA 3MN7A 4B1WB 3AGRA 5M1NA 3O5BA 3M5RA 5AQTA 4IEEA 4BR2A 5LJWA 4YOWA 4DB3A 4NB4A 3LM9A 5AQZA 5M1QA 5DM7L 5TKWA 4BY9C 2VWBA 4K41A 2ZGZA 2P9IA 4B1VA 5C12A 1VQ8N 3QICA 1OVYA 2IVNA 2QM1A 3HTVA 2P9LA 4JD2B 3GDQA 4H5TA 2W41A 3WQTA 4FWKA 3KVGA 1CZAN 3MGZA 4YOXA 5JICA 3C65A 4NLBA 4A5BA 4GNIA 3CD6N 3I8BA 3T7ZA 2P9PA 4MLHA 4WYBA 4MO5A 1P8ZA 1G99A 5AQGA 1SQKA 5C2FA 1VQ6N 3H46O 1Q86O 2HBJA 2FF6A 2V7ZA 5AQNA 1VQLN 3LS6A 4XH5A 2F7TA 3T1IA 3TTCA 2F9TA 1K4LA 4OPHA 1K8KA 1GLCG 3ZIHA 2OANA 4EO0A 3O1WA 3QBXA 5GINA 1G57A 4P6CA 1ATNA 1Q82O 1IJJA 3SAHA 1SNNA 3L7VA 4FSVA 5AQLA 3UKUA 4M7YA 2J4RA 4A5AA 3RSEB 3ID8A 3F5TA 3C0BA 3CQXA 4AM7A 1Q7YO 5AQSA 2BTFA 3AGKA 2D4WA 3ATUA 4O5FA 2CGKA 2IVOA 4FWNA 2BH1A 2H3GX 3BF3A 3HZ6A 3BEXA 2P9SA 3SAFA 4CZJA 2YJFA 3KWGA 3CMEN 2NRHA 5F2RA 4IEIA 5C0YA 3MIOA 2GUPA 3VGMA 3LDPA 2HBLA 2QWOA 2P9KB 3E1YA 4PL7A 1YXQA 2EQAA 3PLAA 3C6HA 3GE1A 2AP1A 1X3NA 3MN9A 5EX5A 4BRDA 2WBNA 2QWQA 4K43A 5M1FA 1OKJA 2P9UA 3TU5A 4JKHA 3VGLA 2QA4N 1K7JA 3J8AA 4FVUA 4ILHA 4NZTM 3UE5A 2YX6A 3VF4A 3A5NC 3O9UA 2NRTA 1NM1A 2V51B 4ISGA 2ZGYA 4CZLA 1K4PA 4DCHA 2GX9A 2FSJA 4IOCL 4BRAA 4WQ5C 4KBOA 1DT9A 4H0XB 4P8EA 2QI2A 3QMLA 4FWOA 1K73O 1GLLO 3NVKA 1GLFO 4YOTA 1Z6RA 1NGEA 2NRVA 4P8JA 1HLUA 3HI0A 2E2NA 4DQ8A 3M1FA 3TTDA 3EKUA 4ISEA 2FLOA 1M90O 3O8MA 4CBWA 3DJCA 3MN5A 4JKDA 1JCGA 4RWTA 1EQYA 1MA9B 5MLCQ 1XEZA 4WCEL 4A2BA 5AFUA 5JLHA 1NGFA 1TUUA 1MWMA 3LDNA 3E9PA 4H0OA 3CXCM 2PBDA 1NGBA 4IOXA 4JN4A 4CD3A 5H1SQ 5AQQA 2E1YA 3HOTA 4BG8A 1NGCA 3EE8A 1BOTO 4QS7A 3SBTA 1NGDA 1T3VA 3LL3A 1S3XA 2Q97A 1HKCA 5JVHL 4FBWA 1X3MA 4EHUA 3G25A 1KAXA 1BO5O 4H03B 3P04A 4A59A 4CJ7A 3CCQN 3LRJA 3CF5L 1GLBG 1DKGD 1Q81O 3D2FA 2CGJA 3ENOA 2RISA 4CZEA 5AQKA 1D4XA 3CCMN 2P9NB 4CZFA 2HF3A 4WFNL 3WXLA 3MX2A 1T6DA 4YDUC 4IDHA 1XQSC 5AQPA 1K4OA 3ZIIA 2PFUA 1QQOA 3S41A 4M7XA 3D2EA 3VERA 4P77A 5AQYA 3CCVN 4Z94A 4FPBA 3ENHA 3OBYA 4ISFA 3F9MA 3Q7BA 1HPMA 2ZF5O 4A2AA 1ILYA 4BRPA 1QQMA 1N8RO 1YUWA 3O80A 2QWRA 2JWLA 3O9TA 5AQHA 3WXKA 2NLXA 3CJ9A 3MK5A 2A5XA 2JWKA 4KH5A 3SJHA 1K8AO 1RDWX 3VF6A 1QQNA 4PKGA 3FZKA 3CJ7A 5AZIA 4BC4A 3F2KA 3GG4A 3R8EA 3UKRA 4A57A 5M1KA 2CH6A 3GBTA 3MCAB 3NMUA 4FL9A 2P9IB 3K9JA 3I55N 3CPEA 3P39A 5F1XA 3GL1A 2P9LB 1R59O 3WEEA 1C0GA 4ILJA 4OPAA 3C6AA 4BRCA 5BN9A 4BRKA 3W0LA 4M63C 4AM6A 5AZJA 3VGKA 4I6MA 5AFUH 2P9PB 4FWSA 1KAZA 5FPMA 1QVFM 2NZTA 3ZEUA 3CIPA 1NLVA 4BRMA 2KKZA 1DEJA 3VPZA 5E26A 5ELZA 3VEZA 1T6CA 3IFRA 4JKBA 1NGGA 1XUPO 1VQ5N 3LM2A 2KHOA 3AY9A 5HL7L 3CJ1A 1K8KB 1X9JA 2E2QA 4JK7A 5BPLA 3CETA 3P38A 4B1UB 3AAQA 3DLLL 4B9QA 4FWPA 4BRFA 4FWQA 3UKUB 4JKGA 3R3LA 4JHDA 3ATVA 5DM6L 4KH4A 3MX5A 5GAGP 4GV3A 4YDUA 3ZIEA 1RGIA 3NVMA 3VTIA 3EE9A 3SK3A 1HKGA 4FOIA 3WUHA 1NGHA 3WXIA 3C7NA 1KQSM 3M3ZA 3DXMA 4BRNA 4XEIA 2P9SB 1NGAA 3A5MC 4O8KA 3WQUA 3TTFA 3OBWA 3WXJA 5LY3A 3D6RA 3MCPA 4K25A 3G71N 3CI5A 1GLDG 3CCEN 2OTLN 4JAXA 1U2VA 3A5OC 3QFUA 1TUYA 4IO8A 3AAPA 3CCUN 2NRZA 1IG8A 2QXLA 4BGBA 1ESVA 2YHWA 3KK7A 3O4WA 3FFKB 3HBTA 4BQZA 4OO1J 4FWRA 4GV6A 4G9ZA 5KPRA 2P9UB 3BUZB 2NRRA 3DWLA 4L3QA 4H5NA 2ASMA 1Z05A 5EXWA 3MK6A 3U9DA 5M1PA 4JKCA 4CZHA 3N4PA 4H5WA 1JCUA 3O9QA 3CERA 5KQDA 4HVZA 3O1BA 4IOAL 4NO7A 1KC8O 4E1JA 4BREA 1RDUA 1QVGM 1VQNN 4BR9A 1VQMN 2E2PA 5CR4A 4BR5A 1JCFA 2QTDA 3BP8A 4YORA 5HOOA 1KAYA 1NMDA 1SS6A 3H45C 2A42A 1WUAA 3LDQA 5EOYA 3W3DA 1RFQA 3E9LA 4ILGB 4C1NI 2Q0UA 3O9RA 4CZKA 4QS8A 4H0YB 2YI1A 5E84A 3VEYA 2Q1NA 5M1OA 4P6PA 3HRGA 4BROA 5EY4A 4CI6A 1BDGA 3P31A 3SMSA 1QZ5A 3JXUA 3FZMA 3KHYA 3L4IA 3P4IA 3WXMB 3T69A 4BGAA 4C1NK 5GADP 3UB5A 1VQPN 3FR0A 2V52B 4K42A 4CZMA 5AQWA 1MWKA 1U6ZA 1TKUA 1YI2N 3SMPA 1BUPA 3CPWM 5JMVA 3ULEA 3DXKA 1NGJA 1ZXOA 1VQ7N 2E20A 3D2FB 4JEPA 3ZYYX 3CCLN 3MWPA 3G6EN 3IUCA 3LDLA 3ZETA 1KXPA 3N4QA 2YCHA 4IJAA 4JKEA 4CBUA 5AQUA 3QFPA 1HJOA 4XH1A 4F9OA 3MN6A 1M1KO 1NGIA 3LDOA 4YOYA 1YJWN 5AQJA 3VMFB 1YITN 4JK8A 2HF4A 3SLCA 3D2EB 4DKWA 2LN3A 4YOUA 3FZHA 1YJNN 5KQ8A 3CC7N 1H1VA 3CJAA 5AQRA 2PAVA 3U8XA 1YVNA 3CHWA 2FSKA 2VGNA 4IFEA 1ATSA 4BR7A 3OHRA 4B1XB 1QZ6A 3I33A 5B8HA 4B1ZA 2E8AA 2HBKA 2VGMA 2NRXA 3DAWA 1MDUB 2E88A 4WFAL 4BVPA 3CCJN 4YKEA 4FOEA 5AZIB 4FCXA 3VOVA 4BRHA 3UKRB 3CCSN 1W2BM 1TYQA 1VQKN 2D0PA 4FPAA 2Q31A 4NZRM 4PKHA 2YJEA 2I7NA 1J6ZA 4PL8A 2D0OA 2WUSA 5AZJB 2QEXN 2A6AA 4H0VB 4I6MB 1ATRA 3ID6A 4MDAA 2V7YA 2A40A 3ZEUB 3VEVA 1JCEA 3O08A 3HOSA 1K9MO 3Q7CA 3VEWA 3CC2N 2RHKA 3E66A 1HX1A 3CQYA 1YHQN 2ASPA 4BG9A 4CBXA 5F0XA 2ZJRL 1C0FA 1T44A 2HOEA 3CCRN 4A61A 5C15A 4H0PA 5C2DA 4JKGB 4JKFA 4JHDB 4QS9A 4BQLA 1S22A 5FPNA 4BRGA 1VQON 2RIUA 3H07A 3A8YA 2W40A 3H3NO 2CGLA 2CH5A 4UY8O 1ZC6A 3EKSA 5JLFA 4WQ4A 3BF1A 3C7NB 4FBQA 1HUXA 2D1KA 3DXMB 4JD2A 4XH4A 4YOVA 5AQVA 4JK9A 4O8UA 1JJ2M 4I14A 4P6DA 4FO0A 2YHXA 3R6MA 5GIPA 1S72N 1EO1A 2MX1A 4KH6A 4BR4A 1YJ9N 2VYPA 2KLAA 3KWIA 1U2VB 4B1YB 5KPZA 3PIOL 1SZ2A 3R9PA 1P90A 3PIPL 4GVEA 3KZBA 2Q36A 3OA9A 4HTLA 5AR0A 5GAEP 5CHIA 3TSQA 2YHYA 4E1BA 5TKYA 5GIOA 3L4QA 3A0IX 2NRWA 3H6EA 2WC9A 3MDQA 5BR9A 5ADXA 5FPEA 1GLEG 3U4LA 2GELA 3ZX2A 3OW2M 3CMAN 4PHTX 3SAGA 1BWFO 4EIAA 4H5VA 1E4GT 1O13A 4MDBA 3RSEA 4JKAA 1VQ4N 5EVZA 4JNEA 4EFHA 4A62A 3AARA 4BC5A 1SAZA 3IKMA 4NLCA 5BPMA 2FF3B 4J8FA 3QBWA 4WF9L 4GV9A 4FFJA 2QW9A 1V4SA 1KD1O 2E1ZA 2FXUA 4BR0A 3L6QA 3FZFA 4IJNA 3D7EO 2ITMA 5BREA 3AJEA 1G58A 1TKSA 1VQ9N 3QDKA 4AF1A 4EAHD 3JS6A 3O9SA 3U9ZA 2ZJPL 3M6GA 3QB0A 4H0TB 4IZ9A 2NNWA 2P9KA 4U67L 1NJIO 4IXCA 2IIRA 3E9OA 1NWKA 3TPQA 3FZLA 5C10A 1Y64A 3IMXA 2ZJQL 2EWSA 5AQMA 1K4IA 3VTHA 3CJCA 4RTFD 5AQXA 5AQOA 3LQUA 3VEXA 3CJBA 2HMPA 2QWMA 3VETA 2GTDA 5AQFA 3K9KA 3ULEB 3DXKB 3SBGA 3H3OB 1ZBSA 3B8AX 2ZWHA 2E2OA 3ZIGA 1E4FT 1YIJN 4MLEA 3ZETB 4BRQA 3G4SN 2I7PA 2QWLA 4BC2A 3VEOA 2HBMA 5LJVA 5GAHP 2A41A 4FWLA 4HWIA 4CZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VES A;  3VEW A;  3TTF A;  3TSU A;  3VER A;  3TSP A;  3TTD A;  3VTI A;  3VEX A;  3VEO A;  3VF2 A;  3VET A;  3TTC A;  3TSQ A;  3VEN A;  3VEZ A;  3VF4 A;  3VTH A; 
#chains in the Genus database with same CATH topology
 1YF5 L;  3KKR A;  1BU6 O;  4CJR A;  3MWT A;  4X65 K;  3TAE A;  3FGU A;  2HHT A;  3MXM A;  2HHS A;  3QNN A;  1TK8 A;  5ADX H;  2W42 A;  2XY8 A;  1XC3 A;  3SQ1 A;  1ZBI A;  1YAG A;  3BZK A;  4EHT A;  1TKX A;  1BG3 A;  4CK3 A;  5IWA K;  2BKY X;  4LC9 B;  4E7K A;  3ZSO A;  1KK9 A;  5HRN A;  3HPH A;  4JV5 K;  4CGH A;  3WEE B;  2Q0R A;  4CHZ A;  2Q3V A;  4IKF A;  2QK9 A;  4BVO A;  1HKB A;  3OYN A;  1JO0 A;  1WSH A;  1X1P A;  4JI2 K;  1VAZ A;  3EN9 A;  5CE3 A;  3VES A;  3MN7 A;  4Q15 A;  3JSM A;  5AQZ A;  3LM9 A;  3LAM A;  5TKW A;  2VWB A;  2QKB A;  4K41 A;  4PY5 A;  1TKT A;  3HTV A;  2P9L A;  4CIG A;  1CZA N;  4YOX A;  1QHT A;  2P1J A;  4A5B A;  3I8B A;  3LAN A;  1IO2 A;  2P9P A;  2G8V A;  4CJQ A;  4MO5 A;  4OLA A;  5AQG A;  5K14 A;  1SQK A;  4CJ5 A;  1Q86 O;  1NJ8 A;  3U3G A;  4KI4 A;  2LXR A;  2VWJ A;  1JLB A;  1Q82 O;  4FSV A;  2OA8 A;  3O3H A;  3FFI A;  3C0B A;  1Q7Y O;  3TWH A;  3AGK A;  3HPG A;  3ATU A;  3AO4 A;  4X66 K;  1G15 A;  2OZM A;  2HVH A;  4LF5 K;  4CEZ A;  4ELT A;  2NRH A;  5C0Y A;  1C6V A;  3AA3 A;  3LDP A;  3WNE A;  3E1Y A;  1WBD A;  2EQA A;  1NK4 A;  2AJQ A;  1X3N A;  4CEO A;  1FJG K;  4CHN A;  4M3R A;  3TU5 A;  3VGL A;  3J8A A;  4FVU A;  2UUA K;  5KGW A;  1NJW A;  1JLA A;  1VSD A;  4AIL C;  1NM1 A;  1D9F A;  1RBV A;  5HLF A;  4DV5 K;  1FKP A;  2FSJ A;  4BRA A;  1LV5 A;  4B3M K;  4H0X B;  1K73 O;  3NVK A;  4GKK K;  4B9L A;  4P8J A;  2G8H A;  4ISE A;  4RW7 A;  4UQG A;  3O8M A;  2A1S A;  4CBW A;  1X9W A;  4ELV A;  3IG1 A;  1HYV A;  4EZ6 A;  3CFO A;  4FYD A;  4A2B A;  1MWM A;  3CXC M;  3E9P A;  3KLH A;  1WNS A;  2KTQ A;  4H4O A;  3AVK A;  5CZ1 A;  4N47 A;  4CEB A;  1BOT O;  5JS1 A;  1NGD A;  4H03 B;  4A59 A;  3CCQ N;  1GLB G;  4B9M A;  1Q81 O;  2CGJ A;  1D4X A;  3CCM N;  2BE2 A;  4WFN L;  3WXL A;  1T6D A;  4IDH A;  4LFC K;  3SQ0 A;  3ENH A;  3PUF A;  2Z7C A;  4W5Q A;  4E1M A;  2ZF5 O;  4O44 A;  4NCG A;  1QQM A;  2DFF A;  4DV6 K;  3SUQ A;  3OYA A;  1BQN A;  5J2P A;  1HQE A;  3WXK A;  1SKS A;  2NLX A;  1XWL A;  1QQN A;  4PKG A;  3ZSQ A;  3F2K A;  3GG4 A;  3R8E A;  3UKR A;  4A57 A;  3MCA B;  4E7I A;  2P9I B;  3CPE A;  3GL1 A;  2UXC K;  4GW6 A;  1C0G A;  5BN9 A;  3OYL A;  1OH7 A;  2WOM A;  4FWS A;  1KAZ A;  4DR7 K;  3HVR A;  4BRM A;  4JI5 K;  4JKB A;  2RKI A;  3L2W A;  4JRQ A;  5HBM A;  1VQ5 N;  3AY9 A;  2E2Q A;  3CET A;  4FWP A;  4FWQ A;  3UKU B;  4OGE A;  3R3L A;  3F73 A;  4FLX A;  4KH4 A;  3MX5 A;  2YHB A;  1CLQ A;  1RGI A;  5EU7 A;  1H4T A;  3T3F A;  3M3Z A;  1NKB A;  4HHT A;  3T19 A;  4XEI A;  2P9S B;  4O8K A;  3WXJ A;  4E7L A;  1BI4 A;  3TAR A;  1GLD G;  1W9H A;  1U2V A;  3V6D A;  3QFU A;  5J2N A;  3AAP A;  3KLI A;  1J9A A;  2QXL A;  4BGB A;  2RN2 A;  4W5N A;  3FFK B;  4BQZ A;  1T8E A;  2IDO A;  3DWL A;  4L3Q A;  3VQ6 A;  4O0J A;  3MED A;  2YNH A;  5EXW A;  3MK6 A;  1BCM A;  5M1P A;  4CHQ A;  4W5O A;  4DG1 A;  1D8Y A;  2EH1 A;  5KQD A;  3O1B A;  4NO7 A;  1KC8 O;  4FJN A;  1VQN N;  1JXE A;  3L3U A;  2E2P A;  4FJ8 A;  3CG7 A;  2QTD A;  3THX B;  4NCA A;  4DF8 A;  3H45 C;  4KFB A;  1WUA A;  4IG3 A;  1RFQ A;  1SV5 A;  4C1N I;  2Q0U A;  3O9R A;  3OYG A;  2KW4 A;  4QS8 A;  2YI1 A;  5E84 A;  2O8D A;  2Q1N A;  2GUI A;  4B08 A;  3HRG A;  3BDP A;  1ZBH A;  1T7P A;  3QET A;  4B3R K;  3FZM A;  5GAD P;  3AO2 A;  1II7 A;  4KHU A;  4OPK A;  4DQR A;  2V52 B;  3K2P A;  1ZBL A;  5AQW A;  3THW A;  3ULE A;  3D2F B;  3NH1 A;  3CCL N;  1ITG A;  3MWP A;  3LDL A;  1A5V A;  4IJA A;  3TI0 A;  4FJK A;  3LWM A;  5AQU A;  3QFP A;  1HJO A;  3MN6 A;  4J2A A;  3D2E B;  4YOU A;  1RTH A;  1YJN N;  5J2M A;  3HYF A;  1NJ1 A;  2OPQ A;  3RRH A;  3T1Y K;  3EEQ A;  4BR7 A;  3OHR A;  1VSF A;  3OY9 A;  2NRX A;  2E88 A;  2JGU A;  4YKE A;  3CCS N;  4DV7 K;  1Q8I A;  1K6Y A;  2HNY A;  1J6Z A;  1HYZ A;  5AZJ B;  3SUN A;  2A6A A;  3T1A A;  3ID6 A;  3J80 O;  5SWM A;  3HOS A;  3O08 A;  4CEQ A;  2IGI A;  3AVB A;  1HX1 A;  1NOZ A;  4CBX A;  4JI1 K;  4CGI A;  3CCR N;  4A61 A;  3M8Q A;  4RG8 A;  4JHD B;  5I3U A;  3H07 A;  4BRG A;  3HVT A;  1WLJ A;  1RBT A;  3DLR A;  3J7A P;  4DFM A;  2Y1J A;  4FCY A;  5JLF A;  3NH0 A;  4WQ4 A;  4CEC A;  4YOV A;  4JK9 A;  4O8U A;  3HT3 A;  4OKJ A;  1J5O A;  2MX1 A;  4KTZ A;  2VYP A;  3KWI A;  3LPT A;  5KPZ A;  1IBM K;  4CK1 A;  1P90 A;  3AVF A;  4GVE A;  5GAE P;  2FBT A;  4HTL A;  3VQC A;  2PYL A;  2G8W A;  4CW7 B;  4AHU A;  5BR9 A;  3ZSW A;  5FPE A;  3ZX2 A;  4LF4 K;  1HRH A;  1KVA A;  3LDS A;  3M8R A;  1BWF O;  3SI6 A;  1O13 A;  1REV A;  1QQC A;  4BE1 A;  2HW3 A;  4CK2 A;  1SAZ A;  2E5L K;  3RWU A;  3QBW A;  4GV9 A;  4HD0 A;  4KKO A;  2FXU A;  3J7Y P;  3TAM A;  5BRE A;  1CZB A;  4EAH D;  3JS6 A;  3SQ4 A;  3O9S A;  3M6G A;  5CZ2 A;  3U6Y A;  4H0T B;  2P9K A;  3S3M A;  2IIR A;  3IRX A;  2XHB A;  5C10 A;  1K4I A;  3IMX A;  2ZJQ L;  5AQM A;  4HVC A;  4RTF D;  5AQO A;  1EKE A;  3DOL A;  3CJB A;  2DFH A;  3VET A;  1HNI A;  4CGD A;  2ZWH A;  1VRU A;  3ZIG A;  3ZET B;  4BRQ A;  2I7P A;  2FBY A;  5GAH P;  4KPY A;  4HWI A;  4CZG A;  1TVR A;  1JE3 A;  1IBL K;  2GEM A;  3SNN A;  1KSP A;  3TAG A;  4M3U A;  1WAJ A;  3ZX0 A;  2DPN A;  2O8E B;  3EL2 A;  3ZX3 A;  5LL6 Z;  4BC3 A;  1NBW A;  4OGC A;  4OJR A;  1PVY A;  1VSI A;  2OTJ N;  4Y0W A;  3VQP A;  4FLY A;  1WSI A;  1RBS A;  3IDH A;  4DTX A;  2VCP A;  1QHA A;  4RCH A;  2KFZ A;  4FM2 A;  5BRD A;  1U47 A;  2HHQ A;  4FLW A;  4BRI A;  4O4G A;  2FSN A;  2WFB A;  1RBU A;  5FDL A;  1DGK N;  4GKJ K;  1BA1 A;  3TAP A;  5BPN A;  1LCU A;  2P9N A;  3NHG A;  1S9G A;  3LVJ C;  4DWI A;  2HST A;  3CC4 N;  1WOQ A;  3R1X A;  4DHY A;  3S9H A;  4F2R A;  1WSE A;  4OX9 K;  4WQ5 A;  4JRP A;  5HRR A;  3ENB A;  4CHO A;  4AHT A;  4CD1 A;  4B1W B;  4N41 A;  1RT2 A;  4KRF A;  5M1N A;  3O5B A;  3HK2 A;  4IEE A;  1H0Y A;  5LJW A;  4DB3 A;  1U49 A;  5M1Q A;  3THY A;  1LAW A;  3KD1 E;  3HJF A;  2OPR A;  2IAJ A;  1VQ8 N;  1OVY A;  2QM1 A;  1QSY A;  4H5T A;  2W41 A;  4JI6 K;  3MGZ A;  3KVG A;  3DLB A;  1NJ5 A;  4NLB A;  1RIL A;  2G8I A;  4CEA A;  3IAL A;  3DSC A;  4DU3 A;  5C2F A;  1VQ6 N;  3NGI A;  1NJ6 A;  2V7Z A;  2F7T A;  4CGF A;  3TTC A;  4OPH A;  1K8K A;  4OLF A;  4P6C A;  1ATN A;  3ISN C;  1IJJ A;  2BGG A;  4KB1 A;  4LD0 A;  4J2D A;  3LAK A;  4M7Y A;  3OYC A;  4KHQ A;  3HST B;  1EET A;  3IAY A;  3RSE B;  5AQS A;  3OVN A;  4IG0 A;  1CXU A;  2IVO A;  5J2Q A;  2BH1 A;  3BF3 A;  3HZ6 A;  4XIU A;  3CME N;  4BAC A;  3MIO A;  4IEI A;  4W5R A;  3P1G A;  2HBL A;  2QWO A;  1SL1 A;  5SZT A;  1YTA A;  3PLA A;  1VSE A;  3MN9 A;  3K0S A;  3ZT2 A;  2BDP A;  4B3T K;  1OKJ A;  2P9U A;  1NG9 A;  4LF9 K;  4JKH A;  4DU1 A;  4ILH A;  4NZT M;  3HM9 A;  5JS2 A;  3UE5 A;  3TAQ A;  2YX6 A;  3VF4 A;  3O9U A;  3M8S A;  2V51 B;  4ISG A;  4E3S A;  4KHW A;  1DT9 A;  4P8E A;  4M3X A;  2Y1I A;  1GLL O;  3LP3 A;  1HNW K;  4YOT A;  1Z6R A;  4B8A B;  3AA4 A;  4CE9 A;  3ZLJ A;  1M90 O;  4DQ8 A;  4L8R B;  1HC7 A;  2PZS A;  3LZJ A;  3KJV A;  3DJC A;  1LWE A;  4JKD A;  2E6M A;  5C25 A;  1KRP A;  1HJR A;  1NJ2 A;  1XEZ A;  3ZT0 A;  5AFU A;  4NXM K;  1RDB A;  2PBD A;  1NGB A;  1KLN A;  4DMN A;  4GVM A;  3EYZ A;  2UXD K;  1TV6 A;  2G8K A;  2Q97 A;  3ZSX A;  4EHU A;  1F21 A;  1BO5 O;  3L8B A;  3LRJ A;  3CF5 L;  3ENO A;  1TK5 A;  1NK7 A;  4CZE A;  3QLH A;  3DM2 A;  2O8C A;  3AVH A;  3VQ9 A;  2HF3 A;  4FLV A;  1XQS C;  1K4O A;  3ZII A;  1VR4 A;  3S41 A;  3G10 A;  3VER A;  1XI1 A;  1FW6 A;  1R0A A;  4Z94 A;  4C8L A;  4ISF A;  3L2Q A;  3MXI A;  1YUW A;  3O80 A;  5AQH A;  2HHW A;  4I9Q A;  4B9U A;  3MK5 A;  1K8A O;  1CXQ A;  3VF6 A;  2YNG A;  3ZCM A;  1I94 K;  2ZE2 A;  3KLG A;  3QIN A;  3I55 N;  3TAF A;  1S9E A;  1KVC A;  2P9L B;  4O5B A;  3WEE A;  3ZSV A;  4ILJ A;  3C6A A;  4M63 C;  1HYS A;  1Y2I A;  4Z0U A;  2OPS A;  2P9P B;  2Y1B A;  4CJF A;  2NZT A;  3CIP A;  2KKZ A;  4CFD A;  4Q5V A;  3H08 A;  3VEZ A;  1T6C A;  1YTU A;  1OH5 A;  1DTQ A;  3KLE A;  2KHO A;  3NH2 A;  2OPP A;  4B1U B;  3AAQ A;  3ULD A;  3AO1 A;  3U6F A;  1ASW A;  1LW0 A;  5I42 A;  3NVM A;  4BDP A;  3C7N A;  1NKE A;  3DXM A;  4BRN A;  1NGA A;  3B6P A;  3TTF A;  3D6R A;  3MCP A;  3G71 N;  2P51 A;  3CCE N;  4DSK A;  2QXF A;  4DF4 A;  4DLE A;  3G0Z A;  3SUO A;  3KK7 A;  2P5O A;  4OO1 J;  3VQA A;  2DTU A;  2YNF A;  2I5J A;  4HUF A;  4H5N A;  4HUE A;  3V4I A;  1XMQ K;  1C0U A;  1JL2 A;  3NGZ A;  3OS0 A;  4Z4G A;  3N4P A;  4H5W A;  3CER A;  4HVZ A;  3AVJ A;  4M3Z A;  4IOA L;  3TAN A;  3TR8 A;  1BIS A;  1RDU A;  2BAN A;  4BR9 A;  5CR4 A;  1Q9Y A;  5KRT A;  1NMD A;  2A42 A;  5EOY A;  1W7A A;  3L2U A;  4CZK A;  1GOA A;  4I7F A;  3L2R A;  3VEY A;  3DI6 A;  4DSE A;  1NKC A;  3OYM A;  1WAF A;  3P31 A;  3JXU A;  2Z1I A;  3QEI A;  5HRO A;  3UB5 A;  4K42 A;  2O8B A;  1MWK A;  4DR6 K;  1TKU A;  1BUP A;  5JMV A;  3DXK A;  4YHH K;  3NAE A;  3ZYY X;  1KLM A;  1N5Y A;  3IUC A;  1KXP A;  4E7J A;  2YCH A;  4JKE A;  3CFR A;  5FLX O;  1LW2 A;  3ASM A;  4OPJ A;  3LDO A;  1YJW N;  1Z26 A;  3VMF B;  1YIT N;  2HF4 A;  3SLC A;  1U04 A;  3ZT1 A;  4DKW A;  4FZZ A;  5KQ8 A;  3CC7 N;  1YVN A;  2Z1G A;  2VGN A;  1A5X A;  1ATS A;  4K8X A;  4BE2 A;  2Q3S A;  4R5P A;  1HQU A;  2E8A A;  2HBK A;  1W0H A;  4I2Q A;  4ZTF A;  1MDU B;  3UKR B;  1TYQ A;  4DLG A;  2Q31 A;  1EWQ A;  2GBZ A;  3THV A;  3E01 A;  1HMV A;  4RW4 A;  3SCX A;  2ZD1 A;  1DTT A;  2WUS A;  2QEX N;  4LF7 K;  3D45 A;  1ATR A;  4CJP A;  4YY3 K;  3K5O A;  2V7Y A;  1SUQ A;  3VEV A;  1JCE A;  4B9T A;  1S6P A;  4JS5 A;  2RHK A;  3DLH A;  1RTI A;  2HB5 A;  3CQY A;  3KKS A;  1YHQ N;  4BG9 A;  4FJG A;  1TKD A;  1C0F A;  1T44 A;  4CJW A;  5C2D A;  4YNQ A;  4QS9 A;  4BQL A;  3DYA A;  1H4Q A;  5FPN A;  4CIE A;  4E1N A;  1VQO N;  5FRN A;  1UAX A;  1N6Q A;  2D5R A;  2CGL A;  3V1O A;  1X9M A;  3EKS A;  1WB9 A;  1L5U A;  3PO4 A;  1RNH A;  4C8K A;  2IFE A;  4XH4 A;  3RR7 A;  4JD2 A;  2YKM A;  3NF6 A;  4YFU A;  4K88 A;  4DS4 A;  5GIP A;  1S72 N;  4Z4I A;  1BI4 B;  3DMJ A;  4M41 A;  1U2V B;  3PIO L;  3PIP L;  3KZB A;  4BDZ A;  3OA9 A;  4E1B A;  5TKY A;  5GIO A;  3L4Q A;  3A0I X;  2NRW A;  4ZHR A;  3U4L A;  4F2S A;  4DTO A;  1BGX T;  3NCI A;  4H5V A;  1E4G T;  1IH7 A;  3KK3 A;  4MDB A;  1WSG A;  4JNE A;  3LZI A;  2F96 A;  3AO3 A;  4E19 A;  4BC5 A;  1ASV A;  3IKM A;  5BPM A;  5IT9 O;  4J8F A;  4DFP A;  3AV9 A;  1NOY A;  1KTQ A;  1KD1 O;  2QKK A;  1IBK K;  4HCC A;  2ITM A;  4IJN A;  3AJE A;  4DV0 K;  1TKS A;  4FVM A;  1XMO K;  3F9K A;  1NK5 A;  3U9Z A;  3QB0 A;  4FK0 A;  4IZ9 A;  2O8D B;  1NJI O;  3E9O A;  1LWF A;  1S1X A;  3TPQ A;  4HCB A;  2EWS A;  1IKW A;  2IOC A;  3VTH A;  5AQX A;  4DR1 K;  2HMP A;  3ZSY A;  3THW B;  1SL2 A;  1WN7 A;  3AVN A;  4DTR A;  3S3N A;  4FXD A;  1PAV A;  3PSF A;  3ULE B;  3SBG A;  3OYK A;  4Y1C A;  2E2O A;  1E4F T;  1BCO A;  3PSI A;  1IV0 A;  2ITG A;  4DR3 K;  5LJV A;  1UA1 A;  4FWL A;  4FM1 A;  4M3Y A;  2IVP A;  1S5J A;  5I9E B;  1Q18 A;  5CYM A;  4I9L A;  3SPZ A;  4FLZ A;  4WQ4 C;  1LOT B;  2ASO A;  1O1W A;  4K0K K;  4ID5 A;  5BN8 A;  2BUP A;  1H0X A;  1H4S A;  4RW6 A;  3RMD A;  4PKI A;  1Y97 A;  3SUP A;  2A3Z A;  4IO9 L;  5FPD A;  3J81 O;  4R79 A;  4LFA K;  3VEN A;  2QWP A;  4CJV A;  2F4V K;  4BRL A;  3FLC O;  3TSP A;  1PVW A;  4DR4 K;  3H1V X;  2Q2R A;  4OVL A;  2B5J A;  3O6W A;  2H9U A;  4DUZ K;  1RT4 A;  3H1Q A;  3TAB A;  2RE2 A;  4CF9 A;  3NFA A;  4DQQ A;  1GLA G;  4FJ7 A;  2P9B A;  1HRU A;  1NNE A;  1K49 A;  4RW9 A;  4HVJ A;  1X9S A;  2AA4 A;  1V4T A;  1W97 L;  5A2Q O;  3I56 N;  1S1V A;  3M8P A;  1BL3 A;  3HM8 A;  1QE1 A;  4WFB L;  3OS2 A;  1LWC A;  4Y1D A;  3EO3 A;  4GY2 B;  1IG9 A;  3S3O A;  1I3A A;  5AQI A;  3AGR A;  1VSK A;  4EP5 A;  3M5R A;  3NF8 A;  4YOW A;  4ZTJ A;  5LMU K;  4NB4 A;  5DM7 L;  1JL1 A;  4BY9 C;  3DRS A;  5D3G A;  2IVN A;  1S1T A;  4CIF A;  3VA0 A;  4CES A;  4CVN E;  3NF7 A;  2EHG A;  3CD6 N;  4DV4 K;  1B92 A;  4WYB A;  4W5T A;  3H46 O;  2HBJ A;  3LS6 A;  1K4L A;  2CRQ A;  2F9T A;  2OAN A;  2D0C A;  3QNO A;  5GIN A;  1SNN A;  5AQL A;  4AHV A;  1S1W A;  2J4R A;  4A5A A;  3F5T A;  3CQX A;  4AM7 A;  2VG5 A;  3K58 A;  1D9D A;  2M71 A;  2BTF A;  4CFC A;  4DS5 A;  1VSM A;  4O5F A;  2CGK A;  4FWN A;  2H3G X;  3BEX A;  3SAF A;  1VHX A;  3KWG A;  5F2R A;  4CER A;  3QO9 A;  2GUP A;  1LN4 A;  2P9K B;  3CQ8 A;  1YXQ A;  3K57 A;  1T05 A;  3DLK A;  3QEV A;  3OYB A;  1QSL A;  3QIO A;  2QWQ A;  1NJY A;  3MEE A;  3JYT A;  2QA4 N;  3NE6 A;  1TIG A;  1TAQ A;  4EP4 A;  1RDC A;  4FW1 A;  2Z1H A;  2D0A A;  4CZL A;  5KRS A;  2GX9 A;  3V9U A;  4IOC L;  3LVK B;  4WQ5 C;  1GOC A;  2F8S A;  2QI2 A;  2F8T A;  1GLF O;  4DV2 K;  4JI8 K;  1ASU A;  3O3F A;  3HI0 A;  2E2N A;  1RQ8 A;  1UDV A;  3EKU A;  2FLO A;  5KTQ A;  2XO7 A;  1NFH A;  4RWT A;  1QTM A;  4ELU A;  1EQY A;  5J1E A;  4KTQ A;  4B8C A;  1NGF A;  1TUU A;  4H0O A;  3OYD A;  4JN4 A;  3HOT A;  4HTU A;  4KI6 A;  4BWJ A;  3I0R A;  3EE8 A;  3A2F A;  4QS7 A;  2NUB A;  3SBT A;  1HKC A;  5JVH L;  1X3M A;  3P04 A;  3P5J A;  4E0D A;  4LSL A;  5AQK A;  3LAL A;  2IS3 A;  2P9N B;  3MX2 A;  4YDU C;  1NJX A;  4FW2 A;  2PFU A;  4F4K A;  1QQO A;  2RPI A;  4KHP K;  3AO5 A;  3JAM O;  1JLF A;  1RT5 A;  3CCV N;  1U48 A;  4FJ9 A;  1TK0 A;  3F9M A;  1HPM A;  1ILY A;  1JDQ A;  4BRP A;  5CYQ A;  3VQ8 A;  4O55 A;  2QWR A;  2HND A;  3O9T A;  1KCF A;  4HUG A;  1J53 A;  4FJH A;  3CJ9 A;  2JWK A;  3SJH A;  1RDW X;  3CJ7 A;  5AZI A;  5M1K A;  3KD5 E;  4KRE A;  3THY B;  1OH6 A;  2B6A A;  4FL9 A;  3K9J A;  5F1X A;  3O3G A;  1UWB A;  1R59 O;  5T7B A;  4OPA A;  4BRK A;  3W0L A;  2O8F A;  1UA0 A;  4I6M A;  5AFU H;  1QVF M;  4DV3 K;  4AH9 A;  1CZ9 A;  3ZEU A;  1NLV A;  3SV4 A;  4FJL A;  1WSF A;  4CF1 A;  3VPZ A;  5E26 A;  5ELZ A;  2D0B A;  3IFR A;  1XUP O;  3LM2 A;  5HL7 L;  1HR0 K;  1K8K B;  5BR8 K;  2DFE A;  3P38 A;  1T03 A;  2VQF K;  2UUB K;  3RR8 A;  3ZT3 A;  4FJJ A;  1TKZ A;  4QAG A;  3HO1 A;  4JKG A;  4JLH A;  1LAV A;  2OCE A;  3ATV A;  5DM6 L;  3MEG A;  5GAG P;  4KTW A;  4GV3 A;  4YDU A;  1S1U A;  4DTU A;  2YKN A;  4IFY A;  3VTI A;  2VWK A;  3EE9 A;  3WXI A;  5KI6 A;  4DSF A;  3WQU A;  3OBW A;  3AVG A;  2OTL N;  4JAX A;  3L2V A;  3A5O C;  3V9Z A;  2XY6 A;  4IO8 A;  3CCU N;  3VQB A;  3HBT A;  3C94 A;  4FWR A;  1HPZ A;  2P9U B;  3BUZ B;  2NRR A;  3U9D A;  1N33 K;  3IAB A;  4JKC A;  4CZH A;  2FBV A;  4DTS A;  3PO5 A;  3O9Q A;  1YVU A;  4KV8 A;  3LPU A;  3DLG A;  3MEC A;  4E1J A;  4LF8 K;  3L3V A;  1VQM N;  4YOR A;  5HOO A;  1NK6 A;  4DFJ A;  3T1H K;  1DLO A;  2L8Y A;  1N36 K;  1YT3 A;  3ZSZ A;  3V9S A;  4B3S K;  1L3T A;  4KB0 A;  4QOZ B;  5M1O A;  4CGJ A;  4BRO A;  5EY4 A;  4CI6 A;  4C1N K;  4PWD A;  1C1B A;  3P4I A;  1VQP N;  3FR0 A;  3PY8 A;  3OYH A;  4KHN A;  3SMP A;  4CCH A;  4DFK A;  1NGJ A;  1ZXO A;  1VQ7 N;  2E20 A;  3I0S A;  4IDK A;  3C6U A;  1OH8 A;  4H4M A;  3EZ5 A;  4CBU A;  2O8C B;  3ZSR A;  4XH1 A;  3VQQ A;  4F9O A;  1RT7 A;  3NF9 A;  3O4N A;  1NGI A;  5FRO A;  1SL0 A;  1M1K O;  4FZY A;  1KVB A;  1GOB A;  4JK8 A;  2VG6 A;  2HHH K;  3FZH A;  5AQR A;  3U8X A;  3CHW A;  4IFE A;  1QZ6 A;  3I33 A;  5B8H A;  1NJZ A;  3DAW A;  4KAZ A;  4WFA L;  3CCJ N;  2KFN A;  3VOV A;  1W2B M;  4CFA A;  3VQ4 A;  4Z4F A;  4WE1 A;  4PKH A;  2YJE A;  2DY4 A;  4NYF A;  4PUO A;  2D0O A;  3BZC A;  4MDA A;  1K9M O;  3Q7C A;  3BGR A;  5C42 A;  2B4J A;  2VG7 A;  1VSL A;  5F0X A;  4AHC A;  2ZJR L;  1RCH A;  4H0P A;  1FK9 A;  2W40 A;  3H3N O;  4M3T A;  5LMN K;  2HMI A;  3PX6 A;  4UY8 O;  4C8M A;  3SZ2 A;  4DSI A;  1ZBF A;  3K5L A;  4JI4 K;  3C7N B;  4FBQ A;  2D1K A;  3DXM B;  4K87 A;  4I14 A;  5AQV A;  1JJ2 M;  2ZQB A;  4FO0 A;  2GV9 A;  1EO1 A;  4E89 A;  4X64 K;  4PA1 A;  4CHY A;  1SZ2 A;  2YNI A;  3DLE A;  3R9P A;  3ZT4 A;  2Q36 A;  2XY7 A;  3SJJ A;  5CHI A;  4X62 K;  3MDQ A;  5ADX A;  1GLE G;  2GEL A;  4Q0B A;  4PHT X;  3SAG A;  3AVL A;  4JKA A;  4EFH A;  4A62 A;  3V1Q A;  4WF9 L;  3MXJ A;  1E3M A;  1V4S A;  2E1Z A;  3HXM A;  3L6Q A;  4Z9E A;  1KFD A;  1VQ9 N;  2W6K A;  4AF1 A;  4DR2 K;  1RT6 A;  4YDQ A;  2ATQ A;  1JLG A;  4Z4C A;  3VN5 A;  1RT1 A;  3QEW A;  1WBB A;  5DK5 A;  4IXC A;  3OYE A;  1NWK A;  3AVC A;  1Z25 A;  3AA5 X;  1Y64 A;  1NFJ A;  4K86 A;  4BDY A;  3LQU A;  2XRI A;  2UXB K;  4F8R A;  3WNG A;  4FJM A;  2GTD A;  3QIP A;  3PV8 A;  2O8B B;  5CY4 A;  1EXQ A;  1VSH A;  1BIU A;  2KQ2 A;  3DXK B;  3H3O B;  4FZX C;  3B8A X;  1YIJ N;  3G4S N;  1BQM A;  2QWL A;  4BC2 A;  3VEO A;  2A41 A;  1L3S A;  3RVC A;  2F9W A;  3A5L C;  4CZI A;  4J2E A;  5AJ3 K;  3BY5 A;  4Z4E A;  3L0Q A;  4IWV A;  2OYQ A;  4U7B A;  1BA0 A;  1DCJ A;  3MAQ A;  5KPT A;  5JVG L;  4DSJ A;  1L3V A;  4MO4 A;  3GOI A;  4CF0 A;  1TYQ B;  2GWJ A;  5BRH A;  3OS1 A;  5BRF A;  4DSL A;  3OJU A;  2E4L A;  3SYZ A;  3VF2 A;  3AA2 A;  2QWN A;  3NBP A;  3EZW A;  1IEZ A;  3WT0 A;  4V19 S;  3FE1 A;  1JKH A;  1S6Q A;  2UYT A;  4H5R A;  2GWK A;  3MMV A;  4MQ3 A;  2HHU A;  4FBK A;  3OYF A;  4FJI A;  4C23 A;  3HSC A;  4O0I A;  3J7Z O;  4OLB A;  1GLJ O;  3TSU A;  1EX4 A;  2LSN A;  3VQ5 A;  3WNH A;  4FWM A;  3HP6 A;  5HRS A;  5AQT A;  4BR2 A;  4CJU A;  1NMN A;  2A1R A;  2ZGZ A;  2P9I A;  4B1V A;  5C12 A;  3VA3 A;  3QIC A;  4JD2 B;  3GDQ A;  3WQT A;  4NCX A;  4FWK A;  4AHR A;  3D0P A;  4DQP A;  5JIC A;  3C65 A;  4GNI A;  3KTQ A;  3T7Z A;  4F3O A;  4MLH A;  1ZYQ A;  2HHX A;  1P8Z A;  1G99 A;  1HNV A;  4LY7 A;  1RT3 A;  2FF6 A;  5AQN A;  3V9W A;  3KIO A;  1VQL N;  4XH5 A;  4DU4 A;  1Y9X A;  3T1I A;  4J2B A;  1GLC G;  3ZIH A;  3O1W A;  4EO0 A;  3QBX A;  1G57 A;  3SAH A;  2X78 A;  3L7V A;  3UKU A;  3ID8 A;  2O4G A;  1N34 K;  4DTM A;  2D4W A;  3QES A;  1J5E K;  4AHS A;  3OYI A;  2P9S A;  4CZJ A;  2YJF A;  4B3O A;  1XNR K;  2ETJ A;  4OKE A;  3VGM A;  4IBN A;  1EWR A;  4PL7 A;  3SPY A;  2E6L A;  4LF6 K;  1IKV A;  3C6H A;  2AP1 A;  3GE1 A;  3CM5 A;  4TSX A;  5EX5 A;  4MFB A;  4BRD A;  3PX0 A;  5FRM A;  2WBN A;  5M1F A;  4K43 A;  3RRG A;  4N56 A;  1K7J A;  3RMC A;  3EY1 A;  4CJL A;  3A5N C;  3NGY A;  2X6N A;  4CEE A;  2NRT A;  2ZGY A;  1K4P A;  4DCH A;  4Z4H A;  4CJE A;  4KBO A;  3QML A;  4CJS A;  4FWO A;  1XHX A;  3V1R A;  1NGE A;  2PYJ A;  2NRV A;  3HZ7 A;  3C95 A;  3THX A;  1HLU A;  3M1F A;  3TTD A;  3MN5 A;  1JCG A;  1ZBU A;  1MA9 B;  5MLC Q;  4WCE L;  4KO0 A;  5JLH A;  3K5M A;  3LDN A;  1NK8 A;  4IOX A;  5H1S Q;  4CD3 A;  4DUY K;  5AQQ A;  2E1Y A;  1RBR A;  4BG8 A;  3VQD A;  1NGC A;  3O4Q A;  1UOC A;  1T3V A;  4PQU A;  3LL3 A;  1S3X A;  1FXX A;  4CFB A;  4DV1 K;  4FBW A;  2WON A;  3G25 A;  1KAX A;  4TWA A;  4CJ7 A;  4JI7 K;  3C6T A;  2OZS A;  1DKG D;  3D2F A;  2RIS A;  4B9V A;  4C8O A;  4CZF A;  2ZM6 K;  5AQP A;  3QEX A;  2EK0 A;  4M7X A;  3D2E A;  4P77 A;  5AQY A;  4FPB A;  3OBY A;  4JI0 K;  3TOE A;  3Q7B A;  4A2A A;  1XHZ A;  3DOK A;  1N8R O;  2JWL A;  3RMB A;  4LH5 A;  2A5X A;  4KH5 A;  3FZK A;  1EP4 A;  4LH4 A;  4BC4 A;  4H8K A;  4C8N A;  2CH6 A;  3GBT A;  3NMU A;  4E7H A;  3P39 A;  4IFV A;  4BRC A;  5AZJ A;  4AM6 A;  1NU0 A;  3VGK A;  2EX3 A;  1B9D A;  4CJ4 A;  5FPM A;  1B9F A;  3WBM A;  1DEJ A;  4CF8 A;  4KHS A;  1NGG A;  4G1Q A;  4JI3 K;  4NXN K;  5HP1 A;  3CJ1 A;  4JK7 A;  1X9J A;  5BPL A;  1NK0 A;  1QS4 A;  4M45 A;  2UU9 K;  3DLL L;  4B9Q A;  4BRF A;  4JHD A;  4AQY K;  4N76 A;  4ID1 A;  3NDK A;  5DMR A;  3AVA A;  3ZIE A;  3B6O A;  1N32 K;  3SK3 A;  1HKG A;  4FOI A;  3WUH A;  1NGH A;  1KQS M;  3V9X A;  1C1A A;  2P5G A;  1VM0 A;  3A5M C;  2A2Y A;  3OTO K;  5LY3 A;  3KK2 A;  4K25 A;  3QEP A;  3CI5 A;  3RTV A;  1I39 A;  4FK2 A;  1TUY A;  2W6L A;  1TAU A;  2XY5 A;  2NRZ A;  1IG8 A;  1ESV A;  2YHW A;  3O4W A;  4GV6 A;  4G9Z A;  5KPR A;  2O4I A;  3CFP A;  1IKX A;  1RTD A;  4DR5 K;  3PX4 A;  2ASM A;  1BHL A;  4EZ9 A;  1Z05 A;  4LFB K;  1J54 A;  1JCU A;  3WNF A;  3DSD A;  3VQE A;  2IC3 A;  4BRE A;  1QVG M;  3V81 A;  4BR5 A;  1JCF A;  3BP8 A;  1KFS A;  4QCL A;  1KAY A;  1XNQ K;  4WI1 A;  1SS6 A;  3QKB A;  4OKK A;  3LP0 A;  3LDQ A;  3W3D A;  3E9L A;  1TL3 A;  4ILG B;  1RTJ A;  4NCB A;  1JXB A;  3IS9 A;  4H0Y B;  4CGG A;  2G8U A;  1TL1 A;  3QER A;  4P6P A;  1FKO A;  1RDD A;  1BDG A;  3SMS A;  4DTJ A;  3SV3 A;  1QZ5 A;  3L4I A;  3KHY A;  3WXM B;  4BGA A;  3T69 A;  4FLU A;  3HP9 A;  3ALY A;  4CZM A;  3P83 D;  1U6Z A;  4CEF A;  4DQS A;  1YI2 N;  4B9S A;  3CPW M;  4F3T A;  3OJS A;  3DRR A;  4JEP A;  3ITH A;  3G6E N;  3AVM A;  3ZET A;  3N4Q A;  4GMJ B;  4KHY A;  4YOY A;  1NH9 A;  5AQJ A;  1QSS A;  2LN3 A;  1H1V A;  3CJA A;  2PAV A;  1JLE A;  2HHV A;  2FSK A;  2GTC A;  4FK4 A;  2O8E A;  4M42 A;  4B1X B;  4CED A;  1U4B A;  4B1Z A;  2VQE K;  2VGM A;  2HVI A;  1WSJ A;  4BVP A;  1BIZ A;  3OYJ A;  2HNZ A;  4FOE A;  5AZI B;  4FCX A;  4BRH A;  3K5N A;  1TGO A;  5KGX A;  1VQK N;  2D0P A;  2PY5 A;  4FPA A;  3SQ2 A;  5E41 A;  1D5A A;  4NZR M;  4NYN A;  2YV0 X;  2I7N A;  4LSN A;  4FJX A;  4PL8 A;  2YHA A;  2O8F B;  4H0V B;  4I6M B;  3K59 A;  1SKW A;  2A40 A;  4FM0 A;  3HPO A;  3ZEU B;  4CJT A;  3VEW A;  3CC2 N;  3E66 A;  1Q9X A;  2ASP A;  2JLE A;  1JLC A;  4RW8 A;  2HOE A;  1RDA A;  5C15 A;  1C0T A;  2WTU A;  4JKG B;  2KZM A;  4JKF A;  2KZZ A;  2X6S A;  1S22 A;  2RIU A;  3A8Y A;  3U3Y A;  4BE0 A;  3LWL A;  5C24 A;  2CH5 A;  4DTP A;  1ZC6 A;  4JYA K;  3BF1 A;  1HUX A;  1HNX K;  1XC9 A;  4P6D A;  2YHX A;  4CJ3 A;  1OVQ A;  3R6M A;  2Z1J A;  1U45 A;  4ICL A;  3UIQ A;  1C1C A;  4KH6 A;  4BR4 A;  1YJ9 N;  4JS4 A;  4B9N A;  4M3W A;  2KLA A;  3CYM A;  4B1Y B;  2FC0 A;  3KLF A;  4BWM A;  4DTN A;  5AR0 A;  3TSQ A;  3HL8 A;  2YHY A;  2X74 A;  2FBX A;  3H6E A;  2WC9 A;  4CJK A;  4N5S A;  4FLT A;  3OW2 M;  3CMA N;  3IAB B;  1JLQ A;  4EIA A;  2UUC K;  3RSE A;  1VQ4 N;  5EVZ A;  1MU2 A;  3AAR A;  1C0M A;  4NLC A;  4FFJ A;  2FF3 B;  2QW9 A;  1NK9 A;  1VSJ A;  1L3U A;  4BR0 A;  3CM6 A;  3FZF A;  3D7E O;  3AVI A;  4I2P A;  1G58 A;  3LP1 A;  3QDK A;  3DRP A;  5HRP A;  2ZJP L;  1SKR A;  2NNW A;  4U67 L;  3RMA A;  2RF2 A;  4FJ5 A;  1HNZ K;  1S8E A;  3FZL A;  1IKY A;  3CJC A;  1VK0 A;  3VEX A;  2QWM A;  1A5W A;  5AQF A;  3K9K A;  4CHP A;  3KK1 A;  2G8F A;  3VQ7 A;  1ZBS A;  2R7Y A;  3LP2 A;  4MLE A;  4K8Z A;  1VRT A;  2HBM A;  4CF2 A;  3I8D A;  4DQI A; 
#chains in the Genus database with same CATH homology
 2IVP A;  3RVC A;  1YF5 L;  2F9W A;  3A5L C;  1BU6 O;  3MWT A;  4CZI A;  3FGU A;  5I9E B;  2GEM A;  1Q18 A;  5ADX H;  4WQ4 C;  3L0Q A;  3ZX0 A;  1LOT B;  2ASO A;  4IWV A;  1XC3 A;  5BN8 A;  2BUP A;  2DPN A;  4U7B A;  1BA0 A;  1YAG A;  3EL2 A;  4PKI A;  3ZX3 A;  2A3Z A;  4IO9 L;  4BC3 A;  1NBW A;  4EHT A;  5FPD A;  1PVY A;  2OTJ N;  5KPT A;  5JVG L;  4Y0W A;  4R79 A;  1BG3 A;  4MO4 A;  3GOI A;  3IDH A;  3VEN A;  2VCP A;  1QHA A;  2QWP A;  4RCH A;  1TYQ B;  2GWJ A;  4LC9 B;  5BRH A;  5BRF A;  4BRL A;  3FLC O;  3TSP A;  5BRD A;  3VF2 A;  1PVW A;  4BRI A;  2FSN A;  2WFB A;  3H1V X;  1KK9 A;  2QWN A;  1DGK N;  2Q2R A;  3O6W A;  3EZW A;  1IEZ A;  1BA1 A;  3WT0 A;  3H1Q A;  5BPN A;  1LCU A;  3FE1 A;  2RE2 A;  2P9N A;  3WEE B;  2UYT A;  4H5R A;  1GLA G;  2GWK A;  3MMV A;  2P9B A;  2Q0R A;  1HRU A;  1K49 A;  4FBK A;  2HST A;  4BVO A;  3CC4 N;  1WOQ A;  2AA4 A;  1V4T A;  3R1X A;  4C23 A;  4DHY A;  1W97 L;  1HKB A;  3HSC A;  3I56 N;  3J7Z O;  1GLJ O;  3HM8 A;  3TSU A;  4WQ5 A;  4WFB L;  1VAZ A;  3EO3 A;  3ENB A;  4GY2 B;  3EN9 A;  4CD1 A;  5CE3 A;  4FWM A;  5AQI A;  3VES A;  3MN7 A;  4B1W B;  3AGR A;  5M1N A;  3O5B A;  3M5R A;  5AQT A;  4IEE A;  4BR2 A;  5LJW A;  4YOW A;  4DB3 A;  4NB4 A;  3LM9 A;  5AQZ A;  5M1Q A;  5DM7 L;  5TKW A;  4BY9 C;  2VWB A;  4K41 A;  2ZGZ A;  2P9I A;  4B1V A;  5C12 A;  1VQ8 N;  3QIC A;  1OVY A;  2IVN A;  2QM1 A;  3HTV A;  2P9L A;  4JD2 B;  3GDQ A;  4H5T A;  2W41 A;  3WQT A;  4FWK A;  3KVG A;  1CZA N;  3MGZ A;  4YOX A;  5JIC A;  3C65 A;  4NLB A;  4A5B A;  4GNI A;  3CD6 N;  3I8B A;  3T7Z A;  2P9P A;  4MLH A;  4WYB A;  4MO5 A;  1P8Z A;  1G99 A;  5AQG A;  1SQK A;  5C2F A;  1VQ6 N;  3H46 O;  1Q86 O;  2HBJ A;  2FF6 A;  2V7Z A;  5AQN A;  1VQL N;  3LS6 A;  4XH5 A;  2F7T A;  3T1I A;  3TTC A;  2F9T A;  1K4L A;  4OPH A;  1K8K A;  1GLC G;  3ZIH A;  2OAN A;  4EO0 A;  3O1W A;  3QBX A;  5GIN A;  1G57 A;  4P6C A;  1ATN A;  1Q82 O;  1IJJ A;  3SAH A;  1SNN A;  3L7V A;  4FSV A;  5AQL A;  3UKU A;  4M7Y A;  2J4R A;  4A5A A;  3RSE B;  3ID8 A;  3F5T A;  3C0B A;  3CQX A;  4AM7 A;  1Q7Y O;  5AQS A;  2BTF A;  3AGK A;  2D4W A;  3ATU A;  4O5F A;  2CGK A;  2IVO A;  4FWN A;  2BH1 A;  2H3G X;  3BF3 A;  3HZ6 A;  3BEX A;  2P9S A;  3SAF A;  4CZJ A;  2YJF A;  3KWG A;  3CME N;  2NRH A;  5F2R A;  4IEI A;  5C0Y A;  3MIO A;  2GUP A;  3VGM A;  3LDP A;  2HBL A;  2QWO A;  2P9K B;  3E1Y A;  4PL7 A;  1YXQ A;  2EQA A;  3PLA A;  3C6H A;  3GE1 A;  2AP1 A;  1X3N A;  3MN9 A;  5EX5 A;  4BRD A;  2WBN A;  2QWQ A;  4K43 A;  5M1F A;  1OKJ A;  2P9U A;  3TU5 A;  4JKH A;  3VGL A;  2QA4 N;  1K7J A;  3J8A A;  4FVU A;  4ILH A;  4NZT M;  3UE5 A;  2YX6 A;  3VF4 A;  3A5N C;  3O9U A;  2NRT A;  1NM1 A;  2V51 B;  4ISG A;  2ZGY A;  4CZL A;  1K4P A;  4DCH A;  2GX9 A;  2FSJ A;  4IOC L;  4BRA A;  4WQ5 C;  4KBO A;  1DT9 A;  4H0X B;  4P8E A;  2QI2 A;  3QML A;  4FWO A;  1K73 O;  1GLL O;  3NVK A;  1GLF O;  4YOT A;  1Z6R A;  1NGE A;  2NRV A;  4P8J A;  1HLU A;  3HI0 A;  2E2N A;  4DQ8 A;  3M1F A;  3TTD A;  3EKU A;  4ISE A;  2FLO A;  1M90 O;  3O8M A;  4CBW A;  3DJC A;  3MN5 A;  4JKD A;  1JCG A;  4RWT A;  1EQY A;  1MA9 B;  5MLC Q;  1XEZ A;  4WCE L;  4A2B A;  5AFU A;  5JLH A;  1NGF A;  1TUU A;  1MWM A;  3LDN A;  3E9P A;  4H0O A;  3CXC M;  2PBD A;  1NGB A;  4IOX A;  4JN4 A;  4CD3 A;  5H1S Q;  5AQQ A;  2E1Y A;  3HOT A;  4BG8 A;  1NGC A;  3EE8 A;  1BOT O;  4QS7 A;  3SBT A;  1NGD A;  1T3V A;  3LL3 A;  1S3X A;  2Q97 A;  1HKC A;  5JVH L;  4FBW A;  1X3M A;  4EHU A;  3G25 A;  1KAX A;  1BO5 O;  4H03 B;  3P04 A;  4A59 A;  4CJ7 A;  3CCQ N;  3LRJ A;  3CF5 L;  1GLB G;  1DKG D;  1Q81 O;  3D2F A;  2CGJ A;  3ENO A;  2RIS A;  4CZE A;  5AQK A;  1D4X A;  3CCM N;  2P9N B;  4CZF A;  2HF3 A;  4WFN L;  3WXL A;  3MX2 A;  1T6D A;  4YDU C;  4IDH A;  1XQS C;  5AQP A;  1K4O A;  3ZII A;  2PFU A;  1QQO A;  3S41 A;  4M7X A;  3D2E A;  3VER A;  4P77 A;  5AQY A;  3CCV N;  4Z94 A;  4FPB A;  3ENH A;  3OBY A;  4ISF A;  3F9M A;  3Q7B A;  1HPM A;  2ZF5 O;  4A2A A;  1ILY A;  4BRP A;  1QQM A;  1N8R O;  1YUW A;  3O80 A;  2QWR A;  2JWL A;  3O9T A;  5AQH A;  3WXK A;  2NLX A;  3CJ9 A;  3MK5 A;  2A5X A;  2JWK A;  4KH5 A;  3SJH A;  1K8A O;  1RDW X;  3VF6 A;  1QQN A;  4PKG A;  3FZK A;  3CJ7 A;  5AZI A;  4BC4 A;  3F2K A;  3GG4 A;  3R8E A;  3UKR A;  4A57 A;  5M1K A;  2CH6 A;  3GBT A;  3MCA B;  3NMU A;  4FL9 A;  2P9I B;  3K9J A;  3I55 N;  3CPE A;  3P39 A;  5F1X A;  3GL1 A;  2P9L B;  1R59 O;  3WEE A;  1C0G A;  4ILJ A;  4OPA A;  3C6A A;  4BRC A;  5BN9 A;  4BRK A;  3W0L A;  4M63 C;  4AM6 A;  5AZJ A;  3VGK A;  4I6M A;  5AFU H;  2P9P B;  4FWS A;  1KAZ A;  5FPM A;  1QVF M;  2NZT A;  3ZEU A;  3CIP A;  1NLV A;  4BRM A;  2KKZ A;  1DEJ A;  3VPZ A;  5E26 A;  5ELZ A;  3VEZ A;  1T6C A;  3IFR A;  4JKB A;  1NGG A;  1XUP O;  1VQ5 N;  3LM2 A;  2KHO A;  3AY9 A;  5HL7 L;  3CJ1 A;  1K8K B;  1X9J A;  2E2Q A;  4JK7 A;  5BPL A;  3CET A;  3P38 A;  4B1U B;  3AAQ A;  3DLL L;  4B9Q A;  4FWP A;  4BRF A;  4FWQ A;  3UKU B;  4JKG A;  3R3L A;  4JHD A;  3ATV A;  5DM6 L;  4KH4 A;  3MX5 A;  5GAG P;  4GV3 A;  4YDU A;  3ZIE A;  1RGI A;  3NVM A;  3VTI A;  3EE9 A;  3SK3 A;  1HKG A;  4FOI A;  3WUH A;  1NGH A;  3WXI A;  3C7N A;  1KQS M;  3M3Z A;  3DXM A;  4BRN A;  4XEI A;  2P9S B;  1NGA A;  3A5M C;  4O8K A;  3WQU A;  3TTF A;  3OBW A;  3WXJ A;  5LY3 A;  3D6R A;  3MCP A;  4K25 A;  3G71 N;  3CI5 A;  1GLD G;  3CCE N;  2OTL N;  4JAX A;  1U2V A;  3A5O C;  3QFU A;  1TUY A;  4IO8 A;  3AAP A;  3CCU N;  2NRZ A;  1IG8 A;  2QXL A;  4BGB A;  1ESV A;  2YHW A;  3KK7 A;  3O4W A;  3FFK B;  3HBT A;  4BQZ A;  4OO1 J;  4FWR A;  4GV6 A;  4G9Z A;  5KPR A;  2P9U B;  3BUZ B;  2NRR A;  3DWL A;  4L3Q A;  4H5N A;  2ASM A;  1Z05 A;  5EXW A;  3MK6 A;  3U9D A;  5M1P A;  4JKC A;  4CZH A;  3N4P A;  4H5W A;  1JCU A;  3O9Q A;  3CER A;  5KQD A;  4HVZ A;  3O1B A;  4IOA L;  4NO7 A;  1KC8 O;  4E1J A;  4BRE A;  1RDU A;  1QVG M;  1VQN N;  4BR9 A;  1VQM N;  2E2P A;  5CR4 A;  4BR5 A;  1JCF A;  2QTD A;  3BP8 A;  4YOR A;  5HOO A;  1KAY A;  1NMD A;  1SS6 A;  3H45 C;  2A42 A;  1WUA A;  3LDQ A;  5EOY A;  3W3D A;  1RFQ A;  3E9L A;  4ILG B;  4C1N I;  2Q0U A;  3O9R A;  4CZK A;  4QS8 A;  4H0Y B;  2YI1 A;  5E84 A;  3VEY A;  2Q1N A;  5M1O A;  4P6P A;  3HRG A;  4BRO A;  5EY4 A;  4CI6 A;  1BDG A;  3P31 A;  3SMS A;  1QZ5 A;  3JXU A;  3FZM A;  3KHY A;  3L4I A;  3P4I A;  3WXM B;  3T69 A;  4BGA A;  4C1N K;  5GAD P;  3UB5 A;  1VQP N;  3FR0 A;  2V52 B;  4K42 A;  4CZM A;  5AQW A;  1MWK A;  1U6Z A;  1TKU A;  1YI2 N;  3SMP A;  1BUP A;  3CPW M;  5JMV A;  3ULE A;  3DXK A;  1NGJ A;  1ZXO A;  1VQ7 N;  2E20 A;  3D2F B;  4JEP A;  3ZYY X;  3CCL N;  3MWP A;  3G6E N;  3IUC A;  3LDL A;  3ZET A;  1KXP A;  3N4Q A;  2YCH A;  4IJA A;  4JKE A;  4CBU A;  5AQU A;  3QFP A;  1HJO A;  4XH1 A;  4F9O A;  3MN6 A;  1M1K O;  1NGI A;  3LDO A;  4YOY A;  1YJW N;  5AQJ A;  3VMF B;  1YIT N;  4JK8 A;  2HF4 A;  3SLC A;  3D2E B;  4DKW A;  2LN3 A;  4YOU A;  3FZH A;  1YJN N;  5KQ8 A;  3CC7 N;  1H1V A;  3CJA A;  5AQR A;  2PAV A;  3U8X A;  1YVN A;  3CHW A;  2FSK A;  2VGN A;  4IFE A;  1ATS A;  4BR7 A;  3OHR A;  4B1X B;  1QZ6 A;  3I33 A;  5B8H A;  4B1Z A;  2E8A A;  2HBK A;  2VGM A;  2NRX A;  3DAW A;  1MDU B;  2E88 A;  4WFA L;  4BVP A;  3CCJ N;  4YKE A;  4FOE A;  5AZI B;  4FCX A;  3VOV A;  4BRH A;  3UKR B;  3CCS N;  1W2B M;  1TYQ A;  1VQK N;  2D0P A;  4FPA A;  2Q31 A;  4NZR M;  4PKH A;  2YJE A;  2I7N A;  1J6Z A;  4PL8 A;  2D0O A;  2WUS A;  5AZJ B;  2QEX N;  2A6A A;  4H0V B;  4I6M B;  1ATR A;  3ID6 A;  4MDA A;  2V7Y A;  2A40 A;  3ZEU B;  3VEV A;  1JCE A;  3O08 A;  3HOS A;  1K9M O;  3Q7C A;  3VEW A;  3CC2 N;  2RHK A;  3E66 A;  1HX1 A;  3CQY A;  1YHQ N;  2ASP A;  4BG9 A;  4CBX A;  5F0X A;  2ZJR L;  1C0F A;  1T44 A;  2HOE A;  3CCR N;  4A61 A;  5C15 A;  4H0P A;  5C2D A;  4JKG B;  4JKF A;  4JHD B;  4QS9 A;  4BQL A;  1S22 A;  5FPN A;  4BRG A;  1VQO N;  2RIU A;  3H07 A;  3A8Y A;  2W40 A;  3H3N O;  2CGL A;  2CH5 A;  4UY8 O;  1ZC6 A;  3EKS A;  5JLF A;  4WQ4 A;  3BF1 A;  3C7N B;  4FBQ A;  1HUX A;  2D1K A;  3DXM B;  4JD2 A;  4XH4 A;  4YOV A;  5AQV A;  4JK9 A;  4O8U A;  1JJ2 M;  4I14 A;  4P6D A;  4FO0 A;  2YHX A;  3R6M A;  5GIP A;  1S72 N;  1EO1 A;  2MX1 A;  4KH6 A;  4BR4 A;  1YJ9 N;  2VYP A;  2KLA A;  3KWI A;  1U2V B;  4B1Y B;  5KPZ A;  3PIO L;  1SZ2 A;  3R9P A;  1P90 A;  3PIP L;  4GVE A;  3KZB A;  2Q36 A;  3OA9 A;  4HTL A;  5AR0 A;  5GAE P;  5CHI A;  3TSQ A;  2YHY A;  4E1B A;  5TKY A;  5GIO A;  3L4Q A;  3A0I X;  2NRW A;  3H6E A;  2WC9 A;  3MDQ A;  5BR9 A;  5ADX A;  5FPE A;  1GLE G;  3U4L A;  2GEL A;  3ZX2 A;  3OW2 M;  3CMA N;  4PHT X;  3SAG A;  1BWF O;  4EIA A;  4H5V A;  1E4G T;  1O13 A;  4MDB A;  3RSE A;  4JKA A;  1VQ4 N;  5EVZ A;  4JNE A;  4EFH A;  4A62 A;  3AAR A;  4BC5 A;  1SAZ A;  3IKM A;  4NLC A;  5BPM A;  2FF3 B;  4J8F A;  3QBW A;  4WF9 L;  4GV9 A;  4FFJ A;  2QW9 A;  1V4S A;  1KD1 O;  2E1Z A;  2FXU A;  4BR0 A;  3L6Q A;  3FZF A;  4IJN A;  3D7E O;  2ITM A;  5BRE A;  3AJE A;  1G58 A;  1TKS A;  1VQ9 N;  3QDK A;  4AF1 A;  4EAH D;  3JS6 A;  3O9S A;  3U9Z A;  2ZJP L;  3M6G A;  3QB0 A;  4H0T B;  4IZ9 A;  2NNW A;  2P9K A;  4U67 L;  1NJI O;  4IXC A;  2IIR A;  3E9O A;  1NWK A;  3TPQ A;  3FZL A;  5C10 A;  1Y64 A;  3IMX A;  2ZJQ L;  2EWS A;  5AQM A;  1K4I A;  3VTH A;  3CJC A;  4RTF D;  5AQX A;  5AQO A;  3LQU A;  3VEX A;  3CJB A;  2HMP A;  2QWM A;  3VET A;  2GTD A;  5AQF A;  3K9K A;  3ULE B;  3DXK B;  3SBG A;  3H3O B;  1ZBS A;  3B8A X;  2ZWH A;  2E2O A;  3ZIG A;  1E4F T;  1YIJ N;  4MLE A;  3ZET B;  4BRQ A;  3G4S N;  2I7P A;  2QWL A;  4BC2 A;  3VEO A;  2HBM A;  5LJV A;  5GAH P;  2A41 A;  4FWL A;  4HWI A;  4CZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...