3TTDA

Crystal structure of e. coli hypf with amp-cpp and carbamoyl phosphate
Total Genus 211
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
211
sequence length
647
structure length
647
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 211
structure length 647
sequence length 647
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttdA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttdA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttdA01
3VF4A 3VEOA 3VERA 3TTCA 3VTHA 3TSQA 3TTFA 3VTIA 3VESA 3TTDA 3VF2A 3VEWA 3VEZA 3TSPA 3VEXA 3VENA 3VETA 3TSUA
chains in the Genus database with same CATH superfamily
3KKRA 3VQAA 1S1WA 2M71A 2QWQA 3IABA 1D4XA 2JGUA 5KGXA 1M90O 4O0IA 1EXQA 1QQCA 1GLDG 4MLEA 2RHKA 2PBDA 1NJ6A 5FPMA 1KLNA 3J81O 1Z26A 3G4SN 4H5RA 4CGDA 3SQ0A 1GLBG 4HCCA 2GTCA 2F8TA 1QVGM 3TAQA 3A8YA 1BI4B 1CZAN 2Q2RA 4BR9A 2QKKA 2UXCK 4KRFA 3TSQA 1EWRA 4HUGA 1D5AA 1TL3A 2WTUA 1HUXA 1WUAA 4WFNL 3I33A 1T6DA 1VK0A 2ZGZA 4LF9K 4IDHA 2HNDA 1L3SA 1RBRA 3VMFB 4RW4A 3A5LC 2NRVA 4DF4A 4Z4EA 3OHRA 4ISEA 4RW6A 5F1XA 4DSKA 5DM6L 2GWKA 1NU0A 2P9NB 4WYBA 3QIPA 3HVTA 2O4IA 1H1VA 4LFAK 4CE9A 1BGXT 3HK2A 3LP2A 4CK2A 1YVUA 2UU9K 4P8EA 4CCHA 4YFUA 1L3VA 4IOCL 4DTOA 3P31A 3VQQA 3L6QA 4F2SA 1RTHA 4BDYA 4DF8A 3KVGA 5AQXA 3MDQA 3IAYA 4J2AA 1DTQA 4CI6A 4DR1K 4I6MB 1J53A 4JHDB 2G8FA 1CLQA 1YVNA 1Z05A 3MMVA 4FM2A 3WEEB 1HKBA 4FJMA 1R0AA 1DLOA 1T7PA 3QBWA 4CBWA 1NFJA 4DV5K 3VEWA 4MQ3A 1FXXA 4CZKA 3TAFA 4FZXC 4DR5K 3UKUA 3O80A 3E66A 1Q9YA 3VTHA 1VSIA 2PFUA 4DV3K 3DXMB 3EN9A 4BRAA 2O8DB 2IVNA 3ISNC 2EK0A 2PYLA 5HRPA 4RTFD 4IFYA 3T1HK 1EETA 4ELUA 3ZLJA 1QQMA 4BGBA 4CGFA 1L5UA 3QKBA 2OCEA 1YTUA 3AA2A 5FPNA 3D0PA 3DLLL 2B4JA 4CF1A 3RMCA 2QXFA 2OTLN 2GTDA 5A2QO 4FLTA 5AQWA 3NH0A 4F4KA 3IMXA 1NJ2A 3T19A 2D5RA 4BR5A 3QERA 1HLUA 1C1AA 1XEZA 1VQ8N 1HNWK 1WOQA 4YHHK 1ZBHA 3VQ7A 3DI6A 3HL8A 3T1AA 3SAGA 5AQQA 3CJ9A 4K0KK 3IRXA 3WT0A 3ZIHA 1F21A 3AY9A 3V1QA 2ZQBA 4FJLA 3HSTB 4FWMA 4B9MA 4FWKA 3CCEN 4LFBK 4O5BA 5AQVA 3MAQA 4PUOA 3QDKA 4AHTA 1BIZA 1YUWA 3RR7A 3GDQA 1K4IA 1QQOA 4H4OA 2WFBA 3QINA 3FZKA 4CIFA 5JVGL 4EAHD 3SMSA 4YOYA 3J8AA 2F9TA 1LOTB 3SUNA 4C8NA 1VAZA 4E3SA 1D8YA 1D9DA 1VQKN 3HPOA 3MEEA 4CJVA 3MEGA 2JWKA 3B6OA 3VQ9A 4JKHA 1QSLA 3I0SA 3VQPA 2HBMA 4FBWA 1Q18A 3ZEUB 1VQ9N 3ZT4A 3HSCA 2UUBK 2HMPA 3CF5L 4KHPK 3CPWM 3OBWA 3AA5X 3S9HA 4B8AB 2P9NA 3EYZA 4KH4A 3PSIA 3TI0A 4Q5VA 3DXKB 4E19A 3K0SA 1J54A 1ITGA 3K9JA 3LQUA 3C6UA 1JCEA 3WNGA 3QB0A 1RT1A 3F9KA 2VYPA 1M1KO 4WQ4C 2ZJPL 4M7XA 4P6PA 4KTWA 1BQNA 4DV6K 3VGKA 2YI1A 4LH4A 3OS1A 1JCGA 2HHWA 3NFAA 1IKYA 4JHDA 3LL3A 2O8BB 1W0HA 2ETJA 4GY2B 3OYIA 2X6NA 3RTVA 1JLFA 2VGNA 1BL3A 3WEEA 2LXRA 3LZIA 3KLGA 4B08A 4C1NK 3VGMA 1TKZA 4XIUA 4F3TA 3V6DA 3H1VX 2P9UB 1HX1A 4LSNA 3D2FB 3P04A 2A42A 4FJNA 3HP6A 3U6YA 3VF6A 1WAFA 3ALYA 1BISA 4JS5A 3RMDA 5I42A 4DFJA 3PO4A 3KWIA 3T3FA 4BRQA 3LM2A 3ID8A 2O8DA 2FXUA 2FC0A 5GAEP 3JSMA 5IWAK 3VETA 4E0DA 2HVIA 5LL6Z 2QWMA 4IO8A 3FZFA 3VPZA 3AVBA 4DQIA 4KREA 2NRXA 5GINA 2Q3VA 4HVJA 3PIPL 3EE9A 3OYNA 4LD0A 1WAJA 3WXJA 4Y1CA 4DSFA 4ILGB 2ZE2A 2A40A 4IJAA 5CZ2A 4OPAA 4FFJA 4DQRA 4Z4HA 3HP9A 1HRHA 3LZJA 4JS4A 4TSXA 1RT3A 1V4TA 4FYDA 3M1FA 2KHOA 3KK7A 1VQLN 1RQ8A 2G8WA 3RRHA 4QS8A 2A2YA 3AVCA 3WNFA 1RBVA 3H46O 1U49A 3JAMO 2QM1A 3R9PA 3VGLA 4PY5A 3DMJA 1T8EA 1HRUA 4JRQA 1NJ8A 3CMEN 1HC7A 5DK5A 2HHUA 2KLAA 4IBNA 1NBWA 1T05A 1KK9A 2I7NA 5AJ3K 4KV8A 3MEDA 2F4VK 4NXNK 1I94K 3KHYA 3CMAN 2P9LB 3FGUA 4IEIA 1EX4A 3SAHA 4DR3K 4LF6K 2E6LA 4KHYA 3LAMA 4W5TA 1RCHA 3V4IA 3R8EA 4WI1A 4O55A 1NGBA 4A57A 1NK0A 2Y1JA 3EZWA 5C2DA 3ZSZA 4FJ7A 3LP3A 4CJ7A 4YDQA 2YHWA 4P77A 1JE3A 4DV0K 3LRJA 3AAQA 3LWMA 4FM1A 5D3GA 1HNXK 1GLAG 2GEMA 1GLCG 3ZSYA 1XI1A 1HNVA 4BR7A 2A6AA 1EKEA 4ZTJA 4CEOA 2P1JA 5M1KA 4QAGA 4K8ZA 1VQON 2QWLA 5LJWA 2E5LK 3DXKA 4KKOA 3TSUA 4Z9EA 3F5TA 4K88A 4RW7A 3CCRN 1RILA 1NKEA 3Q7CA 4BC3A 1HJOA 4M41A 2GV9A 2G8VA 4EFHA 4FBQA 3CJ7A 4DR7K 4DQSA 1VR4A 3VQEA 1KXPA 1NMNA 4GMJB 1EQYA 4X62K 4U67L 3ZIEA 1GLFO 4KHNA 3PUFA 2YHXA 4YOTA 3ITHA 4FWOA 3M5RA 1TV6A 4WF9L 4OLAA 1RFQA 1V4SA 1NK6A 4A61A 4DR6K 3ZT1A 2EH1A 3VOVA 3AGKA 2P9UA 1H0XA 1KVBA 5AR0A 4BQLA 4CF2A 4NCAA 2HB5A 2W6LA 3MIOA 3TSPA 3VEVA 3J7YP 4NZTM 4ILJA 4JKCA 4FJ9A 1NJWA 3LANA 4H5TA 1YHQN 1TUYA 5BREA 3MCPA 5JS2A 1S8EA 2G8HA 1NGFA 2JWLA 1SNNA 3GE1A 2QWPA 2Q31A 3CQ8A 3A5MC 3ZT3A 2FSKA 4C8OA 3A0IX 5AQYA 2ZF5O 1NOZA 2AP1A 1SKRA 2I7PA 1OVQA 3K2PA 4BACA 1QZ6A 5C0YA 2DFEA 3E1YA 1NK9A 3P39A 2QA4N 3NH1A 3NHGA 4CBUA 3BF3A 4OLFA 4BREA 4I9QA 2BUPA 3G25A 4FVMA 3CFOA 3EEQA 5EY4A 4AF1A 4CHZA 3HO1A 1VQ5N 3DM2A 1NM1A 3KWGA 3J7ZO 3V9WA 3D2EB 5AQSA 1VSJA 4C1NI 3ZIGA 4DV7K 3LDPA 3SI6A 1VSFA 3DLBA 2UXBK 1Y64A 4K25A 4FJXA 2IC3A 1QSYA 4E1NA 2E8AA 3KLEA 3I8DA 4OO1J 1E4FT 4YOVA 2IDOA 2P9LA 2Q0RA 5BRFA 5LMUK 1JLBA 3L2RA 1XHZA 5CR4A 3KK1A 3VQBA 4M63C 3P5JA 5FDLA 5BRHA 5F2RA 2AA4A 4JKDA 1ASVA 2A41A 2IFEA 3CG7A 4FK0A 2VCPA 4NZRM 3ENOA 4H0VB 4M3RA 3FZMA 4JKAA 3I8BA 4CEAA 4K41A 3LS6A 3HTVA 4DFKA 1HNIA 4KH6A 4K42A 2XRIA 2GBZA 4BVPA 2IGIA 1VQ6N 1BDGA 3BDPA 3LDNA 2ITMA 3CXCM 3ZETB 1U6ZA 4DSJA 1TAQA 3ZX3A 4PKGA 3MN7A 3ZSWA 4EP5A 4QOZB 2XY7A 2Q1NA 3U8XA 2FBTA 3CCQN 1H4SA 1UDVA 4JI4K 2H9UA 3WQTA 4DCHA 4KO0A 2G8KA 3ZSXA 2Z1IA 1Z25A 1XHXA 3O1BA 3K57A 4ID5A 1LN4A 3ZSRA 3H08A 1YJ9N 2PYJA 5M1OA 4FLUA 4A62A 3P1GA 4KH5A 5AQHA 2QWNA 4B1UB 4IOAL 1TK5A 3NBPA 1A5XA 2XO7A 4M42A 4KHQA 4M3XA 3QFPA 3HXMA 4BRDA 3BF1A 4BRPA 4CF0A 4E1BA 3L4QA 4KHUA 1KFDA 4CIEA 2OPSA 3HPHA 4BRKA 2IS3A 3OYMA 5AQKA 4CGIA 3U9ZA 3GG4A 3V1RA 5BRDA 3EKSA 1RTDA 4CHYA 3THVA 3L0QA 1ZYQA 4B9SA 4H5WA 2E20A 1W2BM 2UXDK 4CK1A 3SJHA 1JDQA 4CJTA 4NCXA 3NGZA 1XMOK 4CEDA 2YCHA 3OYBA 3QNOA 1K4OA 5B8HA 5M1QA 3FLCO 2OPPA 4BR4A 3TABA 4JYAK 2X78A 1VM0A 4JKFA 1BHLA 1QHTA 1WSHA 3O9SA 3SNNA 3EZ5A 3D2EA 3P4IA 4B1VA 1JL2A 3AA3A 1VHXA 1C0TA 4H03B 4RW8A 1YJNN 4FSVA 2OPQA 4BWJA 3NGIA 3SV4A 4HVZA 4J2BA 3KTQA 4N5SA 2YNHA 1NWKA 4O44A 3THXB 1Q86O 4F3OA 1ZBUA 1DTTA 1KVCA 4PKHA 1TKUA 1NJZA 4IG3A 4CD3A 5SZTA 3TPQA 4WQ4A 4H0TB 4R5PA 2P9SB 4E7IA 4DU3A 3VQ5A 1XWLA 3MN5A 3TAMA 1VSEA 3OYAA 2D0OA 4DMNA 4BRLA 2CGLA 1JXBA 4LF4K 4F8RA 1JO0A 3JYTA 1FW6A 2RISA 1KAZA 4CECA 3AA4A 4HTLA 1REVA 3O08A 4CZLA 4K8XA 2VQEK 1BA0A 1JCFA 3LP0A 3ZETA 3O3FA 1TKDA 3AJEA 2BKYX 4AM6A 3VA0A 5JMVA 1HJRA 4JAXA 1ASWA 1WSJA 4EHUA 1K7JA 2CGKA 1C0FA 3C95A 3S3OA 4EZ6A 1XNRK 3M8PA 1HPMA 4CEZA 3C6AA 3QEWA 1BIUA 4FZYA 3O3HA 1RDAA 2P9BA 2X6SA 3U9DA 4FPAA 3J7AP 4XH1A 3ASMA 5EX5A 2EWSA 4BC4A 4ZTFA 4KHSA 1MWMA 1NGDA 1WN7A 3PX4A 3A2FA 4DR2K 1YAGA 1OKJA 1U04A 1NLVA 5ELZA 4DS4A 3ZYYX 3LP1A 4F2RA 4PHTX 4PWDA 4B9NA 2HHVA 3OS2A 4H0OA 1D9FA 5HROA 1K8AO 3TR8A 4OPKA 2VGMA 4EP4A 3R3LA 4Z0UA 4P6CA 5EVZA 2O4GA 3EE8A 3SBTA 3S3NA 1U45A 4LF7K 4HUFA 1ASUA 2RF2A 5KGWA 1QE1A 1QZ5A 1HQEA 2VWKA 1JKHA 5BN8A 1VSMA 1ZC6A 3EL2A 3SLCA 4DTUA 5M1PA 2YHYA 3HRGA 1HPZA 2QXLA 4BY9C 3LDLA 1BI4A 3AVFA 4GVMA 4C23A 3ZX2A 1YXQA 5AFUH 3OYGA 1N8RO 5AQRA 1WSIA 4X65K 2WBNA 2E2PA 2Q0UA 5AFUA 1W9HA 4FVUA 1GOAA 1K6YA 4YKEA 5CE3A 4FWRA 3AVHA 4JN4A 4NO7A 3TTCA 1TKXA 3E9OA 5LY3A 3M8QA 1C6VA 3EO3A 3W0LA 5AQZA 4LFCK 1C1BA 1GLJO 3NF8A 2RIUA 4BRCA 3DLKA 1LWEA 2P5OA 1IV0A 1K4PA 1BWFO 3CJ1A 5FPEA 2IIRA 2ZJQL 3MN6A 3TTDA 1YITN 4KBOA 2CH6A 1RT7A 3QEPA 5GIOA 3PX0A 1BCMA 3SPYA 3K58A 2PAVA 1RDBA 4B3MK 1IBMK 4CEEA 1KVAA 1QHAA 1X1PA 2MX1A 4FLXA 3THXA 4I6MA 1NGJA 3O9RA 3CCJN 1BA1A 4DFMA 4EZ9A 4JI5K 1NJIO 2O8FB 1NK5A 3OYFA 3NE6A 2P9SA 1UWBA 4CJSA 2UYTA 4JI2K 1EP4A 5AQPA 1TK0A 1RGIA 3IG1A 2NRWA 4DLEA 4CZMA 4YOUA 1RT4A 1Y9XA 3J80O 3C6TA 2ZGYA 3L4IA 4CHPA 3HJFA 1TL1A 4IKFA 5HP1A 4I2QA 2Q97A 4X64K 1XC3A 4B9VA 3OTOK 3L3UA 2VG7A 3DAWA 3DXMA 1FKPA 2JLEA 2XY5A 3QFUA 2FBVA 5HL7L 5AQGA 3QNNA 2HHHK 1JXEA 4JD2B 4OKEA 1H0YA 1BO5O 3E9PA 4NB4A 4JI6K 3L2UA 3O4NA 3SK3A 3AVKA 4IOXA 4BROA 2EQAA 1E4GT 3O3GA 4B1XB 5TKYA 4IFVA 5AQFA 4CZEA 4DFPA 3VN5A 1C0UA 3QICA 4XH5A 5AQLA 2ZJRL 1KD1O 3O9QA 2W6KA 1YTAA 2YHAA 1NJXA 4FK2A 1CZ9A 1ZBFA 3QO9A 2DY4A 1SV5A 1KFSA 4FJIA 3CFPA 1G99A 3AVJA 4MO5A 2HF3A 3CCUN 3CC4N 4BRHA 5HRSA 2YNIA 1JL1A 4Z4GA 2FF6A 4DS5A 1ATRA 3ZIIA 3H3NO 1K8KB 3MECA 4FJKA 4FZZA 1TYQB 3MCAB 4YORA 4Y1DA 3QLHA 4DTJA 1N6QA 1RBUA 1EO1A 1C0GA 2Q3SA 4ISGA 3RSEB 3ZSQA 4M3ZA 3DLGA 3DOLA 1SZ2A 2DTUA 4K43A 1N33K 3UIQA 2ITGA 4FOIA 1VRUA 1Y97A 3IUCA 3PO5A 3V9XA 3SMPA 4DV1K 1X3NA 3OYCA 1O1WA 1YJWN 2CGJA 1CXUA 4CW7B 1ATNA 3THWB 4FO0A 4FPBA 2YJEA 3DLEA 3CI5A 4DB3A 2HHSA 1RNHA 1NJ1A 2A1SA 1WLJA 4F9OA 3ZEUA 4CERA 4B9QA 4B3TK 4E7KA 4A2AA 3OYEA 3DRPA 3LDSA 3IFRA 1B92A 4CHNA 3TWHA 1XMQK 1NGAA 5AQTA 3M3ZA 3C65A 2ASPA 1S9EA 1U48A 4MFBA 4FWNA 2YJFA 3VQDA 3KJVA 5J2PA 2OA8A 3MX5A 5J2NA 4GV9A 1Z6RA 4CFDA 3LWLA 4A59A 3SUQA 1OVYA 2GELA 3DJCA 1WNSA 2QTDA 4FJ8A 2E2NA 5BPNA 5KQ8A 3RMAA 2BE2A 3CJAA 4OPHA 4AHSA 4HHTA 2V52B 3O6WA 3IKMA 4HD0A 4K86A 1O13A 4UQGA 1R59O 4NCBA 3NMUA 2P9PB 2CH5A 3K5MA 1YT3A 2O8BA 3V1OA 2XHBA 3HZ7A 2F7TA 3TAPA 2O8FA 1T44A 3UE5A 1BOTO 5SWMA 3AO2A 4FW2A 3MWPA 4IXCA 4DTSA 5KTQA 1IEZA 1RDDA 3L2WA 5BR9A 3VEOA 3T7ZA 2HHTA 1LAVA 3THYB 2UUCK 1TKSA 1GOBA 1VRTA 3D2FA 2VQFK 1UA1A 5I3UA 4Z4IA 2B6AA 4ISFA 1MU2A 3ATVA 4CHQA 3H07A 3TAEA 3FZLA 3IS9A 4ZHRA 1WBDA 3P38A 4JD2A 1ZBIA 4DTMA 3VEXA 1HNZK 2ASOA 3WUHA 5CYMA 4RCHA 1K4LA 4GNIA 4LC9B 4OLBA 1CXQA 5AZIB 4OX9K 4CJRA 1LW0A 2FLOA 1T6CA 4EHTA 1SL0A 4WFBL 4YOXA 1NGGA 4DQQA 5FRNA 3E01A 2LSNA 4OKJA 3G10A 1MDUB 2A3ZA 3ENBA 4MDAA 4NLCA 4Y0WA 1KSPA 4KTZA 4IEEA 2W42A 4I2PA 4QS7A 3NAEA 2KFNA 4Q15A 2HBJA 3QMLA 3JXUA 2VWJA 2HBLA 1OH8A 4C8MA 1A5WA 1BG3A 4H0YB 3KD5E 1K8KA 4OJRA 5J1EA 3LVKB 3HOSA 5HRNA 1H4TA 4Z4FA 4AHUA 1TKTA 3AO5A 2GWJA 2YHBA 3RSEA 3M6GA 5CZ1A 4CJ3A 2WUSA 4JI3K 2P9KB 4JK7A 4BRGA 5KRTA 4DUYK 3V9ZA 1LWFA 1I39A 1UOCA 3KK2A 1IKVA 2E88A 5C24A 5FROA 3O4WA 2BGGA 3KLHA 4I14A 3OS0A 3THWA 2XY6A 3M8SA 4A5AA 4CGJA 1DEJA 3NH2A 3VESA 4CJWA 1S1UA 3TARA 3VA3A 1TUUA 1TK8A 3HM9A 3V9SA 4GV6A 2D0AA 3OYLA 3C0BA 3QEVA 4PL7A 3ATUA 4KB1A 1PAVA 1S6PA 4HUEA 1NGEA 2D0PA 3WNHA 3RMBA 3PV8A 1J5OA 1I3AA 1HQUA 1YF5L 3UB5A 4Q0BA 4XEIA 3L3VA 4RWTA 4YY3K 3PSFA 1NFHA 2BH1A 4G1QA 3V81A 4K87A 1IBLK 1WSEA 2FSJA 1Q82O 3AVAA 4DV4K 1VQPN 4CEQA 3K5OA 1IKXA 3OYDA 3MK6A 3VQCA 4WQ5C 3KKSA 1IG8A 4P8JA 1HKGA 5GAGP 1X3MA 3A5OC 4UY8O 2P9PA 3FR0A 3BEXA 4B9UA 3OY9A 2YNFA 3CERA 4LH5A 4FLYA 3F9MA 2Y1BA 5AQIA 4E7HA 3C94A 1QTMA 1S22A 1MA9B 3HBTA 3H6EA 3L7VA 2RPIA 1JLAA 2KQ2A 4H0XB 2I5JA 4FJ5A 4JKBA 4PL8A 3OYJA 1KQSM 3VEZA 3THYA 2D0CA 3DSDA 3MWTA 4GVEA 4CZGA 4CEBA 2X74A 1IBKK 3DOKA 3ZX0A 4DLGA 2H3GX 2HBKA 5EOYA 4FLZA 3KD1E 2LN3A 3TOEA 1MWKA 2YV0X 3AARA 5FPDA 3D45A 4FOEA 4E89A 1T03A 1W7AA 5C12A 3T69A 4W5QA 3T1YK 1S9GA 4JLHA 5AZIA 3MX2A 2ASMA 5LMNK 4BRIA 1OH7A 2D4WA 3ZSOA 4CGGA 1OH5A 2P51A 5E26A 3KZBA 4BVOA 4X66K 3HT3A 4BE1A 4BC2A 1NKBA 4CJUA 3N4QA 4H5NA 1PVYA 3I56N 1N32K 1E3MA 1KLMA 4IWVA 4TWAA 4IJNA 2E2QA 1BQMA 3NVMA 1RDCA 4CJFA 1S72N 5AZJB 5FRMA 5F0XA 1NGCA 4J2EA 4FWSA 3DYAA 1SL1A 3UKRB 4ELTA 4JK8A 2NZTA 2NRZA 3ENHA 1ZXOA 4CJ5A 4C8KA 2OTJN 4DQ8A 5DMRA 1KAYA 4YNQA 3CJBA 4LF8K 1EWQA 4WFAL 4CJLA 4KAZA 4NXMK 1IKWA 4GKKK 4JI0K 3O9TA 3SJJA 4JRPA 3LPUA 4NLBA 2HNZA 4BDZA 3A5NC 2P9KA 2PZSA 4JNEA 4AHRA 1SQKA 1H4QA 2E6MA 3QEIA 4B1WB 3G0ZA 3K5LA 4FWLA 5GADP 3CQYA 3LVJC 1KRPA 4EIAA 3RRGA 2XY8A 3BP8A 3WXKA 3PIOL 3K59A 4DTPA 4BWMA 3SUPA 3AVGA 1X9MA 5E41A 3BY5A 3ZCMA 3CCLN 4JKEA 3MN9A 4JKGB 4CHOA 1KC8O 4QCLA 4MLHA 1NGHA 3NF6A 4O8UA 1YI2N 4FLVA 3CCVN 4FK4A 4U7BA 5TKWA 3AO4A 4O5FA 4W5NA 4BE0A 3HVRA 2HMIA 4EO0A 4BR2A 3O9UA 3SBGA 5AQUA 4B1ZA 1YIJN 1JLCA 3OVNA 3OW2M 2YX6A 3GL1A 1NOYA 4IZ9A 3T1IA 3JS6A 4BR0A 3AGRA 4DU1A 3PX6A 3VERA 2BTFA 2QKBA 4J2DA 2O8EB 2BANA 2HOEA 1HYSA 1ATSA 1NMDA 5MLCQ 3KLFA 4B3RK 3U4LA 3CC7N 4OGEA 3ULDA 1XC9A 3OJSA 3MK5A 3VQ6A 1U47A 5JLFA 4M3YA 3DWLA 4B3SK 3CETA 5JICA 4O0JA 3SQ1A 3HZ6A 2KFZA 4BC5A 3AVLA 2FSNA 2G8UA 3AVIA 4DWIA 3LDOA 4NYNA 5KPRA 1QQNA 4YDUC 3MXJA 2OYQA 5EXWA 4IDKA 4N56A 4OVLA 3HPGA 5BPLA 2F9WA 4CBXA 2EX3A 5BN9A 4CJ4A 4BG9A 5BR8K 5DM7L 5HRRA 1RBSA 2P9IB 3S3MA 2IVOA 1VSHA 4QS9A 2NUBA 1ZBLA 3DSCA 2HW3A 1TIGA 4GW6A 3GOIA 1LCUA 1DCJA 4MO4A 4FXDA 1G57A 1XQSC 5C42A 4DSIA 2L8YA 2ZM6K 4LSLA 1NK7A 4B9TA 3C7NB 4CJKA 1J5EK 5KPZA 3NF9A 3O4QA 3L8BA 3ULEB 2KW4A 4DR4K 3CYMA 5AZJA 4M45A 1UAXA 4HVCA 1L3TA 4DU4A 3UKRA 4CFCA 2QWRA 2Z1JA 3VEYA 4HCBA 3K5NA 4CIGA 4BE2A 5FLXO 1N36K 3DLRA 4DUZK 1CZBA 5C15A 3MXIA 1FK9A 4HTUA 3HOTA 1NNEA 3H3OB 4IFEA 3NCIA 3ID6A 3WXIA 3NF7A 5GAHP 4KPYA 2NLXA 3BZKA 2O8CB 3QBXA 4DQPA 2GUPA 1HYVA 3CHWA 1LW2A 2DFHA 3FFIA 3WNEA 1HMVA 4DSLA 4O8KA 1B9FA 1JCUA 2QEXN 1X9SA 3KK3A 4FM0A 3ZT0A 4CFAA 1Q81O 3FE1A 4P6DA 1WSGA 4DTNA 3ZT2A 3RVCA 1VSKA 4RG8A 1JLEA 4FJHA 3TTFA 1NJ5A 1S1XA 2NRRA 4A5BA 1QSSA 3HI0A 4AH9A 2ZWHA 5HLFA 4CF8A 4HWIA 2VWBA 4JKGA 2RKIA 4AM7A 2FBXA 4H0PA 1UA0A 3DRSA 3QESA 1LAWA 1JLGA 5CY4A 5AQOA 3U6FA 2DPNA 1SAZA 1VQ4N 4KHWA 2Z1GA 3OYKA 4AHCA 1N5YA 3CC2N 1RTJA 3OJUA 4C8LA 1QVFM 1XNQK 1ESVA 1P8ZA 1XUPO 4KI4A 1GLLO 2R7YA 5KRSA 5J2MA 4NYFA 2QI2A 3C6HA 1RT2A 4LY7A 1RTIA 2O8EA 4N41A 3NVKA 1NKCA 2E1YA 3CD6N 1DT9A 3D6RA 4JEPA 1K73O 4DTRA 3F73A 5J2QA 5I9EB 1RDUA 3VQ4A 3NGYA 3ZSVA 4DSEA 1J6ZA 4J8FA 2W41A 4DTXA 3AV9A 1J9AA 5KI6A 3VTIA 3H1QA 3BZCA 2WC9A 3QIOA 3R6MA 2QK9A 1IO2A 1G58A 2P5GA 3TU5A 4I7FA 1SL2A 3IDHA 5JS1A 4CJQA 2CRQA 3D7EO 3OA9A 3AAPA 2V7ZA 1L3UA 4KTQA 5BPMA 3V9UA 4ELVA 1S6QA 2GUIA 1FJGK 1TAUA 5CHIA 3SPZA 3S41A 4B3OA 1IH7A 1N34K 1QS4A 4FWPA 4OPJA 5EU7A 2J4RA 4FCXA 1X9JA 2P9IA 3CCSN 3FZHA 1B9DA 1C0MA 5H1SQ 2QW9A 4NCGA 3SYZA 3CCMN 1VQ7N 1U2VB 3R1XA 5GIPA 1X9WA 1S5JA 3KLIA 2IVPA 1A5VA 4CZHA 1VSDA 3AVNA 3SZ2A 3B8AX 3TANA 4PA1A 4KFBA 2E4LA 4CJEA 1Q7YO 3C7NA 5K14A 4JI8K 4FJJA 4AHVA 4CZFA 3ULEA 3CFRA 1VSLA 4M3TA 3LALA 1BUPA 2HVHA 4LF5K 3HM8A 1RT6A 3MXMA 4M3UA 5ADXH 4BRFA 4BDPA 4JV5K 1Q9XA 1Q8IA 4CGHA 4OKKA 5ADXA 1JJ2M 4I9LA 4ICLA 3E9LA 3LM9A 5LJVA 3PY8A 1NK8A 1P90A 1T3VA 2O8CA 4FL9A 2KTQA 3VF4A 3U3YA 4WE1A 3WBMA 2Z1HA 4Z94A 2YKMA 1WBBA 1K49A 3Q7BA 4KI6A 4FW1A 1LWCA 4OGCA 4CZIA 1ZBSA 5AQNA 4H5VA 1WSFA 1W97L 2F96A 3FFKB 4B9LA 1SKWA 2D1KA 1HR0K 1JLQA 4FBKA 2HHQA 4WQ5A 2WOMA 3N4PA 4CESA 1S1VA 1SUQA 3M8RA 2KZMA 4E7JA 4JK9A 4CF9A 1DGKN 2E1ZA 4FCYA 3H45C 3VF2A 2IAJA 1KAXA 3DRRA 1S1TA 2Z7CA 3L2VA 2D0BA 1NG9A 4BGAA 2ZD1A 3G71N 1SS6A 3WXLA 3CM5A 4DKWA 3SQ4A 1DKGD 1IG9A 5HBMA 5M1NA 5KQDA 3I0RA 3G6EN 3QETA 5JVHL 3W3DA 3MGZA 4R79A 3P83D 2EHGA 3BUZB 4B8CA 4CJPA 4AQYK 4CFBA 4JI1K 1SKSA 4PKIA 4CK3A 3NDKA 1PVWA 3SAFA 3K9KA 2GX9A 1RBTA 4H8KA 5E84A 3O1WA 2YKNA 4GV3A 3IABB 3WXMB 5JLHA 3CIPA 4DHYA 3I55N 2VG5A 3DLHA 5AQJA 1BCOA 2AJQA 2G8IA 4KB0A 1GLEG 3F2KA 3EKUA 4W5RA 4O4GA 2UUAK 4L3QA 4Z4CA 4BRMA 4RW9A 1TVRA 1GOCA 1U4BA 2YNGA 4BRNA 3CJCA 2FBYA 2E2OA 2B5JA 1TYQA 4ID1A 4A2BA 1WB9A 4FWQA 1VQNN 3TAGA 3OYHA 3LAKA 1RT5A 1G15A 3BGRA 4PQUA 1Y2IA 1U2VA 4E1JA 1KCFA 3AO1A 3U3GA 4L8RB 2Q36A 4CD1A 3O5BA 1OH6A 4M3WA 4G9ZA 4E7LA 2NNWA 5CYQA 3SUOA 4BQZA 4CEFA 3EY1A 3HYFA 1KTQA 2HF4A 3SQ2A 4DV2K 1S3XA 5M1FA 3VENA 2BDPA 2IOCA 2OZMA 4FJGA 2RN2A 3KIOA 2KZZA 4CZJA 2OZSA 4N76A 4IO9L 4GKJK 1NH9A 2HSTA 2V7YA 4M7YA 4WCEL 2QWOA 3LPTA 4MDBA 4E1MA 2F8SA 2NRTA 3SCXA 1FKOA 2OANA 3CPEA 4V19S 2WONA 4W5OA 1II7A 1HYZA 5C2FA 1ILYA 3UKUB 4FLWA 3O8MA 5T7BA 3IALA 4N47A 1VQMN 3LDQA 2FF3B 4AILC 4JI7K 5C25A 5IT9O 1NGIA 3QEXA 3SV3A 3L2QA 2HNYA 2A5XA 3CM6A 2ATQA 5C10A 3OBYA 1K9MO 5KPTA 3RWUA 3AO3A 1TGOA 2Y1IA 4YOWA 3PLAA 4DG1A 4XH4A 2RE2A 2KKZA 2OPRA 2DFFA 4CVNE 2W40A 1NK4A 1NJYA 5HOOA 3AVMA 1LV5A 1C1CA 1BU6O 1HKCA 4IG0A 1IJJA 3GBTA 2V51B 3CQXA 4BG8A 2PY5A 2A1RA 3RR8A 4ILHA 4B1YB 1RDWX 4YDUA 3VQ8A 2NRHA 5AQMA 2HHXA 2VG6A 3B6PA 3WQUA 4H4MA
chains in the Genus database with same CATH topology
5BPLA 2QWPA 2F9WA 4CBXA 2Q31A 5BN9A 1G99A 2QWQA 4MO5A 1D4XA 3A5MC 2HF3A 4BG9A 5DM7L 3CCUN 2FSKA 4BRHA 3A0IX 2P9IB 3CC4N 5AQYA 1M90O 2IVOA 2ZF5O 4QS9A 2AP1A 2FF6A 3GOIA 1GLDG 1LCUA 4MLEA 2RHKA 1ATRA 2I7PA 2PBDA 3ZIIA 3H3NO 4MO4A 1G57A 1K8KB 5FPMA 1QZ6A 1XQSC 5C0YA 1TYQB 3MCAB 3G4SN 4YORA 3E1YA 4H5RA 3P39A 2QA4N 1GLBG 4CBUA 3BF3A 1EO1A 1C0GA 4ISGA 3RSEB 4BREA 1QVGM 3A8YA 2BUPA 1SZ2A 1CZAN 2Q2RA 3C7NB 3G25A 4K43A 4BR9A 3TSQA 5KPZA 4FOIA 5EY4A 3ULEB 4AF1A 1HUXA 1WUAA 5AZJA 4WFNL 3I33A 1NM1A 1T6DA 3KWGA 1VQ5N 2ZGZA 3J7ZO 3IUCA 3D2EB 4IDHA 5AQSA 3UKRA 4C1NI 3ZIGA 3LDPA 3SMPA 2QWRA 1X3NA 3VMFB 3A5LC 3VEYA 2NRVA 1YJWN 2CGJA 1Y64A 3OHRA 1ATNA 4ISEA 4K25A 5F1XA 5DM6L 4FO0A 4FPBA 2E8AA 2GWKA 2YJEA 2P9NB 3CI5A 4WYBA 4DB3A 5C15A 4OO1J 1E4FT 3HOTA 3H3OB 4IFEA 3ID6A 4F9OA 3ZEUA 2P9LA 3WXIA 4B9QA 5GAHP 4YOVA 4A2AA 2NLXA 2Q0RA 3IFRA 3QBXA 5BRFA 1H1VA 2GUPA 5CR4A 1NGAA 4M63C 4P8EA 3CHWA 5AQTA 5BRHA 3M3ZA 3C65A 5F2RA 2AA4A 2ASPA 4JKDA 4O8KA 4IOCL 4FWNA 2YJFA 2A41A 1JCUA 2QEXN 3P31A 3L6QA 1Q81O 2VCPA 3FE1A 4NZRM 3ENOA 3MX5A 4H0VB 4GV9A 4P6DA 1Z6RA 3KVGA 5AQXA 3RVCA 4A59A 3FZMA 3MDQA 3I8BA 4JKAA 1OVYA 2GELA 3DJCA 3HTVA 4K41A 4CI6A 2QTDA 3TTFA 4I6MB 3LS6A 2E2NA 4JHDB 4K42A 4KH6A 5BPNA 4BVPA 5KQ8A 4A5BA 2NRRA 1YVNA 3HI0A 1VQ6N 1BDGA 1Z05A 3CJAA 3MMVA 2ZWHA 4OPHA 3LDNA 2ITMA 2V52B 3CXCM 4HWIA 1HKBA 2VWBA 3IKMA 3O6WA 3WEEB 3QBWA 4JKGA 1U6ZA 3ZETB 4CBWA 1O13A 4AM7A 1R59O 4H0PA 3VEWA 3ZX3A 4PKGA 5AQOA 3MN7A 2P9PB 3NMUA 2CH5A 4CZKA 2DPNA 1SAZA 1VQ4N 2Q1NA 2F7TA 3U8XA 1T44A 3UE5A 3CC2N 1BOTO 3CCQN 3UKUA 3O80A 3E66A 1QVFM 3MWPA 3VTHA 4IXCA 1ESVA 1P8ZA 1XUPO 2PFUA 1IEZA 1GLLO 3DXMB 2QI2A 3C6HA 3EN9A 4BRAA 3VEOA 3WQTA 5BR9A 4DCHA 2IVNA 3T7ZA 4RTFD 3NVKA 2E1YA 3O1BA 1TKSA 3D2FA 3CD6N 1DT9A 3D6RA 4JEPA 1K73O 1QQMA 4BGBA 1YJ9N 4ISFA 5I9EB 5M1OA 3ATVA 5FPNA 1RDUA 3DLLL 4A62A 3H07A 4KH5A 2OTLN 1J6ZA 2GTDA 4J8FA 5AQWA 3FZLA 2W41A 3P38A 4JD2A 3VTIA 3H1QA 2QWNA 5AQHA 3VEXA 2ASOA 3IMXA 2WC9A 3R6MA 3WUHA 4B1UB 4IOAL 4RCHA 1K4LA 4GNIA 4LC9B 1G58A 3TU5A 5AZIB 4BR5A 1HLUA 3IDHA 1XEZA 1VQ8N 3D7EO 1WOQA 3AAPA 2V7ZA 2FLOA 3OA9A 5BPMA 1T6CA 4EHTA 4WFBL 3QFPA 4YOXA 1NGGA 4BRDA 5AQQA 3BF1A 3SAGA 5CHIA 3CJ9A 4BRPA 4E1BA 3L4QA 3WT0A 3ZIHA 3S41A 1MDUB 2A3ZA 3AY9A 3ENBA 4MDAA 4NLCA 4Y0WA 4BRKA 4IEEA 5AQKA 4FWPA 4QS7A 3U9ZA 3GG4A 4FWMA 2J4RA 2HBJA 3QMLA 4FWKA 3JXUA 5BRDA 4FCXA 3EKSA 1X9JA 3CCEN 2P9IA 3CCSN 3FZHA 5AQVA 2HBLA 3L0QA 3QDKA 5H1SQ 1BG3A 2QW9A 1YUWA 3CCMN 1VQ7N 1U2VB 3GDQA 3R1XA 4H5WA 2E20A 5GIPA 4H0YB 1K4IA 1K8KA 1QQOA 1W2BM 2WFBA 3HOSA 2IVPA 4CZHA 3FZKA 3SJHA 5JVGL 4EAHD 3SMSA 4YOYA 3J8AA 2F9TA 2YCHA 3B8AX 1LOTB 1K4OA 1VAZA 2GWJA 3RSEA 5B8HA 3M6GA 3FLCO 5M1QA 4BR4A 1Q7YO 2WUSA 3C7NA 4JKFA 1VQKN 2P9KB 4JK7A 4BRGA 2JWKA 4CZFA 3ULEA 3O9SA 4JKHA 1BUPA 3D2EA 3P4IA 3HM8A 4B1VA 2HBMA 4FBWA 1Q18A 3ZEUB 2E88A 4H03B 5ADXH 1YJNN 1VQ9N 4BRFA 3O4WA 3HSCA 4FSVA 4I14A 2HMPA 3CF5L 5ADXA 1JJ2M 3CPWM 3OBWA 3E9LA 4A5AA 2P9NA 4HVZA 5LJVA 1DEJA 4KH4A 1NWKA 3DXKB 3VESA 1Q86O 1P90A 1T3VA 4PKHA 1TUUA 4FL9A 1TKUA 3K9JA 3VF4A 4CD3A 4GV6A 3LQUA 4Z94A 3TPQA 1JCEA 4WQ4A 4H0TB 3C0BA 2P9SB 4PL7A 3QB0A 3ATUA 1M1KO 2VYPA 3MN5A 4WQ4C 1K49A 2ZJPL 3Q7BA 1NGEA 2D0PA 4M7XA 4P6PA 4CZIA 2D0OA 4BRLA 1YF5L 1ZBSA 5AQNA 2CGLA 3VGKA 2YI1A 4H5VA 3UB5A 1JCGA 4XEIA 1W97L 4RWTA 3FFKB 2BH1A 4JHDA 3LL3A 2RISA 2D1KA 1KAZA 4FBKA 4GY2B 2FSJA 4WQ5A 1Q82O 1VQPN 2VGNA 3N4PA 3O08A 4HTLA 4CZLA 3WEEA 1BA0A 1JCFA 3MK6A 4WQ5C 4JK9A 1IG8A 1DGKN 2E1ZA 3ZETA 1HKGA 3H45C 3VF2A 4C1NK 1X3MA 3A5OC 5GAGP 3AJEA 3VGMA 4AM6A 1KAXA 4UY8O 5JMVA 2P9PA 4JAXA 3FR0A 3H1VX 2P9UB 1HX1A 3BEXA 4EHUA 4BGAA 2CGKA 1K7JA 1C0FA 3CERA 3G71N 3D2FB 3P04A 1SS6A 2A42A 3WXLA 3F9MA 4DKWA 5AQIA 1DKGD 1S22A 1HPMA 1MA9B 5M1NA 3HBTA 3H6EA 3C6AA 3VF6A 5KQDA 3L7VA 3G6EN 4H0XB 5JVHL 3KWIA 3W3DA 4BRQA 3LM2A 3ID8A 3MGZA 2P9BA 4JKBA 4R79A 3U9DA 4FPAA 2FXUA 3BUZB 4PL8A 1KQSM 4XH1A 3VEZA 5GAEP 5EX5A 3VETA 2QWMA 4IO8A 3VPZA 3FZFA 2EWSA 4GVEA 3MWTA 4BC4A 2NRXA 4PKIA 4CZGA 1MWMA 1NGDA 5GINA 3PIPL 3EE9A 1YAGA 1OKJA 3WXJA 1PVWA 3SAFA 3K9KA 1NLVA 4ILGB 3ZX0A 2GX9A 2A40A 4IJAA 5E84A 3O1WA 2H3GX 4OPAA 2HBKA 5EOYA 4GV3A 4FFJA 5ELZA 3ZYYX 2LN3A 1MWKA 3WXMB 4PHTX 5JLHA 3AARA 4H0OA 5FPDA 3CIPA 4DHYA 3I55N 4FOEA 5AQJA 1K8AO 5C12A 3T69A 1V4TA 2VGMA 1GLEG 3F2KA 3M1FA 3R3LA 2KHOA 3EKUA 3KK7A 1VQLN 5AZIA 3MX2A 4P6CA 2ASMA 5EVZA 4BRIA 3EE8A 4L3QA 4QS8A 3SBTA 4BRMA 2D4WA 3H46O 1QZ5A 4BVOA 5E26A 2QM1A 3KZBA 4BRNA 3CJCA 3R9PA 4BC2A 3VGLA 3N4QA 2E2OA 4H5NA 1PVYA 3I56N 4IWVA 5BN8A 4IJNA 2E2QA 3NVMA 1TYQA 1ZC6A 1S72N 5AZJB 4A2BA 3EL2A 5F0XA 1NGCA 1HRUA 3SLCA 4FWQA 4FWSA 3CMEN 5M1PA 3UKRB 2YHYA 3HRGA 1VQNN 2KLAA 2QXLA 4JK8A 1NBWA 2NZTA 4BY9C 1KK9A 3LDLA 2NRZA 3ENHA 1ZXOA 4C23A 3ZX2A 2I7NA 1YXQA 2OTJN 4DQ8A 5AFUH 1U2VA 4E1JA 1N8RO 5AQRA 1KAYA 2Q36A 4CD1A 2WBNA 3O5BA 3CJBA 2E2PA 2Q0UA 3KHYA 5AFUA 4WFAL 2P9LB 3CMAN 3FGUA 4IEIA 4FVUA 3SAHA 4G9ZA 2NNWA 4YKEA 3O9TA 5CE3A 4FWRA 4NO7A 4JN4A 3TTCA 3E9OA 5LY3A 4BQZA 4NLBA 3R8EA 3EO3A 1NGBA 3W0LA 3A5NC 4A57A 2HF4A 1VQMN 2P9KA 3EZWA 5AQZA 5C2DA 1GLJO 4JNEA 1S3XA 1SQKA 2RIUA 4B1WB 4BRCA 5M1FA 4FWLA 3VENA 4CJ7A 3CQYA 5GADP 2YHWA 4P77A 4EIAA 1K4PA 1BWFO 3CJ1A 3LRJA 5FPEA 2IIRA 2ZJQL 3AAQA 3MN6A 1GLAG 3TTDA 1GLCG 2GEMA 3BP8A 3WXKA 1YITN 4KBOA 2CH6A 3PIOL 5GIOA 4BR7A 4CZJA 3CCLN 2A6AA 4IO9L 2HSTA 2PAVA 4JKEA 3MN9A 5M1KA 4JKGB 2V7YA 4M7YA 4MLHA 4WCEL 2QWOA 1KC8O 1NGHA 1QHAA 2QWLA 4MDBA 4O8UA 1YI2N 1VQON 5LJWA 3CCVN 2MX1A 2NRTA 3DXKA 4U7BA 4I6MA 3TSUA 1NGJA 2OANA 3CPEA 3F5TA 3O9RA 5TKWA 3CCJN 1BA1A 4O5FA 3CCRN 1NJIO 3Q7CA 4BC3A 1HJOA 5C2FA 1ILYA 2P9SA 3UKUB 3O8MA 4EO0A 4BR2A 3O9UA 3SBGA 5AQUA 2UYTA 4B1ZA 4EFHA 1YIJN 3OW2M 5AQPA 4FBQA 1RGIA 2YX6A 3GL1A 4IZ9A 3T1IA 3CJ7A 3JS6A 2FF3B 2NRWA 3AGRA 3LDQA 3VERA 4BR0A 4YOUA 4CZMA 1NGIA 2BTFA 1KXPA 2ZGYA 1EQYA 2A5XA 2HOEA 4U67L 3ZIEA 3L4IA 5C10A 1GLFO 3OBYA 1K9MO 2YHXA 4YOTA 1ATSA 5KPTA 4FWOA 1NMDA 3M5RA 4WF9L 2Q97A 4YOWA 1XC3A 3PLAA 4P8JA 1RFQA 4XH4A 1V4SA 2RE2A 2KKZA 3DAWA 3U4LA 3DXMA 5MLCQ 3CC7N 4A61A 2W40A 3QFUA 3MK5A 5HL7L 5AQGA 5HOOA 4JD2B 5JLFA 3VOVA 3AGKA 2P9UA 1BO5O 1BU6O 1HKCA 3E9PA 4NB4A 3SK3A 4BROA 4IOXA 2EQAA 3DWLA 5AR0A 1IJJA 3GBTA 1E4GT 4B1XB 3CETA 5JICA 4BQLA 2V51B 3HZ6A 3CQXA 5AQFA 5TKYA 4BC5A 4CZEA 3TSPA 4BG8A 3VEVA 3MIOA 4NZTM 4ILJA 4JKCA 2FSNA 4ILHA 4B1YB 1RDWX 3QICA 4H5TA 3LDOA 1YHQN 4YDUA 4XH5A 1TUYA 5AQLA 5BREA 2ZJRL 1KD1O 3O9QA 5KPRA 3MCPA 1QQNA 2NRHA 4YDUC 5AQMA 5EXWA 1NGFA 2JWLA 3WQUA 3LM9A 1SNNA 3GE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VF4 A;  3VEO A;  3VER A;  3TTC A;  3VTH A;  3TSQ A;  3TTF A;  3VTI A;  3VES A;  3TTD A;  3VF2 A;  3VEW A;  3VEZ A;  3TSP A;  3VEX A;  3VEN A;  3VET A;  3TSU A; 
#chains in the Genus database with same CATH topology
 3KKR A;  3VQA A;  1S1W A;  2M71 A;  2QWQ A;  3IAB A;  1D4X A;  2JGU A;  5KGX A;  1M90 O;  4O0I A;  1EXQ A;  1QQC A;  1GLD G;  4MLE A;  2RHK A;  2PBD A;  1NJ6 A;  5FPM A;  1KLN A;  3J81 O;  1Z26 A;  3G4S N;  4H5R A;  4CGD A;  3SQ0 A;  1GLB G;  4HCC A;  2GTC A;  2F8T A;  1QVG M;  3TAQ A;  3A8Y A;  1BI4 B;  1CZA N;  2Q2R A;  4BR9 A;  2QKK A;  2UXC K;  4KRF A;  3TSQ A;  1EWR A;  4HUG A;  1D5A A;  1TL3 A;  2WTU A;  1HUX A;  1WUA A;  4WFN L;  3I33 A;  1T6D A;  1VK0 A;  2ZGZ A;  4LF9 K;  4IDH A;  2HND A;  1L3S A;  1RBR A;  3VMF B;  4RW4 A;  3A5L C;  2NRV A;  4DF4 A;  4Z4E A;  3OHR A;  4ISE A;  4RW6 A;  5F1X A;  4DSK A;  5DM6 L;  2GWK A;  1NU0 A;  2P9N B;  4WYB A;  3QIP A;  3HVT A;  2O4I A;  1H1V A;  4LFA K;  4CE9 A;  1BGX T;  3HK2 A;  3LP2 A;  4CK2 A;  1YVU A;  2UU9 K;  4P8E A;  4CCH A;  4YFU A;  1L3V A;  4IOC L;  4DTO A;  3P31 A;  3VQQ A;  3L6Q A;  4F2S A;  1RTH A;  4BDY A;  4DF8 A;  3KVG A;  5AQX A;  3MDQ A;  3IAY A;  4J2A A;  1DTQ A;  4CI6 A;  4DR1 K;  4I6M B;  1J53 A;  4JHD B;  2G8F A;  1CLQ A;  1YVN A;  1Z05 A;  3MMV A;  4FM2 A;  3WEE B;  1HKB A;  4FJM A;  1R0A A;  1DLO A;  1T7P A;  3QBW A;  4CBW A;  1NFJ A;  4DV5 K;  3VEW A;  4MQ3 A;  1FXX A;  4CZK A;  3TAF A;  4FZX C;  4DR5 K;  3UKU A;  3O80 A;  3E66 A;  1Q9Y A;  3VTH A;  1VSI A;  2PFU A;  4DV3 K;  3DXM B;  3EN9 A;  4BRA A;  2O8D B;  2IVN A;  3ISN C;  2EK0 A;  2PYL A;  5HRP A;  4RTF D;  4IFY A;  3T1H K;  1EET A;  4ELU A;  3ZLJ A;  1QQM A;  4BGB A;  4CGF A;  1L5U A;  3QKB A;  2OCE A;  1YTU A;  3AA2 A;  5FPN A;  3D0P A;  3DLL L;  2B4J A;  4CF1 A;  3RMC A;  2QXF A;  2OTL N;  2GTD A;  5A2Q O;  4FLT A;  5AQW A;  3NH0 A;  4F4K A;  3IMX A;  1NJ2 A;  3T19 A;  2D5R A;  4BR5 A;  3QER A;  1HLU A;  1C1A A;  1XEZ A;  1VQ8 N;  1HNW K;  1WOQ A;  4YHH K;  1ZBH A;  3VQ7 A;  3DI6 A;  3HL8 A;  3T1A A;  3SAG A;  5AQQ A;  3CJ9 A;  4K0K K;  3IRX A;  3WT0 A;  3ZIH A;  1F21 A;  3AY9 A;  3V1Q A;  2ZQB A;  4FJL A;  3HST B;  4FWM A;  4B9M A;  4FWK A;  3CCE N;  4LFB K;  4O5B A;  5AQV A;  3MAQ A;  4PUO A;  3QDK A;  4AHT A;  1BIZ A;  1YUW A;  3RR7 A;  3GDQ A;  1K4I A;  1QQO A;  4H4O A;  2WFB A;  3QIN A;  3FZK A;  4CIF A;  5JVG L;  4EAH D;  3SMS A;  4YOY A;  3J8A A;  2F9T A;  1LOT B;  3SUN A;  4C8N A;  1VAZ A;  4E3S A;  1D8Y A;  1D9D A;  1VQK N;  3HPO A;  3MEE A;  4CJV A;  3MEG A;  2JWK A;  3B6O A;  3VQ9 A;  4JKH A;  1QSL A;  3I0S A;  3VQP A;  2HBM A;  4FBW A;  1Q18 A;  3ZEU B;  1VQ9 N;  3ZT4 A;  3HSC A;  2UUB K;  2HMP A;  3CF5 L;  4KHP K;  3CPW M;  3OBW A;  3AA5 X;  3S9H A;  4B8A B;  2P9N A;  3EYZ A;  4KH4 A;  3PSI A;  3TI0 A;  4Q5V A;  3DXK B;  4E19 A;  3K0S A;  1J54 A;  1ITG A;  3K9J A;  3LQU A;  3C6U A;  1JCE A;  3WNG A;  3QB0 A;  1RT1 A;  3F9K A;  2VYP A;  1M1K O;  4WQ4 C;  2ZJP L;  4M7X A;  4P6P A;  4KTW A;  1BQN A;  4DV6 K;  3VGK A;  2YI1 A;  4LH4 A;  3OS1 A;  1JCG A;  2HHW A;  3NFA A;  1IKY A;  4JHD A;  3LL3 A;  2O8B B;  1W0H A;  2ETJ A;  4GY2 B;  3OYI A;  2X6N A;  3RTV A;  1JLF A;  2VGN A;  1BL3 A;  3WEE A;  2LXR A;  3LZI A;  3KLG A;  4B08 A;  4C1N K;  3VGM A;  1TKZ A;  4XIU A;  4F3T A;  3V6D A;  3H1V X;  2P9U B;  1HX1 A;  4LSN A;  3D2F B;  3P04 A;  2A42 A;  4FJN A;  3HP6 A;  3U6Y A;  3VF6 A;  1WAF A;  3ALY A;  1BIS A;  4JS5 A;  3RMD A;  5I42 A;  4DFJ A;  3PO4 A;  3KWI A;  3T3F A;  4BRQ A;  3LM2 A;  3ID8 A;  2O8D A;  2FXU A;  2FC0 A;  5GAE P;  3JSM A;  5IWA K;  3VET A;  4E0D A;  2HVI A;  5LL6 Z;  2QWM A;  4IO8 A;  3FZF A;  3VPZ A;  3AVB A;  4DQI A;  4KRE A;  2NRX A;  5GIN A;  2Q3V A;  4HVJ A;  3PIP L;  3EE9 A;  3OYN A;  4LD0 A;  1WAJ A;  3WXJ A;  4Y1C A;  4DSF A;  4ILG B;  2ZE2 A;  2A40 A;  4IJA A;  5CZ2 A;  4OPA A;  4FFJ A;  4DQR A;  4Z4H A;  3HP9 A;  1HRH A;  3LZJ A;  4JS4 A;  4TSX A;  1RT3 A;  1V4T A;  4FYD A;  3M1F A;  2KHO A;  3KK7 A;  1VQL N;  1RQ8 A;  2G8W A;  3RRH A;  4QS8 A;  2A2Y A;  3AVC A;  3WNF A;  1RBV A;  3H46 O;  1U49 A;  3JAM O;  2QM1 A;  3R9P A;  3VGL A;  4PY5 A;  3DMJ A;  1T8E A;  1HRU A;  4JRQ A;  1NJ8 A;  3CME N;  1HC7 A;  5DK5 A;  2HHU A;  2KLA A;  4IBN A;  1NBW A;  1T05 A;  1KK9 A;  2I7N A;  5AJ3 K;  4KV8 A;  3MED A;  2F4V K;  4NXN K;  1I94 K;  3KHY A;  3CMA N;  2P9L B;  3FGU A;  4IEI A;  1EX4 A;  3SAH A;  4DR3 K;  4LF6 K;  2E6L A;  4KHY A;  3LAM A;  4W5T A;  1RCH A;  3V4I A;  3R8E A;  4WI1 A;  4O55 A;  1NGB A;  4A57 A;  1NK0 A;  2Y1J A;  3EZW A;  5C2D A;  3ZSZ A;  4FJ7 A;  3LP3 A;  4CJ7 A;  4YDQ A;  2YHW A;  4P77 A;  1JE3 A;  4DV0 K;  3LRJ A;  3AAQ A;  3LWM A;  4FM1 A;  5D3G A;  1HNX K;  1GLA G;  2GEM A;  1GLC G;  3ZSY A;  1XI1 A;  1HNV A;  4BR7 A;  2A6A A;  1EKE A;  4ZTJ A;  4CEO A;  2P1J A;  5M1K A;  4QAG A;  4K8Z A;  1VQO N;  2QWL A;  5LJW A;  2E5L K;  3DXK A;  4KKO A;  3TSU A;  4Z9E A;  3F5T A;  4K88 A;  4RW7 A;  3CCR N;  1RIL A;  1NKE A;  3Q7C A;  4BC3 A;  1HJO A;  4M41 A;  2GV9 A;  2G8V A;  4EFH A;  4FBQ A;  3CJ7 A;  4DR7 K;  4DQS A;  1VR4 A;  3VQE A;  1KXP A;  1NMN A;  4GMJ B;  1EQY A;  4X62 K;  4U67 L;  3ZIE A;  1GLF O;  4KHN A;  3PUF A;  2YHX A;  4YOT A;  3ITH A;  4FWO A;  3M5R A;  1TV6 A;  4WF9 L;  4OLA A;  1RFQ A;  1V4S A;  1NK6 A;  4A61 A;  4DR6 K;  3ZT1 A;  2EH1 A;  3VOV A;  3AGK A;  2P9U A;  1H0X A;  1KVB A;  5AR0 A;  4BQL A;  4CF2 A;  4NCA A;  2HB5 A;  2W6L A;  3MIO A;  3TSP A;  3VEV A;  3J7Y P;  4NZT M;  4ILJ A;  4JKC A;  4FJ9 A;  1NJW A;  3LAN A;  4H5T A;  1YHQ N;  1TUY A;  5BRE A;  3MCP A;  5JS2 A;  1S8E A;  2G8H A;  1NGF A;  2JWL A;  1SNN A;  3GE1 A;  2QWP A;  2Q31 A;  3CQ8 A;  3A5M C;  3ZT3 A;  2FSK A;  4C8O A;  3A0I X;  5AQY A;  2ZF5 O;  1NOZ A;  2AP1 A;  1SKR A;  2I7P A;  1OVQ A;  3K2P A;  4BAC A;  1QZ6 A;  5C0Y A;  2DFE A;  3E1Y A;  1NK9 A;  3P39 A;  2QA4 N;  3NH1 A;  3NHG A;  4CBU A;  3BF3 A;  4OLF A;  4BRE A;  4I9Q A;  2BUP A;  3G25 A;  4FVM A;  3CFO A;  3EEQ A;  5EY4 A;  4AF1 A;  4CHZ A;  3HO1 A;  1VQ5 N;  3DM2 A;  1NM1 A;  3KWG A;  3J7Z O;  3V9W A;  3D2E B;  5AQS A;  1VSJ A;  4C1N I;  3ZIG A;  4DV7 K;  3LDP A;  3SI6 A;  1VSF A;  3DLB A;  2UXB K;  1Y64 A;  4K25 A;  4FJX A;  2IC3 A;  1QSY A;  4E1N A;  2E8A A;  3KLE A;  3I8D A;  4OO1 J;  1E4F T;  4YOV A;  2IDO A;  2P9L A;  2Q0R A;  5BRF A;  5LMU K;  1JLB A;  3L2R A;  1XHZ A;  5CR4 A;  3KK1 A;  3VQB A;  4M63 C;  3P5J A;  5FDL A;  5BRH A;  5F2R A;  2AA4 A;  4JKD A;  1ASV A;  2A41 A;  2IFE A;  3CG7 A;  4FK0 A;  2VCP A;  4NZR M;  3ENO A;  4H0V B;  4M3R A;  3FZM A;  4JKA A;  3I8B A;  4CEA A;  4K41 A;  3LS6 A;  3HTV A;  4DFK A;  1HNI A;  4KH6 A;  4K42 A;  2XRI A;  2GBZ A;  4BVP A;  2IGI A;  1VQ6 N;  1BDG A;  3BDP A;  3LDN A;  2ITM A;  3CXC M;  3ZET B;  1U6Z A;  4DSJ A;  1TAQ A;  3ZX3 A;  4PKG A;  3MN7 A;  3ZSW A;  4EP5 A;  4QOZ B;  2XY7 A;  2Q1N A;  3U8X A;  2FBT A;  3CCQ N;  1H4S A;  1UDV A;  4JI4 K;  2H9U A;  3WQT A;  4DCH A;  4KO0 A;  2G8K A;  3ZSX A;  2Z1I A;  1Z25 A;  1XHX A;  3O1B A;  3K57 A;  4ID5 A;  1LN4 A;  3ZSR A;  3H08 A;  1YJ9 N;  2PYJ A;  5M1O A;  4FLU A;  4A62 A;  3P1G A;  4KH5 A;  5AQH A;  2QWN A;  4B1U B;  4IOA L;  1TK5 A;  3NBP A;  1A5X A;  2XO7 A;  4M42 A;  4KHQ A;  4M3X A;  3QFP A;  3HXM A;  4BRD A;  3BF1 A;  4BRP A;  4CF0 A;  4E1B A;  3L4Q A;  4KHU A;  1KFD A;  4CIE A;  2OPS A;  3HPH A;  4BRK A;  2IS3 A;  3OYM A;  5AQK A;  4CGI A;  3U9Z A;  3GG4 A;  3V1R A;  5BRD A;  3EKS A;  1RTD A;  4CHY A;  3THV A;  3L0Q A;  1ZYQ A;  4B9S A;  4H5W A;  2E20 A;  1W2B M;  2UXD K;  4CK1 A;  3SJH A;  1JDQ A;  4CJT A;  4NCX A;  3NGZ A;  1XMO K;  4CED A;  2YCH A;  3OYB A;  3QNO A;  1K4O A;  5B8H A;  5M1Q A;  3FLC O;  2OPP A;  4BR4 A;  3TAB A;  4JYA K;  2X78 A;  1VM0 A;  4JKF A;  1BHL A;  1QHT A;  1WSH A;  3O9S A;  3SNN A;  3EZ5 A;  3D2E A;  3P4I A;  4B1V A;  1JL2 A;  3AA3 A;  1VHX A;  1C0T A;  4H03 B;  4RW8 A;  1YJN N;  4FSV A;  2OPQ A;  4BWJ A;  3NGI A;  3SV4 A;  4HVZ A;  4J2B A;  3KTQ A;  4N5S A;  2YNH A;  1NWK A;  4O44 A;  3THX B;  1Q86 O;  4F3O A;  1ZBU A;  1DTT A;  1KVC A;  4PKH A;  1TKU A;  1NJZ A;  4IG3 A;  4CD3 A;  5SZT A;  3TPQ A;  4WQ4 A;  4H0T B;  4R5P A;  2P9S B;  4E7I A;  4DU3 A;  3VQ5 A;  1XWL A;  3MN5 A;  3TAM A;  1VSE A;  3OYA A;  2D0O A;  4DMN A;  4BRL A;  2CGL A;  1JXB A;  4LF4 K;  4F8R A;  1JO0 A;  3JYT A;  1FW6 A;  2RIS A;  1KAZ A;  4CEC A;  3AA4 A;  4HTL A;  1REV A;  3O08 A;  4CZL A;  4K8X A;  2VQE K;  1BA0 A;  1JCF A;  3LP0 A;  3ZET A;  3O3F A;  1TKD A;  3AJE A;  2BKY X;  4AM6 A;  3VA0 A;  5JMV A;  1HJR A;  4JAX A;  1ASW A;  1WSJ A;  4EHU A;  1K7J A;  2CGK A;  1C0F A;  3C95 A;  3S3O A;  4EZ6 A;  1XNR K;  3M8P A;  1HPM A;  4CEZ A;  3C6A A;  3QEW A;  1BIU A;  4FZY A;  3O3H A;  1RDA A;  2P9B A;  2X6S A;  3U9D A;  4FPA A;  3J7A P;  4XH1 A;  3ASM A;  5EX5 A;  2EWS A;  4BC4 A;  4ZTF A;  4KHS A;  1MWM A;  1NGD A;  1WN7 A;  3PX4 A;  3A2F A;  4DR2 K;  1YAG A;  1OKJ A;  1U04 A;  1NLV A;  5ELZ A;  4DS4 A;  3ZYY X;  3LP1 A;  4F2R A;  4PHT X;  4PWD A;  4B9N A;  2HHV A;  3OS2 A;  4H0O A;  1D9F A;  5HRO A;  1K8A O;  3TR8 A;  4OPK A;  2VGM A;  4EP4 A;  3R3L A;  4Z0U A;  4P6C A;  5EVZ A;  2O4G A;  3EE8 A;  3SBT A;  3S3N A;  1U45 A;  4LF7 K;  4HUF A;  1ASU A;  2RF2 A;  5KGW A;  1QE1 A;  1QZ5 A;  1HQE A;  2VWK A;  1JKH A;  5BN8 A;  1VSM A;  1ZC6 A;  3EL2 A;  3SLC A;  4DTU A;  5M1P A;  2YHY A;  3HRG A;  1HPZ A;  2QXL A;  4BY9 C;  3LDL A;  1BI4 A;  3AVF A;  4GVM A;  4C23 A;  3ZX2 A;  1YXQ A;  5AFU H;  3OYG A;  1N8R O;  5AQR A;  1WSI A;  4X65 K;  2WBN A;  2E2P A;  2Q0U A;  5AFU A;  1W9H A;  4FVU A;  1GOA A;  1K6Y A;  4YKE A;  5CE3 A;  4FWR A;  3AVH A;  4JN4 A;  4NO7 A;  3TTC A;  1TKX A;  3E9O A;  5LY3 A;  3M8Q A;  1C6V A;  3EO3 A;  3W0L A;  5AQZ A;  4LFC K;  1C1B A;  1GLJ O;  3NF8 A;  2RIU A;  4BRC A;  3DLK A;  1LWE A;  2P5O A;  1IV0 A;  1K4P A;  1BWF O;  3CJ1 A;  5FPE A;  2IIR A;  2ZJQ L;  3MN6 A;  3TTD A;  1YIT N;  4KBO A;  2CH6 A;  1RT7 A;  3QEP A;  5GIO A;  3PX0 A;  1BCM A;  3SPY A;  3K58 A;  2PAV A;  1RDB A;  4B3M K;  1IBM K;  4CEE A;  1KVA A;  1QHA A;  1X1P A;  2MX1 A;  4FLX A;  3THX A;  4I6M A;  1NGJ A;  3O9R A;  3CCJ N;  1BA1 A;  4DFM A;  4EZ9 A;  4JI5 K;  1NJI O;  2O8F B;  1NK5 A;  3OYF A;  3NE6 A;  2P9S A;  1UWB A;  4CJS A;  2UYT A;  4JI2 K;  1EP4 A;  5AQP A;  1TK0 A;  1RGI A;  3IG1 A;  2NRW A;  4DLE A;  4CZM A;  4YOU A;  1RT4 A;  1Y9X A;  3J80 O;  3C6T A;  2ZGY A;  3L4I A;  4CHP A;  3HJF A;  1TL1 A;  4IKF A;  5HP1 A;  4I2Q A;  2Q97 A;  4X64 K;  1XC3 A;  4B9V A;  3OTO K;  3L3U A;  2VG7 A;  3DAW A;  3DXM A;  1FKP A;  2JLE A;  2XY5 A;  3QFU A;  2FBV A;  5HL7 L;  5AQG A;  3QNN A;  2HHH K;  1JXE A;  4JD2 B;  4OKE A;  1H0Y A;  1BO5 O;  3E9P A;  4NB4 A;  4JI6 K;  3L2U A;  3O4N A;  3SK3 A;  3AVK A;  4IOX A;  4BRO A;  2EQA A;  1E4G T;  3O3G A;  4B1X B;  5TKY A;  4IFV A;  5AQF A;  4CZE A;  4DFP A;  3VN5 A;  1C0U A;  3QIC A;  4XH5 A;  5AQL A;  2ZJR L;  1KD1 O;  3O9Q A;  2W6K A;  1YTA A;  2YHA A;  1NJX A;  4FK2 A;  1CZ9 A;  1ZBF A;  3QO9 A;  2DY4 A;  1SV5 A;  1KFS A;  4FJI A;  3CFP A;  1G99 A;  3AVJ A;  4MO5 A;  2HF3 A;  3CCU N;  3CC4 N;  4BRH A;  5HRS A;  2YNI A;  1JL1 A;  4Z4G A;  2FF6 A;  4DS5 A;  1ATR A;  3ZII A;  3H3N O;  1K8K B;  3MEC A;  4FJK A;  4FZZ A;  1TYQ B;  3MCA B;  4YOR A;  4Y1D A;  3QLH A;  4DTJ A;  1N6Q A;  1RBU A;  1EO1 A;  1C0G A;  2Q3S A;  4ISG A;  3RSE B;  3ZSQ A;  4M3Z A;  3DLG A;  3DOL A;  1SZ2 A;  2DTU A;  4K43 A;  1N33 K;  3UIQ A;  2ITG A;  4FOI A;  1VRU A;  1Y97 A;  3IUC A;  3PO5 A;  3V9X A;  3SMP A;  4DV1 K;  1X3N A;  3OYC A;  1O1W A;  1YJW N;  2CGJ A;  1CXU A;  4CW7 B;  1ATN A;  3THW B;  4FO0 A;  4FPB A;  2YJE A;  3DLE A;  3CI5 A;  4DB3 A;  2HHS A;  1RNH A;  1NJ1 A;  2A1S A;  1WLJ A;  4F9O A;  3ZEU A;  4CER A;  4B9Q A;  4B3T K;  4E7K A;  4A2A A;  3OYE A;  3DRP A;  3LDS A;  3IFR A;  1B92 A;  4CHN A;  3TWH A;  1XMQ K;  1NGA A;  5AQT A;  3M3Z A;  3C65 A;  2ASP A;  1S9E A;  1U48 A;  4MFB A;  4FWN A;  2YJF A;  3VQD A;  3KJV A;  5J2P A;  2OA8 A;  3MX5 A;  5J2N A;  4GV9 A;  1Z6R A;  4CFD A;  3LWL A;  4A59 A;  3SUQ A;  1OVY A;  2GEL A;  3DJC A;  1WNS A;  2QTD A;  4FJ8 A;  2E2N A;  5BPN A;  5KQ8 A;  3RMA A;  2BE2 A;  3CJA A;  4OPH A;  4AHS A;  4HHT A;  2V52 B;  3O6W A;  3IKM A;  4HD0 A;  4K86 A;  1O13 A;  4UQG A;  1R59 O;  4NCB A;  3NMU A;  2P9P B;  2CH5 A;  3K5M A;  1YT3 A;  2O8B A;  3V1O A;  2XHB A;  3HZ7 A;  2F7T A;  3TAP A;  2O8F A;  1T44 A;  3UE5 A;  1BOT O;  5SWM A;  3AO2 A;  4FW2 A;  3MWP A;  4IXC A;  4DTS A;  5KTQ A;  1IEZ A;  1RDD A;  3L2W A;  5BR9 A;  3VEO A;  3T7Z A;  2HHT A;  1LAV A;  3THY B;  2UUC K;  1TKS A;  1GOB A;  1VRT A;  3D2F A;  2VQF K;  1UA1 A;  5I3U A;  4Z4I A;  2B6A A;  4ISF A;  1MU2 A;  3ATV A;  4CHQ A;  3H07 A;  3TAE A;  3FZL A;  3IS9 A;  4ZHR A;  1WBD A;  3P38 A;  4JD2 A;  1ZBI A;  4DTM A;  3VEX A;  1HNZ K;  2ASO A;  3WUH A;  5CYM A;  4RCH A;  1K4L A;  4GNI A;  4LC9 B;  4OLB A;  1CXQ A;  5AZI B;  4OX9 K;  4CJR A;  1LW0 A;  2FLO A;  1T6C A;  4EHT A;  1SL0 A;  4WFB L;  4YOX A;  1NGG A;  4DQQ A;  5FRN A;  3E01 A;  2LSN A;  4OKJ A;  3G10 A;  1MDU B;  2A3Z A;  3ENB A;  4MDA A;  4NLC A;  4Y0W A;  1KSP A;  4KTZ A;  4IEE A;  2W42 A;  4I2P A;  4QS7 A;  3NAE A;  2KFN A;  4Q15 A;  2HBJ A;  3QML A;  3JXU A;  2VWJ A;  2HBL A;  1OH8 A;  4C8M A;  1A5W A;  1BG3 A;  4H0Y B;  3KD5 E;  1K8K A;  4OJR A;  5J1E A;  3LVK B;  3HOS A;  5HRN A;  1H4T A;  4Z4F A;  4AHU A;  1TKT A;  3AO5 A;  2GWJ A;  2YHB A;  3RSE A;  3M6G A;  5CZ1 A;  4CJ3 A;  2WUS A;  4JI3 K;  2P9K B;  4JK7 A;  4BRG A;  5KRT A;  4DUY K;  3V9Z A;  1LWF A;  1I39 A;  1UOC A;  3KK2 A;  1IKV A;  2E88 A;  5C24 A;  5FRO A;  3O4W A;  2BGG A;  3KLH A;  4I14 A;  3OS0 A;  3THW A;  2XY6 A;  3M8S A;  4A5A A;  4CGJ A;  1DEJ A;  3NH2 A;  3VES A;  4CJW A;  1S1U A;  3TAR A;  3VA3 A;  1TUU A;  1TK8 A;  3HM9 A;  3V9S A;  4GV6 A;  2D0A A;  3OYL A;  3C0B A;  3QEV A;  4PL7 A;  3ATU A;  4KB1 A;  1PAV A;  1S6P A;  4HUE A;  1NGE A;  2D0P A;  3WNH A;  3RMB A;  3PV8 A;  1J5O A;  1I3A A;  1HQU A;  1YF5 L;  3UB5 A;  4Q0B A;  4XEI A;  3L3V A;  4RWT A;  4YY3 K;  3PSF A;  1NFH A;  2BH1 A;  4G1Q A;  3V81 A;  4K87 A;  1IBL K;  1WSE A;  2FSJ A;  1Q82 O;  3AVA A;  4DV4 K;  1VQP N;  4CEQ A;  3K5O A;  1IKX A;  3OYD A;  3MK6 A;  3VQC A;  4WQ5 C;  3KKS A;  1IG8 A;  4P8J A;  1HKG A;  5GAG P;  1X3M A;  3A5O C;  4UY8 O;  2P9P A;  3FR0 A;  3BEX A;  4B9U A;  3OY9 A;  2YNF A;  3CER A;  4LH5 A;  4FLY A;  3F9M A;  2Y1B A;  5AQI A;  4E7H A;  3C94 A;  1QTM A;  1S22 A;  1MA9 B;  3HBT A;  3H6E A;  3L7V A;  2RPI A;  1JLA A;  2KQ2 A;  4H0X B;  2I5J A;  4FJ5 A;  4JKB A;  4PL8 A;  3OYJ A;  1KQS M;  3VEZ A;  3THY A;  2D0C A;  3DSD A;  3MWT A;  4GVE A;  4CZG A;  4CEB A;  2X74 A;  1IBK K;  3DOK A;  3ZX0 A;  4DLG A;  2H3G X;  2HBK A;  5EOY A;  4FLZ A;  3KD1 E;  2LN3 A;  3TOE A;  1MWK A;  2YV0 X;  3AAR A;  5FPD A;  3D45 A;  4FOE A;  4E89 A;  1T03 A;  1W7A A;  5C12 A;  3T69 A;  4W5Q A;  3T1Y K;  1S9G A;  4JLH A;  5AZI A;  3MX2 A;  2ASM A;  5LMN K;  4BRI A;  1OH7 A;  2D4W A;  3ZSO A;  4CGG A;  1OH5 A;  2P51 A;  5E26 A;  3KZB A;  4BVO A;  4X66 K;  3HT3 A;  4BE1 A;  4BC2 A;  1NKB A;  4CJU A;  3N4Q A;  4H5N A;  1PVY A;  3I56 N;  1N32 K;  1E3M A;  1KLM A;  4IWV A;  4TWA A;  4IJN A;  2E2Q A;  1BQM A;  3NVM A;  1RDC A;  4CJF A;  1S72 N;  5AZJ B;  5FRM A;  5F0X A;  1NGC A;  4J2E A;  4FWS A;  3DYA A;  1SL1 A;  3UKR B;  4ELT A;  4JK8 A;  2NZT A;  2NRZ A;  3ENH A;  1ZXO A;  4CJ5 A;  4C8K A;  2OTJ N;  4DQ8 A;  5DMR A;  1KAY A;  4YNQ A;  3CJB A;  4LF8 K;  1EWQ A;  4WFA L;  4CJL A;  4KAZ A;  4NXM K;  1IKW A;  4GKK K;  4JI0 K;  3O9T A;  3SJJ A;  4JRP A;  3LPU A;  4NLB A;  2HNZ A;  4BDZ A;  3A5N C;  2P9K A;  2PZS A;  4JNE A;  4AHR A;  1SQK A;  1H4Q A;  2E6M A;  3QEI A;  4B1W B;  3G0Z A;  3K5L A;  4FWL A;  5GAD P;  3CQY A;  3LVJ C;  1KRP A;  4EIA A;  3RRG A;  2XY8 A;  3BP8 A;  3WXK A;  3PIO L;  3K59 A;  4DTP A;  4BWM A;  3SUP A;  3AVG A;  1X9M A;  5E41 A;  3BY5 A;  3ZCM A;  3CCL N;  4JKE A;  3MN9 A;  4JKG B;  4CHO A;  1KC8 O;  4QCL A;  4MLH A;  1NGH A;  3NF6 A;  4O8U A;  1YI2 N;  4FLV A;  3CCV N;  4FK4 A;  4U7B A;  5TKW A;  3AO4 A;  4O5F A;  4W5N A;  4BE0 A;  3HVR A;  2HMI A;  4EO0 A;  4BR2 A;  3O9U A;  3SBG A;  5AQU A;  4B1Z A;  1YIJ N;  1JLC A;  3OVN A;  3OW2 M;  2YX6 A;  3GL1 A;  1NOY A;  4IZ9 A;  3T1I A;  3JS6 A;  4BR0 A;  3AGR A;  4DU1 A;  3PX6 A;  3VER A;  2BTF A;  2QKB A;  4J2D A;  2O8E B;  2BAN A;  2HOE A;  1HYS A;  1ATS A;  1NMD A;  5MLC Q;  3KLF A;  4B3R K;  3U4L A;  3CC7 N;  4OGE A;  3ULD A;  1XC9 A;  3OJS A;  3MK5 A;  3VQ6 A;  1U47 A;  5JLF A;  4M3Y A;  3DWL A;  4B3S K;  3CET A;  5JIC A;  4O0J A;  3SQ1 A;  3HZ6 A;  2KFZ A;  4BC5 A;  3AVL A;  2FSN A;  2G8U A;  3AVI A;  4DWI A;  3LDO A;  4NYN A;  5KPR A;  1QQN A;  4YDU C;  3MXJ A;  2OYQ A;  5EXW A;  4IDK A;  4N56 A;  4OVL A;  3HPG A;  5BPL A;  2F9W A;  4CBX A;  2EX3 A;  5BN9 A;  4CJ4 A;  4BG9 A;  5BR8 K;  5DM7 L;  5HRR A;  1RBS A;  2P9I B;  3S3M A;  2IVO A;  1VSH A;  4QS9 A;  2NUB A;  1ZBL A;  3DSC A;  2HW3 A;  1TIG A;  4GW6 A;  3GOI A;  1LCU A;  1DCJ A;  4MO4 A;  4FXD A;  1G57 A;  1XQS C;  5C42 A;  4DSI A;  2L8Y A;  2ZM6 K;  4LSL A;  1NK7 A;  4B9T A;  3C7N B;  4CJK A;  1J5E K;  5KPZ A;  3NF9 A;  3O4Q A;  3L8B A;  3ULE B;  2KW4 A;  4DR4 K;  3CYM A;  5AZJ A;  4M45 A;  1UAX A;  4HVC A;  1L3T A;  4DU4 A;  3UKR A;  4CFC A;  2QWR A;  2Z1J A;  3VEY A;  4HCB A;  3K5N A;  4CIG A;  4BE2 A;  5FLX O;  1N36 K;  3DLR A;  4DUZ K;  1CZB A;  5C15 A;  3MXI A;  1FK9 A;  4HTU A;  3HOT A;  1NNE A;  3H3O B;  4IFE A;  3NCI A;  3ID6 A;  3WXI A;  3NF7 A;  5GAH P;  4KPY A;  2NLX A;  3BZK A;  2O8C B;  3QBX A;  4DQP A;  2GUP A;  1HYV A;  3CHW A;  1LW2 A;  2DFH A;  3FFI A;  3WNE A;  1HMV A;  4DSL A;  4O8K A;  1B9F A;  1JCU A;  2QEX N;  1X9S A;  3KK3 A;  4FM0 A;  3ZT0 A;  4CFA A;  1Q81 O;  3FE1 A;  4P6D A;  1WSG A;  4DTN A;  3ZT2 A;  3RVC A;  1VSK A;  4RG8 A;  1JLE A;  4FJH A;  3TTF A;  1NJ5 A;  1S1X A;  2NRR A;  4A5B A;  1QSS A;  3HI0 A;  4AH9 A;  2ZWH A;  5HLF A;  4CF8 A;  4HWI A;  2VWB A;  4JKG A;  2RKI A;  4AM7 A;  2FBX A;  4H0P A;  1UA0 A;  3DRS A;  3QES A;  1LAW A;  1JLG A;  5CY4 A;  5AQO A;  3U6F A;  2DPN A;  1SAZ A;  1VQ4 N;  4KHW A;  2Z1G A;  3OYK A;  4AHC A;  1N5Y A;  3CC2 N;  1RTJ A;  3OJU A;  4C8L A;  1QVF M;  1XNQ K;  1ESV A;  1P8Z A;  1XUP O;  4KI4 A;  1GLL O;  2R7Y A;  5KRS A;  5J2M A;  4NYF A;  2QI2 A;  3C6H A;  1RT2 A;  4LY7 A;  1RTI A;  2O8E A;  4N41 A;  3NVK A;  1NKC A;  2E1Y A;  3CD6 N;  1DT9 A;  3D6R A;  4JEP A;  1K73 O;  4DTR A;  3F73 A;  5J2Q A;  5I9E B;  1RDU A;  3VQ4 A;  3NGY A;  3ZSV A;  4DSE A;  1J6Z A;  4J8F A;  2W41 A;  4DTX A;  3AV9 A;  1J9A A;  5KI6 A;  3VTI A;  3H1Q A;  3BZC A;  2WC9 A;  3QIO A;  3R6M A;  2QK9 A;  1IO2 A;  1G58 A;  2P5G A;  3TU5 A;  4I7F A;  1SL2 A;  3IDH A;  5JS1 A;  4CJQ A;  2CRQ A;  3D7E O;  3OA9 A;  3AAP A;  2V7Z A;  1L3U A;  4KTQ A;  5BPM A;  3V9U A;  4ELV A;  1S6Q A;  2GUI A;  1FJG K;  1TAU A;  5CHI A;  3SPZ A;  3S41 A;  4B3O A;  1IH7 A;  1N34 K;  1QS4 A;  4FWP A;  4OPJ A;  5EU7 A;  2J4R A;  4FCX A;  1X9J A;  2P9I A;  3CCS N;  3FZH A;  1B9D A;  1C0M A;  5H1S Q;  2QW9 A;  4NCG A;  3SYZ A;  3CCM N;  1VQ7 N;  1U2V B;  3R1X A;  5GIP A;  1X9W A;  1S5J A;  3KLI A;  2IVP A;  1A5V A;  4CZH A;  1VSD A;  3AVN A;  3SZ2 A;  3B8A X;  3TAN A;  4PA1 A;  4KFB A;  2E4L A;  4CJE A;  1Q7Y O;  3C7N A;  5K14 A;  4JI8 K;  4FJJ A;  4AHV A;  4CZF A;  3ULE A;  3CFR A;  1VSL A;  4M3T A;  3LAL A;  1BUP A;  2HVH A;  4LF5 K;  3HM8 A;  1RT6 A;  3MXM A;  4M3U A;  5ADX H;  4BRF A;  4BDP A;  4JV5 K;  1Q9X A;  1Q8I A;  4CGH A;  4OKK A;  5ADX A;  1JJ2 M;  4I9L A;  4ICL A;  3E9L A;  3LM9 A;  5LJV A;  3PY8 A;  1NK8 A;  1P90 A;  1T3V A;  2O8C A;  4FL9 A;  2KTQ A;  3VF4 A;  3U3Y A;  4WE1 A;  3WBM A;  2Z1H A;  4Z94 A;  2YKM A;  1WBB A;  1K49 A;  3Q7B A;  4KI6 A;  4FW1 A;  1LWC A;  4OGC A;  4CZI A;  1ZBS A;  5AQN A;  4H5V A;  1WSF A;  1W97 L;  2F96 A;  3FFK B;  4B9L A;  1SKW A;  2D1K A;  1HR0 K;  1JLQ A;  4FBK A;  2HHQ A;  4WQ5 A;  2WOM A;  3N4P A;  4CES A;  1S1V A;  1SUQ A;  3M8R A;  2KZM A;  4E7J A;  4JK9 A;  4CF9 A;  1DGK N;  2E1Z A;  4FCY A;  3H45 C;  3VF2 A;  2IAJ A;  1KAX A;  3DRR A;  1S1T A;  2Z7C A;  3L2V A;  2D0B A;  1NG9 A;  4BGA A;  2ZD1 A;  3G71 N;  1SS6 A;  3WXL A;  3CM5 A;  4DKW A;  3SQ4 A;  1DKG D;  1IG9 A;  5HBM A;  5M1N A;  5KQD A;  3I0R A;  3G6E N;  3QET A;  5JVH L;  3W3D A;  3MGZ A;  4R79 A;  3P83 D;  2EHG A;  3BUZ B;  4B8C A;  4CJP A;  4AQY K;  4CFB A;  4JI1 K;  1SKS A;  4PKI A;  4CK3 A;  3NDK A;  1PVW A;  3SAF A;  3K9K A;  2GX9 A;  1RBT A;  4H8K A;  5E84 A;  3O1W A;  2YKN A;  4GV3 A;  3IAB B;  3WXM B;  5JLH A;  3CIP A;  4DHY A;  3I55 N;  2VG5 A;  3DLH A;  5AQJ A;  1BCO A;  2AJQ A;  2G8I A;  4KB0 A;  1GLE G;  3F2K A;  3EKU A;  4W5R A;  4O4G A;  2UUA K;  4L3Q A;  4Z4C A;  4BRM A;  4RW9 A;  1TVR A;  1GOC A;  1U4B A;  2YNG A;  4BRN A;  3CJC A;  2FBY A;  2E2O A;  2B5J A;  1TYQ A;  4ID1 A;  4A2B A;  1WB9 A;  4FWQ A;  1VQN N;  3TAG A;  3OYH A;  3LAK A;  1RT5 A;  1G15 A;  3BGR A;  4PQU A;  1Y2I A;  1U2V A;  4E1J A;  1KCF A;  3AO1 A;  3U3G A;  4L8R B;  2Q36 A;  4CD1 A;  3O5B A;  1OH6 A;  4M3W A;  4G9Z A;  4E7L A;  2NNW A;  5CYQ A;  3SUO A;  4BQZ A;  4CEF A;  3EY1 A;  3HYF A;  1KTQ A;  2HF4 A;  3SQ2 A;  4DV2 K;  1S3X A;  5M1F A;  3VEN A;  2BDP A;  2IOC A;  2OZM A;  4FJG A;  2RN2 A;  3KIO A;  2KZZ A;  4CZJ A;  2OZS A;  4N76 A;  4IO9 L;  4GKJ K;  1NH9 A;  2HST A;  2V7Y A;  4M7Y A;  4WCE L;  2QWO A;  3LPT A;  4MDB A;  4E1M A;  2F8S A;  2NRT A;  3SCX A;  1FKO A;  2OAN A;  3CPE A;  4V19 S;  2WON A;  4W5O A;  1II7 A;  1HYZ A;  5C2F A;  1ILY A;  3UKU B;  4FLW A;  3O8M A;  5T7B A;  3IAL A;  4N47 A;  1VQM N;  3LDQ A;  2FF3 B;  4AIL C;  4JI7 K;  5C25 A;  5IT9 O;  1NGI A;  3QEX A;  3SV3 A;  3L2Q A;  2HNY A;  2A5X A;  3CM6 A;  2ATQ A;  5C10 A;  3OBY A;  1K9M O;  5KPT A;  3RWU A;  3AO3 A;  1TGO A;  2Y1I A;  4YOW A;  3PLA A;  4DG1 A;  4XH4 A;  2RE2 A;  2KKZ A;  2OPR A;  2DFF A;  4CVN E;  2W40 A;  1NK4 A;  1NJY A;  5HOO A;  3AVM A;  1LV5 A;  1C1C A;  1BU6 O;  1HKC A;  4IG0 A;  1IJJ A;  3GBT A;  2V51 B;  3CQX A;  4BG8 A;  2PY5 A;  2A1R A;  3RR8 A;  4ILH A;  4B1Y B;  1RDW X;  4YDU A;  3VQ8 A;  2NRH A;  5AQM A;  2HHX A;  2VG6 A;  3B6P A;  3WQU A;  4H4M A; 
#chains in the Genus database with same CATH homology
 5BPL A;  2QWP A;  2F9W A;  4CBX A;  2Q31 A;  5BN9 A;  1G99 A;  2QWQ A;  4MO5 A;  1D4X A;  3A5M C;  2HF3 A;  4BG9 A;  5DM7 L;  3CCU N;  2FSK A;  4BRH A;  3A0I X;  2P9I B;  3CC4 N;  5AQY A;  1M90 O;  2IVO A;  2ZF5 O;  4QS9 A;  2AP1 A;  2FF6 A;  3GOI A;  1GLD G;  1LCU A;  4MLE A;  2RHK A;  1ATR A;  2I7P A;  2PBD A;  3ZII A;  3H3N O;  4MO4 A;  1G57 A;  1K8K B;  5FPM A;  1QZ6 A;  1XQS C;  5C0Y A;  1TYQ B;  3MCA B;  3G4S N;  4YOR A;  3E1Y A;  4H5R A;  3P39 A;  2QA4 N;  1GLB G;  4CBU A;  3BF3 A;  1EO1 A;  1C0G A;  4ISG A;  3RSE B;  4BRE A;  1QVG M;  3A8Y A;  2BUP A;  1SZ2 A;  1CZA N;  2Q2R A;  3C7N B;  3G25 A;  4K43 A;  4BR9 A;  3TSQ A;  5KPZ A;  4FOI A;  5EY4 A;  3ULE B;  4AF1 A;  1HUX A;  1WUA A;  5AZJ A;  4WFN L;  3I33 A;  1NM1 A;  1T6D A;  3KWG A;  1VQ5 N;  2ZGZ A;  3J7Z O;  3IUC A;  3D2E B;  4IDH A;  5AQS A;  3UKR A;  4C1N I;  3ZIG A;  3LDP A;  3SMP A;  2QWR A;  1X3N A;  3VMF B;  3A5L C;  3VEY A;  2NRV A;  1YJW N;  2CGJ A;  1Y64 A;  3OHR A;  1ATN A;  4ISE A;  4K25 A;  5F1X A;  5DM6 L;  4FO0 A;  4FPB A;  2E8A A;  2GWK A;  2YJE A;  2P9N B;  3CI5 A;  4WYB A;  4DB3 A;  5C15 A;  4OO1 J;  1E4F T;  3HOT A;  3H3O B;  4IFE A;  3ID6 A;  4F9O A;  3ZEU A;  2P9L A;  3WXI A;  4B9Q A;  5GAH P;  4YOV A;  4A2A A;  2NLX A;  2Q0R A;  3IFR A;  3QBX A;  5BRF A;  1H1V A;  2GUP A;  5CR4 A;  1NGA A;  4M63 C;  4P8E A;  3CHW A;  5AQT A;  5BRH A;  3M3Z A;  3C65 A;  5F2R A;  2AA4 A;  2ASP A;  4JKD A;  4O8K A;  4IOC L;  4FWN A;  2YJF A;  2A41 A;  1JCU A;  2QEX N;  3P31 A;  3L6Q A;  1Q81 O;  2VCP A;  3FE1 A;  4NZR M;  3ENO A;  3MX5 A;  4H0V B;  4GV9 A;  4P6D A;  1Z6R A;  3KVG A;  5AQX A;  3RVC A;  4A59 A;  3FZM A;  3MDQ A;  3I8B A;  4JKA A;  1OVY A;  2GEL A;  3DJC A;  3HTV A;  4K41 A;  4CI6 A;  2QTD A;  3TTF A;  4I6M B;  3LS6 A;  2E2N A;  4JHD B;  4K42 A;  4KH6 A;  5BPN A;  4BVP A;  5KQ8 A;  4A5B A;  2NRR A;  1YVN A;  3HI0 A;  1VQ6 N;  1BDG A;  1Z05 A;  3CJA A;  3MMV A;  2ZWH A;  4OPH A;  3LDN A;  2ITM A;  2V52 B;  3CXC M;  4HWI A;  1HKB A;  2VWB A;  3IKM A;  3O6W A;  3WEE B;  3QBW A;  4JKG A;  1U6Z A;  3ZET B;  4CBW A;  1O13 A;  4AM7 A;  1R59 O;  4H0P A;  3VEW A;  3ZX3 A;  4PKG A;  5AQO A;  3MN7 A;  2P9P B;  3NMU A;  2CH5 A;  4CZK A;  2DPN A;  1SAZ A;  1VQ4 N;  2Q1N A;  2F7T A;  3U8X A;  1T44 A;  3UE5 A;  3CC2 N;  1BOT O;  3CCQ N;  3UKU A;  3O80 A;  3E66 A;  1QVF M;  3MWP A;  3VTH A;  4IXC A;  1ESV A;  1P8Z A;  1XUP O;  2PFU A;  1IEZ A;  1GLL O;  3DXM B;  2QI2 A;  3C6H A;  3EN9 A;  4BRA A;  3VEO A;  3WQT A;  5BR9 A;  4DCH A;  2IVN A;  3T7Z A;  4RTF D;  3NVK A;  2E1Y A;  3O1B A;  1TKS A;  3D2F A;  3CD6 N;  1DT9 A;  3D6R A;  4JEP A;  1K73 O;  1QQM A;  4BGB A;  1YJ9 N;  4ISF A;  5I9E B;  5M1O A;  3ATV A;  5FPN A;  1RDU A;  3DLL L;  4A62 A;  3H07 A;  4KH5 A;  2OTL N;  1J6Z A;  2GTD A;  4J8F A;  5AQW A;  3FZL A;  2W41 A;  3P38 A;  4JD2 A;  3VTI A;  3H1Q A;  2QWN A;  5AQH A;  3VEX A;  2ASO A;  3IMX A;  2WC9 A;  3R6M A;  3WUH A;  4B1U B;  4IOA L;  4RCH A;  1K4L A;  4GNI A;  4LC9 B;  1G58 A;  3TU5 A;  5AZI B;  4BR5 A;  1HLU A;  3IDH A;  1XEZ A;  1VQ8 N;  3D7E O;  1WOQ A;  3AAP A;  2V7Z A;  2FLO A;  3OA9 A;  5BPM A;  1T6C A;  4EHT A;  4WFB L;  3QFP A;  4YOX A;  1NGG A;  4BRD A;  5AQQ A;  3BF1 A;  3SAG A;  5CHI A;  3CJ9 A;  4BRP A;  4E1B A;  3L4Q A;  3WT0 A;  3ZIH A;  3S41 A;  1MDU B;  2A3Z A;  3AY9 A;  3ENB A;  4MDA A;  4NLC A;  4Y0W A;  4BRK A;  4IEE A;  5AQK A;  4FWP A;  4QS7 A;  3U9Z A;  3GG4 A;  4FWM A;  2J4R A;  2HBJ A;  3QML A;  4FWK A;  3JXU A;  5BRD A;  4FCX A;  3EKS A;  1X9J A;  3CCE N;  2P9I A;  3CCS N;  3FZH A;  5AQV A;  2HBL A;  3L0Q A;  3QDK A;  5H1S Q;  1BG3 A;  2QW9 A;  1YUW A;  3CCM N;  1VQ7 N;  1U2V B;  3GDQ A;  3R1X A;  4H5W A;  2E20 A;  5GIP A;  4H0Y B;  1K4I A;  1K8K A;  1QQO A;  1W2B M;  2WFB A;  3HOS A;  2IVP A;  4CZH A;  3FZK A;  3SJH A;  5JVG L;  4EAH D;  3SMS A;  4YOY A;  3J8A A;  2F9T A;  2YCH A;  3B8A X;  1LOT B;  1K4O A;  1VAZ A;  2GWJ A;  3RSE A;  5B8H A;  3M6G A;  3FLC O;  5M1Q A;  4BR4 A;  1Q7Y O;  2WUS A;  3C7N A;  4JKF A;  1VQK N;  2P9K B;  4JK7 A;  4BRG A;  2JWK A;  4CZF A;  3ULE A;  3O9S A;  4JKH A;  1BUP A;  3D2E A;  3P4I A;  3HM8 A;  4B1V A;  2HBM A;  4FBW A;  1Q18 A;  3ZEU B;  2E88 A;  4H03 B;  5ADX H;  1YJN N;  1VQ9 N;  4BRF A;  3O4W A;  3HSC A;  4FSV A;  4I14 A;  2HMP A;  3CF5 L;  5ADX A;  1JJ2 M;  3CPW M;  3OBW A;  3E9L A;  4A5A A;  2P9N A;  4HVZ A;  5LJV A;  1DEJ A;  4KH4 A;  1NWK A;  3DXK B;  3VES A;  1Q86 O;  1P90 A;  1T3V A;  4PKH A;  1TUU A;  4FL9 A;  1TKU A;  3K9J A;  3VF4 A;  4CD3 A;  4GV6 A;  3LQU A;  4Z94 A;  3TPQ A;  1JCE A;  4WQ4 A;  4H0T B;  3C0B A;  2P9S B;  4PL7 A;  3QB0 A;  3ATU A;  1M1K O;  2VYP A;  3MN5 A;  4WQ4 C;  1K49 A;  2ZJP L;  3Q7B A;  1NGE A;  2D0P A;  4M7X A;  4P6P A;  4CZI A;  2D0O A;  4BRL A;  1YF5 L;  1ZBS A;  5AQN A;  2CGL A;  3VGK A;  2YI1 A;  4H5V A;  3UB5 A;  1JCG A;  4XEI A;  1W97 L;  4RWT A;  3FFK B;  2BH1 A;  4JHD A;  3LL3 A;  2RIS A;  2D1K A;  1KAZ A;  4FBK A;  4GY2 B;  2FSJ A;  4WQ5 A;  1Q82 O;  1VQP N;  2VGN A;  3N4P A;  3O08 A;  4HTL A;  4CZL A;  3WEE A;  1BA0 A;  1JCF A;  3MK6 A;  4WQ5 C;  4JK9 A;  1IG8 A;  1DGK N;  2E1Z A;  3ZET A;  1HKG A;  3H45 C;  3VF2 A;  4C1N K;  1X3M A;  3A5O C;  5GAG P;  3AJE A;  3VGM A;  4AM6 A;  1KAX A;  4UY8 O;  5JMV A;  2P9P A;  4JAX A;  3FR0 A;  3H1V X;  2P9U B;  1HX1 A;  3BEX A;  4EHU A;  4BGA A;  2CGK A;  1K7J A;  1C0F A;  3CER A;  3G71 N;  3D2F B;  3P04 A;  1SS6 A;  2A42 A;  3WXL A;  3F9M A;  4DKW A;  5AQI A;  1DKG D;  1S22 A;  1HPM A;  1MA9 B;  5M1N A;  3HBT A;  3H6E A;  3C6A A;  3VF6 A;  5KQD A;  3L7V A;  3G6E N;  4H0X B;  5JVH L;  3KWI A;  3W3D A;  4BRQ A;  3LM2 A;  3ID8 A;  3MGZ A;  2P9B A;  4JKB A;  4R79 A;  3U9D A;  4FPA A;  2FXU A;  3BUZ B;  4PL8 A;  1KQS M;  4XH1 A;  3VEZ A;  5GAE P;  5EX5 A;  3VET A;  2QWM A;  4IO8 A;  3VPZ A;  3FZF A;  2EWS A;  4GVE A;  3MWT A;  4BC4 A;  2NRX A;  4PKI A;  4CZG A;  1MWM A;  1NGD A;  5GIN A;  3PIP L;  3EE9 A;  1YAG A;  1OKJ A;  3WXJ A;  1PVW A;  3SAF A;  3K9K A;  1NLV A;  4ILG B;  3ZX0 A;  2GX9 A;  2A40 A;  4IJA A;  5E84 A;  3O1W A;  2H3G X;  4OPA A;  2HBK A;  5EOY A;  4GV3 A;  4FFJ A;  5ELZ A;  3ZYY X;  2LN3 A;  1MWK A;  3WXM B;  4PHT X;  5JLH A;  3AAR A;  4H0O A;  5FPD A;  3CIP A;  4DHY A;  3I55 N;  4FOE A;  5AQJ A;  1K8A O;  5C12 A;  3T69 A;  1V4T A;  2VGM A;  1GLE G;  3F2K A;  3M1F A;  3R3L A;  2KHO A;  3EKU A;  3KK7 A;  1VQL N;  5AZI A;  3MX2 A;  4P6C A;  2ASM A;  5EVZ A;  4BRI A;  3EE8 A;  4L3Q A;  4QS8 A;  3SBT A;  4BRM A;  2D4W A;  3H46 O;  1QZ5 A;  4BVO A;  5E26 A;  2QM1 A;  3KZB A;  4BRN A;  3CJC A;  3R9P A;  4BC2 A;  3VGL A;  3N4Q A;  2E2O A;  4H5N A;  1PVY A;  3I56 N;  4IWV A;  5BN8 A;  4IJN A;  2E2Q A;  3NVM A;  1TYQ A;  1ZC6 A;  1S72 N;  5AZJ B;  4A2B A;  3EL2 A;  5F0X A;  1NGC A;  1HRU A;  3SLC A;  4FWQ A;  4FWS A;  3CME N;  5M1P A;  3UKR B;  2YHY A;  3HRG A;  1VQN N;  2KLA A;  2QXL A;  4JK8 A;  1NBW A;  2NZT A;  4BY9 C;  1KK9 A;  3LDL A;  2NRZ A;  3ENH A;  1ZXO A;  4C23 A;  3ZX2 A;  2I7N A;  1YXQ A;  2OTJ N;  4DQ8 A;  5AFU H;  1U2V A;  4E1J A;  1N8R O;  5AQR A;  1KAY A;  2Q36 A;  4CD1 A;  2WBN A;  3O5B A;  3CJB A;  2E2P A;  2Q0U A;  3KHY A;  5AFU A;  4WFA L;  2P9L B;  3CMA N;  3FGU A;  4IEI A;  4FVU A;  3SAH A;  4G9Z A;  2NNW A;  4YKE A;  3O9T A;  5CE3 A;  4FWR A;  4NO7 A;  4JN4 A;  3TTC A;  3E9O A;  5LY3 A;  4BQZ A;  4NLB A;  3R8E A;  3EO3 A;  1NGB A;  3W0L A;  3A5N C;  4A57 A;  2HF4 A;  1VQM N;  2P9K A;  3EZW A;  5AQZ A;  5C2D A;  1GLJ O;  4JNE A;  1S3X A;  1SQK A;  2RIU A;  4B1W B;  4BRC A;  5M1F A;  4FWL A;  3VEN A;  4CJ7 A;  3CQY A;  5GAD P;  2YHW A;  4P77 A;  4EIA A;  1K4P A;  1BWF O;  3CJ1 A;  3LRJ A;  5FPE A;  2IIR A;  2ZJQ L;  3AAQ A;  3MN6 A;  1GLA G;  3TTD A;  1GLC G;  2GEM A;  3BP8 A;  3WXK A;  1YIT N;  4KBO A;  2CH6 A;  3PIO L;  5GIO A;  4BR7 A;  4CZJ A;  3CCL N;  2A6A A;  4IO9 L;  2HST A;  2PAV A;  4JKE A;  3MN9 A;  5M1K A;  4JKG B;  2V7Y A;  4M7Y A;  4MLH A;  4WCE L;  2QWO A;  1KC8 O;  1NGH A;  1QHA A;  2QWL A;  4MDB A;  4O8U A;  1YI2 N;  1VQO N;  5LJW A;  3CCV N;  2MX1 A;  2NRT A;  3DXK A;  4U7B A;  4I6M A;  3TSU A;  1NGJ A;  2OAN A;  3CPE A;  3F5T A;  3O9R A;  5TKW A;  3CCJ N;  1BA1 A;  4O5F A;  3CCR N;  1NJI O;  3Q7C A;  4BC3 A;  1HJO A;  5C2F A;  1ILY A;  2P9S A;  3UKU B;  3O8M A;  4EO0 A;  4BR2 A;  3O9U A;  3SBG A;  5AQU A;  2UYT A;  4B1Z A;  4EFH A;  1YIJ N;  3OW2 M;  5AQP A;  4FBQ A;  1RGI A;  2YX6 A;  3GL1 A;  4IZ9 A;  3T1I A;  3CJ7 A;  3JS6 A;  2FF3 B;  2NRW A;  3AGR A;  3LDQ A;  3VER A;  4BR0 A;  4YOU A;  4CZM A;  1NGI A;  2BTF A;  1KXP A;  2ZGY A;  1EQY A;  2A5X A;  2HOE A;  4U67 L;  3ZIE A;  3L4I A;  5C10 A;  1GLF O;  3OBY A;  1K9M O;  2YHX A;  4YOT A;  1ATS A;  5KPT A;  4FWO A;  1NMD A;  3M5R A;  4WF9 L;  2Q97 A;  4YOW A;  1XC3 A;  3PLA A;  4P8J A;  1RFQ A;  4XH4 A;  1V4S A;  2RE2 A;  2KKZ A;  3DAW A;  3U4L A;  3DXM A;  5MLC Q;  3CC7 N;  4A61 A;  2W40 A;  3QFU A;  3MK5 A;  5HL7 L;  5AQG A;  5HOO A;  4JD2 B;  5JLF A;  3VOV A;  3AGK A;  2P9U A;  1BO5 O;  1BU6 O;  1HKC A;  3E9P A;  4NB4 A;  3SK3 A;  4BRO A;  4IOX A;  2EQA A;  3DWL A;  5AR0 A;  1IJJ A;  3GBT A;  1E4G T;  4B1X B;  3CET A;  5JIC A;  4BQL A;  2V51 B;  3HZ6 A;  3CQX A;  5AQF A;  5TKY A;  4BC5 A;  4CZE A;  3TSP A;  4BG8 A;  3VEV A;  3MIO A;  4NZT M;  4ILJ A;  4JKC A;  2FSN A;  4ILH A;  4B1Y B;  1RDW X;  3QIC A;  4H5T A;  3LDO A;  1YHQ N;  4YDU A;  4XH5 A;  1TUY A;  5AQL A;  5BRE A;  2ZJR L;  1KD1 O;  3O9Q A;  5KPR A;  3MCP A;  1QQN A;  2NRH A;  4YDU C;  5AQM A;  5EXW A;  1NGF A;  2JWL A;  3WQU A;  3LM9 A;  1SNN A;  3GE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...