3TTCA

Crystal structure of e. coli hypf with adp and carbamoyl phosphate
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
646
structure length
646
Chain Sequence
b'QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 215
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttcA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttcA01
3TTCA 3VEXA 3TSPA 3VESA 3VENA 3TSUA 3TTFA 3VTHA 3TTDA 3VEOA 3VERA 3TSQA 3VEZA 3VEWA 3VTIA 3VF4A 3VF2A 3VETA
chains in the Genus database with same CATH superfamily
2A3ZA 3QBXA 1BOTO 4DSFA 4BC5A 1FKPA 2YHAA 4KRFA 2Z1GA 3DXKA 5LMNK 4RW4A 3PIPL 3K0SA 1C0TA 1NGAA 3T1HK 4JK8A 3TSUA 4H0PA 3RVCA 4LC9B 3QINA 4CHYA 3ZSXA 3CQ8A 2Q0UA 2OZSA 5AQWA 2G8FA 1K4PA 3IKMA 2F8TA 4ELTA 2Q31A 2DPNA 2VCPA 1IEZA 3THWA 5C0YA 3HBTA 3K58A 2EX3A 1HPZA 3L4IA 3CXCM 5GINA 1KFSA 1CXUA 5FDLA 3RMAA 3R6MA 4XH4A 1BI4B 2OPSA 3BZKA 3OYGA 3VGLA 3SUQA 3PO5A 4DFMA 3VEYA 4DLGA 3C7NB 4A62A 3LQUA 3P83D 4Z4CA 2H9UA 2O4IA 4DF4A 2P9NA 3SBTA 4B1YB 1S6QA 2HBKA 1QZ5A 2NNWA 1KK9A 3MGZA 4LF6K 4O5FA 3ENOA 1VQON 4MDAA 3KK7A 3W3DA 4KO0A 3TAMA 2A1RA 1X9SA 4KHSA 4DKWA 3CD6N 3VF4A 4IJNA 2E6LA 3C6AA 4E1NA 2P9SA 3SAHA 1CLQA 1BIUA 3AO3A 3WXMB 4YOWA 3VGKA 2NUBA 1BA1A 4B9VA 3J8AA 2JWLA 4X62K 1KTQA 3KWGA 4XEIA 1YTUA 3V9ZA 2WUSA 3LVKB 3DXMB 3MX2A 2YNIA 2V7ZA 2FXUA 4CJWA 2GV9A 4RTFD 2DY4A 2YCHA 3QBWA 2UUCK 1TK5A 3TTCA 4BRCA 2HHXA 1JDQA 1XC9A 4IDKA 5AQIA 1KLMA 3EEQA 4A2AA 3OYLA 3CPEA 4DV2K 1DGKN 1TK0A 3A8YA 5FRMA 3AVMA 3LDPA 4DU1A 4CZFA 4NZTM 4KB0A 4JEPA 4OLAA 3D2EB 4LF7K 2D0CA 2QTDA 3EKSA 1Z25A 2KZZA 3TSQA 3CI5A 1FJGK 4B1WB 2XY8A 5H1SQ 1D8YA 3LM2A 2QI2A 4OVLA 4C23A 1WSEA 4ELVA 3G25A 2NRWA 4H0YB 3VMFB 3LP1A 4DV6K 4O4GA 3I0SA 5J2PA 5J1EA 3D2FA 1W9HA 1IBKK 4A5BA 4BR0A 3ZX3A 2G8UA 3OJSA 3LP0A 3ZSRA 4B9MA 4PY5A 3MN6A 3CG7A 4P6CA 3JXUA 1T8EA 4Z94A 3HJFA 3O3HA 4AH9A 4UY8O 2W41A 2Q3VA 5HRPA 4KH4A 2E4LA 1WB9A 1P90A 3BF1A 2ITGA 1BHLA 1NU0A 4B8AB 3GL1A 3TAFA 3QIPA 3V1RA 4JKCA 1T6CA 1U2VA 3L4QA 2PBDA 4CE9A 4FXDA 2KQ2A 2I7NA 2W6KA 1G58A 4BDPA 3TWHA 4H5RA 2B4JA 3MAQA 4KHYA 3SMSA 2RPIA 3QETA 1HUXA 1VSDA 3TOEA 5HROA 2IVNA 2YJEA 3S3MA 2BKYX 4PL7A 4I6MA 3K59A 1I94K 3O9UA 3ENBA 3K2PA 2VG5A 4IZ9A 5AQNA 4LF9K 4DF8A 5GIPA 1W2BM 5LY3A 4CIFA 1O1WA 4CZGA 3DRPA 3NF9A 1Q9YA 4LFCK 1U04A 1RTJA 1WSFA 1NJ8A 1C1CA 2IVPA 3EZ5A 3CMAN 2Y1BA 2CGJA 1XMOK 3IABB 4CK2A 3C0BA 3L0QA 4FZZA 1KAZA 4FJLA 1SKSA 1EQYA 4GNIA 4AM7A 4CEEA 1QHTA 2ZQBA 4E7LA 3V9UA 2NRHA 1JCEA 3BY5A 1REVA 2QM1A 1JLQA 1GLCG 3SMPA 1G57A 3QDKA 4DS5A 3LS6A 3J7YP 3V4IA 5C24A 3G0ZA 2GWJA 1VR4A 1K4LA 3U6FA 3JSMA 3H3NO 4P8EA 2FBYA 4FWNA 1GLEG 1LW0A 2Z1JA 2GWKA 1MWKA 1SZ2A 5CY4A 3PO4A 1E4GT 5I9EB 1NKEA 3K5OA 4DWIA 1L3UA 5JLFA 4B3TK 1ATSA 5AQKA 4DR4K 1ASUA 4CZJA 1QVFM 2PFUA 4TSXA 5JMVA 3LP2A 1NJWA 2CH5A 4FPBA 4K41A 4DS4A 3AVNA 1K6YA 3CCQN 1OH5A 3SAGA 3HK2A 3MECA 3TAEA 1VSHA 1HRHA 1NG9A 4IDHA 5GAHP 1Z05A 1RT4A 2X74A 3SK3A 1IG8A 3KWIA 4IFYA 2UXCK 1N8RO 2O8BA 4BRIA 4DQSA 3VF6A 4GV6A 5LL6Z 3WEEA 3OYCA 5BRHA 3KD1E 4Q15A 2UXDK 4RG8A 3NHGA 3I55N 2O8CB 1K9MO 2E1ZA 1J5EK 4BVOA 2FF6A 2NZTA 3FFKB 1NMNA 2G8HA 3PSFA 2OYQA 1C0FA 3AVJA 5AZIA 2HVHA 3MN9A 1OVQA 4I2PA 1TAUA 4YFUA 1NK5A 4CBWA 4CZIA 3VQQA 4F2SA 3LPTA 3I33A 1GLJO 5BPLA 5M1OA 5MLCQ 2NRZA 3LP3A 5KPTA 1H0XA 1FKOA 4M3ZA 3CFPA 3HPHA 4DQQA 3UKRB 4N5SA 2A1SA 1ZBHA 4QCLA 4KV8A 4JI4K 3HYFA 4YOTA 1K49A 2OPRA 4BRDA 3CCVN 1DEJA 2VG7A 5EVZA 4Y1CA 1B92A 4BROA 3OYNA 2QWQA 1OH6A 4CZEA 4CFAA 1RGIA 1HX1A 4ILHA 4JKFA 3QERA 3BZCA 1ILYA 4K43A 1HRUA 3HVRA 2YNFA 3IS9A 4IJAA 3OS2A 3MWTA 3L6QA 4JHDB 1QQMA 4OPHA 2QA4N 2NRVA 3UKUB 3QICA 4BQZA 2OANA 3PX0A 1RBSA 4DTUA 1IG9A 4HUEA 2F8SA 3VQBA 4F4KA 1EWRA 5SWMA 3RSEB 2MX1A 4MQ3A 1NJIO 3MEDA 4RW8A 2PYLA 4OO1J 1W0HA 5AJ3K 3LDQA 1Z6RA 4CIEA 2PYJA 2YKNA 2O8FA 1JKHA 3RWUA 1KVBA 4K42A 4DU3A 1SKRA 4JV5K 3LRJA 3V6DA 3JAMO 4B8CA 1RBRA 3N4PA 1RTHA 2FBXA 4CI6A 4BRLA 4YKEA 3KJVA 2Y1JA 2OZMA 4MDBA 5ADXH 2Y1IA 3SBGA 3BUZB 2QW9A 2YV0X 3TAPA 4OGCA 1M90O 4M3XA 1NFHA 3F2KA 4BRQA 4EO0A 3E66A 5AQZA 2VQFK 5BN8A 1XNRK 1RT5A 4FVMA 4YHHK 1K8KA 3LAKA 1DKGD 1JL2A 1WAJA 5C10A 1NGFA 5EXWA 4KI4A 4KTZA 2BUPA 4QS8A 3AVGA 4GKKK 3RR8A 3IDHA 4EP4A 4CK1A 5AQGA 3CETA 1RQ8A 2P9PB 4FJ8A 4WQ5C 4C1NI 2ZD1A 1Q7YO 2HMIA 1YVNA 3VQ9A 1JLFA 1QZ6A 3VF2A 4GKJK 4FW1A 5HRNA 1HNIA 4M7YA 3TABA 5E26A 2LN3A 3DOKA 1S22A 1OH8A 1TKTA 2HVIA 1GLAG 4GVMA 4FLXA 3ZT3A 3CYMA 3SJJA 3IG1A 4IO9L 4BRKA 3ATUA 2P9UB 3OS0A 1VQ9N 1UWBA 4AHRA 1WLJA 1LAVA 1MDUB 2Q0RA 1UDVA 4FWSA 3LL3A 4BE2A 4E3SA 3MEGA 4U67L 3FFIA 3O9TA 4CJKA 5DM6L 4QAGA 4FJXA 3SI6A 4BR9A 2F96A 3SQ1A 3O5BA 3KD5E 4CD1A 2ASMA 1N6QA 2HNDA 5KPZA 3VA0A 4H0OA 4I9LA 5FROA 1LCUA 1VSKA 1JCFA 1XHXA 3EKUA 4CJRA 3LZIA 4KPYA 4BREA 3ZEUB 4EAHD 3VA3A 1NWKA 4WI1A 5FLXO 3NE6A 3DAWA 3LWLA 3EE8A 3OYEA 4EHUA 4AHTA 1TUYA 1X3NA 1TIGA 4JI1K 3AARA 1D9FA 4R5PA 3CJ7A 4Z4FA 1EXQA 2HBLA 4FCYA 1KD1O 3LM9A 5F1XA 4IFVA 3BDPA 3NDKA 2YJFA 2A41A 4CERA 1KC8O 1SNNA 1WAFA 5F0XA 3DLBA 2P9LA 3T1AA 2QWOA 4ZTFA 4FJGA 1QSSA 3PSIA 1VQ6N 4LSNA 4WFBL 4DQIA 3FGUA 4IOCL 4CESA 3RTVA 3VEXA 5J2QA 3ZETB 2ZE2A 3MN7A 4F9OA 1U45A 4JKEA 4A5AA 3MXMA 2P51A 3J7ZO 2HHUA 1DT9A 5JS2A 3AVLA 2O8DB 2E88A 2X6NA 3SPZA 5HBMA 3HSTB 3L7VA 2D4WA 1U6ZA 3P38A 4B3MK 4IOXA 4GV9A 3RMBA 4WCEL 1VQ5N 1BO5O 3ZSOA 3H45C 1ZXOA 4ZTJA 3H07A 4X66K 1C0MA 1HKBA 1UAXA 5JVHL 3E9LA 1HR0K 5SZTA 1L3VA 5EY4A 1QS4A 3AGKA 3M1FA 5LJWA 3DLKA 1Q82O 2E2NA 3B6PA 4FWMA 4AF1A 4CF9A 4DLEA 3T19A 1BI4A 3WXLA 4O44A 4YOUA 1T7PA 3KLIA 2Q2RA 2DFFA 3VQAA 4CGGA 5J2NA 4LFAK 2P9BA 2VG6A 3K5LA 1HJRA 2HHVA 3ATVA 4CJSA 1HJOA 4FJNA 3S41A 1L3TA 4UQGA 1KCFA 4B9SA 4DB3A 3KHYA 3DXKB 4NYFA 4FLWA 4B1UB 4FJKA 4IG3A 2F7TA 4JYAK 4DUYK 4NXMK 1TVRA 5AQLA 3VEOA 4ID5A 4J2EA 3C6UA 3JYTA 1JL1A 3Q7BA 1FK9A 2V7YA 4WQ5A 3VEZA 1N36K 4CEOA 3FZMA 4JRQA 1NGEA 1GLDG 2HHWA 3QESA 3THWB 1C0UA 4O0IA 3C94A 4DU4A 4DCHA 4OLFA 4CGIA 5HOOA 4OPAA 3V81A 2I7PA 2XY6A 1VQNN 3GDQA 3AVBA 3DXMA 3HP9A 3O6WA 3CCJN 4DUZK 3SUPA 4L3QA 3NH2A 4FK0A 1LN4A 3C65A 4C8KA 3LDNA 3MWPA 3NFAA 3UB5A 4DR5K 5ELZA 3SQ0A 3AVKA 3KK2A 1QSLA 4DV4K 2A5XA 2P9NB 3VQCA 4BWJA 1BWFO 2IVOA 3VN5A 3M3ZA 1M1KO 1D9DA 1CZAN 2W6LA 3IMXA 5ADXA 2ZM6K 2FLOA 4PWDA 2P9SB 4CFBA 1TKZA 3PX6A 1LV5A 3ZLJA 4FLUA 1HMVA 2OCEA 1KVCA 4P6PA 5KGWA 3KK3A 3EY1A 1J6ZA 1NKBA 4B9LA 1VRTA 3ZSYA 2WTUA 1WSHA 4DR6K 3VQDA 3CJCA 3E1YA 4E1JA 4M7XA 4A61A 4BQLA 4RW6A 3KLFA 3VQEA 1Y9XA 1QTMA 1U47A 1S6PA 5B8HA 3EE9A 2HBJA 4PUOA 2YKMA 4CHNA 3CCLN 3AJEA 4DQRA 3GBTA 2UU9K 1U4BA 4K86A 2FSKA 5AQOA 4F8RA 3I8DA 4P8JA 3ZIIA 1IJJA 4CHZA 4JI7K 1RT2A 3QKBA 3TI0A 2YHBA 3ID6A 4BR7A 3THXA 1HKGA 4KHQA 3ZYYX 4FWPA 4BR4A 1I3AA 4NLCA 3IFRA 4FJ7A 4M3WA 1RNHA 1NLVA 3CQYA 3OBYA 4DFKA 3VETA 4CECA 5CZ2A 3OYIA 5JVGL 4F3TA 2E1YA 1SAZA 1V4TA 3RRGA 3ZSVA 1BCOA 1XWLA 3V1OA 4Q0BA 4EFHA 1BQNA 5A2QO 3CFRA 4HD0A 3T7ZA 2VGNA 5EOYA 2QK9A 4OLBA 1VAZA 4W5TA 2QKKA 2BH1A 1YUWA 3D2FB 3TARA 3I0RA 3IRXA 4U7BA 3NVMA 1BIZA 5DK5A 1A5VA 2CRQA 3CJAA 1XNQK 3OJUA 4CGHA 3ZT4A 3CHWA 1WSGA 3G10A 3U3GA 3QFPA 1XI1A 2ZJQL 2ZWHA 2YI1A 1GLLO 4XH5A 3U4LA 1JLEA 1BUPA 4JI2K 4CEQA 3NF6A 3BP8A 4CF1A 1TYQA 4KTQA 3KK1A 4H5TA 1S1VA 4O5BA 4KBOA 4FJ5A 1U2VB 1W97L 2CH6A 1N32K 3VENA 4ISEA 2E2OA 4JD2A 2E8AA 1TK8A 4HVCA 1CZ9A 1S1XA 3H46O 3WQTA 3VOVA 3HO1A 3LVJC 5IWAK 5LJVA 1Q86O 1NGBA 4KTWA 5JLHA 4I6MB 3OW2M 4V19S 5BRDA 3BEXA 4LH5A 3NMUA 1SUQA 4DV5K 2O8EA 1J5OA 4LF8K 4JI5K 3EN9A 3FZHA 1HYVA 3P39A 3LDSA 4JI8K 4H5VA 2NLXA 3CM5A 1C0GA 2G8IA 4MO4A 1RBTA 5AZJA 4F2RA 4NCGA 1JXEA 5AQHA 4M3TA 4OPKA 1W7AA 4GV3A 1VQLN 5FPEA 3CJBA 2B6AA 1QHAA 1IH7A 2IDOA 3K5NA 4FLZA 3WNGA 3SYZA 1GOAA 1RBUA 3MIOA 3P1GA 4PKIA 1VSMA 2RE2A 4MLEA 3LDLA 2P9IB 2ZJPL 3LANA 4LF4K 3IALA 5GADP 3THYB 4JKDA 1E3MA 1T03A 2UXBK 3V1QA 3K9KA 4QOZB 1DLOA 2E20A 4NO7A 3LAMA 3QEIA 4DR3K 1DTQA 1YTAA 4QS9A 3SV3A 5AQSA 5LMUK 3VTHA 4JN4A 4LF5K 3G71N 3CCMN 1NK4A 2D1KA 5C42A 1KVAA 2Q3SA 4A59A 5FRNA 2WONA 5JICA 3IAYA 3PIOL 3A5LC 2E5LK 3FZFA 4K8XA 3H1QA 1SL1A 4CGDA 1MU2A 2HHQA 3OYBA 4NXNK 2IAJA 3ZIGA 3MEEA 1K73O 1VQ8N 1NM1A 3WNFA 1NJYA 3ALYA 4NB4A 1S1WA 2HNZA 3M5RA 4DSJA 1RT6A 1ZC6A 1YJWN 3T3FA 4DG1A 3MK5A 4A2BA 3B6OA 1TUUA 5C25A 1ASVA 5AQQA 5M1KA 3WEEB 2JLEA 3L3VA 5KTQA 3PV8A 1NJ2A 3W0LA 3HPOA 3OYMA 4LFBK 2A6AA 3F9KA 2W42A 3O80A 3V9WA 4IXCA 4AQYK 4YY3K 2QWRA 4M3UA 5C2FA 2A2YA 5AZIB 4BC2A 4K8ZA 1TV6A 3K5MA 3LZJA 4FZYA 2HF4A 3V9XA 2VQEK 2DFHA 4CEFA 1RILA 4KHNA 3AGRA 3M6GA 4EZ6A 4B1VA 4J2DA 1D4XA 3K9JA 1YJNN 2W40A 1KSPA 2M71A 4E1MA 3TAQA 3O8MA 4FLTA 3VGMA 3AO5A 3ASMA 1ZBUA 2CGLA 2A40A 3QMLA 4H03B 4RW9A 3OYDA 3GG4A 1RT7A 1TKXA 3AY9A 1EETA 3E9PA 3ZSQA 4IG0A 3CF5L 1NK9A 2YHYA 2BTFA 3J80O 5CE3A 3CERA 4HUGA 1JLGA 4JKGA 4PKGA 4P77A 1JXBA 1YXQA 3EO3A 4FK4A 2P5GA 4FLYA 1SQKA 3SZ2A 4H4OA 2WFBA 2YX6A 2GUPA 3HZ7A 2X6SA 3CPWM 4B3OA 3G4SN 3M8SA 2QXFA 1NMDA 1DCJA 3WT0A 5AQXA 3ULEA 5M1PA 4CGJA 1NNEA 1YI2N 4TWAA 4OPJA 1RTDA 1LWCA 3NGIA 1HPMA 4E7IA 1PVWA 1JLAA 4CJFA 2F4VK 3ISNC 3VQ8A 1VQ4N 3AVFA 1C6VA 2WC9A 2NRRA 3D45A 1HYZA 4BE0A 1JCGA 2EK0A 3TANA 3L2QA 4CJ7A 3AA2A 2O8FB 3O1BA 1SV5A 4H5WA 4CJEA 2HMPA 2UUAK 1VQKN 2P1JA 4FPAA 5HLFA 3QO9A 1NJ5A 1S9EA 3L2VA 1KRPA 4JRPA 3I56N 2D0OA 4EP5A 1J54A 4J8FA 2VWJA 1NK7A 4YNQA 3MCAB 1EP4A 3LDOA 3RMCA 5GAGP 4HCCA 3NBPA 1RT1A 4FWKA 3P04A 4FWRA 4FM1A 1BU6O 1K8KB 2NRXA 2QWMA 3G6EN 4DTPA 1TKUA 4I9QA 3SCXA 2QWNA 1XUPO 4H0VB 2IC3A 1WN7A 1HNWK 4E7JA 1JLBA 1YT3A 4PA1A 3NVKA 1YF5L 4FYDA 1WBBA 4JI3K 2FSJA 4GW6A 4Q5VA 1IKXA 2P9KA 4IOAL 3OTOK 2GBZA 3N4QA 1WBDA 2RHKA 4ICLA 2EHGA 3U8XA 2UYTA 4DQ8A 1HQEA 5KGXA 4GVEA 3V9SA 3J81O 4BRNA 3LWMA 4BRPA 3AAQA 1NGCA 2KFNA 1NGHA 4BE1A 1S72N 5DM7L 1VQMN 4HVJA 1MWMA 3WUHA 4QS7A 3VQ4A 2IOCA 1II7A 1EX4A 2YHXA 3GOIA 3QIOA 4BVPA 4ZHRA 4FWOA 2FF3B 2D0AA 3OY9A 5IT9O 4K88A 4BC4A 4B1XB 1PAVA 3MXIA 4JLHA 4CZHA 3VQ5A 3DWLA 3TTFA 2HB5A 3HI0A 4FW2A 2CGKA 4I2QA 4HTLA 5C12A 3NF8A 4CEAA 3AA5X 4CZKA 2IS3A 5K14A 4DSIA 5AQYA 2RIUA 2D5RA 1ATNA 4BRFA 4CVNE 1Y97A 1C1BA 1BDGA 1RDWX 1H4TA 3D6RA 2AJQA 4BDZA 4BACA 3HPGA 1CZBA 4X64K 3H08A 4GY2B 2EH1A 4HTUA 3R1XA 4M41A 1KQSM 4FOIA 4BRMA 1OH7A 2HHHK 5EX5A 5AQUA 4B3SK 3VERA 1QQNA 1NBWA 1XMQK 4BY9C 5KPRA 3KTQA 4BGAA 2VGMA 5CR4A 1NJ6A 2KFZA 1UOCA 4AHCA 3WXJA 5GAEP 4CEZA 2RN2A 1WUAA 2IGIA 2HSTA 3D7EO 2P9LB 1J53A 3TPQA 4HVZA 2Q36A 1T44A 1BCMA 4K25A 5AFUH 3OYAA 3H3OB 3WBMA 1IKVA 3HVTA 2EQAA 2AP1A 1TGOA 4R79A 3QNNA 4KKOA 3SLCA 3HOSA 4JKAA 1IO2A 1LW2A 5C15A 4JS5A 2E6MA 4CCHA 1EWQA 3SQ4A 1BISA 5FPDA 2I5JA 4OGEA 4CZMA 4B1ZA 4BDYA 5AR0A 3NH1A 2L8YA 3FLCO 3NH0A 1HNVA 4CJVA 4WF9L 3F73A 3RMDA 3SUNA 2OPQA 3E01A 1HQUA 3CM6A 5J2MA 2FBTA 1WNSA 3THVA 4YDQA 4G9ZA 3WNHA 1NK0A 3PLAA 1S3XA 3U9DA 2ZJRL 5AQPA 3C7NA 4P6DA 3CQXA 2RISA 2P5OA 1O13A 5FPMA 2KLAA 1TAQA 1HC7A 2DFEA 3RR7A 1IKYA 3UIQA 3PX4A 2Z1IA 3EL2A 1BQMA 2WOMA 2BANA 1NK8A 3ZT1A 4HCBA 3KZBA 5KI6A 3TU5A 4CEBA 3S3NA 4FK2A 2ASPA 3MXJA 3B8AX 2OTJN 1R0AA 1NH9A 1UA1A 1TKDA 3E9OA 4MLHA 2KTQA 4CJ4A 1H4QA 1YVUA 4DSEA 2KKZA 3SUOA 3SNNA 1MA9B 2GTCA 2WBNA 4B9UA 4ISFA 4CF8A 4DR1K 2XHBA 4B3RK 1X9JA 3O9QA 4IKFA 3VPZA 2Q1NA 3NF7A 2QEXN 1E4FT 3ITHA 1G99A 4JI0K 1V4SA 4CJ3A 3F9MA 1NGGA 3QFUA 5KQDA 2ITMA 2HHSA 5M1QA 4FZXC 1EKEA 1LAWA 3OYHA 2AA4A 3QEWA 4AHUA 3AA3A 4DTJA 3ZX2A 3A2FA 4CHOA 3DRRA 1HLUA 3EYZA 3JS6A 1H4SA 3ZT2A 4I14A 3MK6A 4JS4A 4FOEA 1XEZA 4FFJA 2J4RA 1DTTA 1VQPN 1JJ2M 4CHPA 1QE1A 3D2EA 1ESVA 3DYAA 1N5YA 4Y0WA 5HL7L 5AQFA 4W5OA 3DMJA 3HZ6A 5DMRA 4BR5A 3F5TA 3HSCA 4JK9A 1LWEA 3T1IA 1GLFO 1T6DA 4FSVA 2ZF5O 3L2UA 3P5JA 3DLLL 1SL2A 3A5OC 3CC7N 4B9NA 2V51B 2HW3A 3KVGA 3VESA 3PY8A 3SV4A 3O4WA 4CGFA 2QWPA 1RDCA 4FBKA 3CCRN 3O9RA 4CHQA 3O08A 2ETJA 2F9WA 4NCBA 1S8EA 2B5JA 4IO8A 3VEVA 3QEXA 4KAZA 1KLNA 1BGXT 5AQTA 4DFPA 1YHQN 4FJIA 3GE1A 2GELA 4CJUA 5JS1A 3HM9A 3CCUN 3ZCMA 4DV0K 4AM6A 3ZSZA 1YIJN 4CBUA 3FE1A 5TKWA 4E7KA 1QSYA 1KXPA 1NOZA 3FR0A 3QLHA 2Q97A 4B9QA 4EIAA 5M1NA 3AA4A 4B08A 1EO1A 4AHVA 3OYFA 4ILJA 3ZIHA 1VSLA 4YOYA 1WOQA 3AAPA 4LD0A 4ID1A 4NLBA 4OKEA 2YHWA 3CFOA 5KQ8A 1X9WA 1NFJA 3ZT0A 3QEPA 4NCAA 1HNXK 2OPPA 3DOLA 3DLGA 3SAFA 1GLBG 4C1NK 4DHYA 4FCXA 4LH4A 2HBMA 3HRGA 3CC4N 4Z4IA 3THXB 4C8OA 4H8KA 3P4IA 4FJMA 1NOYA 3DRSA 2EWSA 2E2QA 3AVAA 4BWMA 3VQ7A 3HXMA 2PAVA 3NAEA 3IABA 4CW7B 1FW6A 4IWVA 2XY5A 4G1QA 1BL3A 4E19A 2NRTA 3BGRA 5HRSA 4JAXA 4DTOA 4AHSA 1HYSA 3QB0A 1YITN 1LOTB 3MDQA 5AQRA 1S9GA 3ZX0A 2KZMA 2JWKA 4X65K 4Z4GA 4PHTX 1U49A 3ZIEA 3M8RA 1HKCA 5BR8K 2OTLN 4MO5A 2UUBK 1NGIA 3ULDA 5KRSA 4CF0A 4XH1A 4CIGA 4CK3A 3H1VX 2IFEA 3EZWA 3WXIA 1S5JA 3CCEN 1TYQB 3HM8A 2OA8A 5CYQA 1VQ7N 4BG9A 4FJJA 1H0YA 1L3SA 3L2WA 4HUFA 4C8MA 2VYPA 1T3VA 4Z0UA 3ENHA 4E7HA 2P9IA 3HL8A 4JD2B 4W5RA 4WQ4C 4HWIA 4Z9EA 2QXLA 5KRTA 3THYA 3P31A 3WQUA 1ATRA 4C8LA 3A5MC 4ELUA 4M3YA 5CHIA 2O8EB 3WXKA 1RTIA 3HTVA 3DJCA 3SPYA 2PZSA 3KLEA 1VSFA 5T7BA 4FM0A 1WSIA 2FSNA 1JCUA 2D0PA 3J7AP 5AFUA 3AO4A 1JE3A 4M63C 1TL3A 5AZJB 2ASOA 3T1YK 5CYMA 4FBWA 2O8CA 3R9PA 1ASWA 3VTIA 3VQ6A 1N34K 2F9TA 5FPNA 1ZYQA 1Y2IA 4W5QA 1XQSC 4CJPA 2XY7A 3UE5A 4CEDA 3NGZA 2HHTA 1VK0A 1X3MA 3CIPA 5BPMA 4FM2A 3HT3A 5EU7A 4E1BA 4O8UA 3NCIA 3TTDA 4EZ9A 1L5UA 1G15A 1RDBA 4DTSA 3DLRA 5M1FA 3R3LA 3OVNA 3I8BA 3H6EA 5HRRA 4N41A 4CBXA 4M3RA 1J9AA 3DM2A 4WFAL 3UKRA 3RRHA 4OKJA 2R7YA 1K4IA 1NKCA 1PVYA 4H0XB 4FVUA 2O8BB 4KFBA 4BGBA 4CJ5A 4CF2A 3QEVA 3LPUA 2O4GA 2KHOA 5E41A 3QNOA 4JK7A 4JHDA 3L8BA 4LY7A 4CFCA 4OKKA 3TR8A 3UKUA 1FXXA 1KAXA 3CJ9A 5TKYA 4N56A 4KB1A 4AILC 4RW7A 3TSPA 4WYBA 3RSEA 1K8AO 4W5NA 4OJRA 4DSKA 1BG3A 4Z4EA 3CJ1A 4CJLA 3DSCA 4DV1K 2DTUA 2G8VA 3AVCA 4DV7K 2BGGA 3KLGA 3ZSWA 2ZGZA 2X78A 3IUCA 3VQPA 1OVYA 1Z26A 4CJQA 4IEIA 1RT3A 4ISGA 4JKHA 1I39A 4BRAA 1ZBFA 1OKJA 3U9ZA 3OYJA 3D0PA 4M42A 1C1AA 2JGUA 1N33K 2FC0A 4H4MA 1A5WA 2XRIA 4KHWA 4ILGB 1X1PA 2XO7A 4JI6K 3SJHA 5F2RA 4YOXA 3C6TA 4K0KK 3O1WA 1HNZK 4LSLA 3MN5A 2ZGYA 4YDUC 4DR7K 2FBVA 4E0DA 2HNYA 5BREA 4KREA 4CJTA 3T69A 1RCHA 1Q81O 2ATQA 1Q9XA 1NGJA 1Q8IA 1YAGA 5BPNA 4DTRA 1UA0A 4F3OA 1YJ9N 5HP1A 1GOBA 4J2AA 3ID8A 3U6YA 1KAYA 1U48A 1K4OA 5BR9A 3AVIA 1B9FA 3AV9A 2V52B 3L3UA 1T05A 4JKGB 1VSJA 1NJXA 1NK6A 1K7JA 3TAGA 2P9PA 4Z4HA 1LWFA 1XHZA 2G8KA 1VSIA 4H5NA 4FL9A 4WQ4A 1IBMK 4OX9K 4KH6A 2GUIA 3PUFA 3L2RA 4DV3K 4FJHA 2IIRA 3ULEB 4Y1DA 1RFQA 1IBLK 3M8PA 5AQJA 4DTMA 4FO0A 4BG8A 4H0TB 5D3GA 4YOVA 3OA9A 4BC3A 1TL1A 4JNEA 4GMJB 3KLHA 4DTXA 2BE2A 1F21A 2P9UA 4FJ9A 4BR2A 3MCPA 4L8RB 2YNGA 1VSEA 3C6HA 3SQ2A 3O3GA 3NGYA 4IEEA 4KHUA 1Y64A 4E89A 5AQVA 1RDAA 4NCXA 4DMNA 2RF2A 1XC3A 4YORA 1ZBIA 4C8NA 5GIOA 3A0IX 3Q7CA 1ZBLA 4RWTA 3HOTA 1KFDA 2Z7CA 3FZLA 1RDDA 3WNEA 3ZEUA 4DTNA 2E2PA 2YNHA 4K87A 4FWQA 4J2BA 2G8WA 1VM0A 1D5AA 1SKWA 4IBNA 3S3OA 4CZLA 1CXQA 1P8ZA 4FBQA 3CMEN 3AO2A 4DFJA 1X9MA 1S1UA 2LSNA 4CFDA 2BDPA 1SS6A 3AVHA 3O4NA 1QQCA 1Q18A 4DSLA 3CC2N 2P9KB 5BN9A 4DR2K 4BRHA 4B9TA 1JLCA 1IKWA 4PQUA 3OYKA 5AQMA 5I42A 1NGDA 5BRFA 1B9DA 3O3FA 4NYNA 4DQPA 3DSDA 3AO1A 4XIUA 3ZETA 1A5XA 2A42A 4PKHA 4N47A 4EHTA 1ITGA 2PY5A 3A5NC 4IFEA 3U3YA 1VRUA 2H3GX 4FLVA 2LXRA 2HF3A 3OHRA 4BRGA 2GX9A 3O4QA 3M8QA 2O8DA 1WSJA 1JO0A 4KHPK 4KI6A 1R59O 3DI6A 3LALA 1NJ1A 3KKRA 3FZKA 1IV0A 3DLHA 2VWKA 3O9SA 4JKBA 1GOCA 1RDUA 4O55A 3DLEA 1H1VA 3KKSA 3OS1A 2RKIA 1TKSA 4PL8A 3R8EA 2QKBA 1ZBSA 1S1TA 4MFBA 3KIOA 2GTDA 3BF3A 1QVGM 4NZRM 2KW4A 4A57A 2QWLA 3C95A 2Z1HA 3CCSN 1BA0A 5C2DA 5E84A 1NJZA 4WE1A 3S9HA 3HP6A 3K57A 1VHXA 5I3UA 4RCHA 3OBWA 4O8KA 1QQOA 4WFNL 4FWLA 2VWBA 4YDUA 4M45A 3MX5A 4O0JA 4CD3A 2HOEA 3MMVA 5CZ1A 2D0BA 4N76A 4HHTA 4KH5A 1RBVA 1SL0A 2GEMA 4I7FA 3VEWA
chains in the Genus database with same CATH topology
4CBUA 2A3ZA 5AQGA 3QBXA 1BOTO 3FE1A 5TKWA 3A5LC 4BC5A 3PIOL 3DXKA 3FZFA 3CETA 1KXPA 3PIPL 3H1QA 1NGAA 3FR0A 2P9PB 4JK8A 3TSUA 4H0PA 4WQ5C 2Q97A 4B9QA 4C1NI 4EIAA 5M1NA 3RVCA 1Q7YO 1EO1A 3ZIGA 1YVNA 1K73O 4ILJA 3ZIHA 1QZ6A 4YOYA 4LC9B 1VQ8N 3VF2A 1WOQA 3AAPA 1NM1A 4NLBA 4M7YA 2Q0UA 4NB4A 5E26A 5AQWA 2LN3A 1K4PA 1S22A 2YHWA 3IKMA 3M5RA 5KQ8A 1ZC6A 1YJWN 2Q31A 3SAFA 3MK5A 4A2BA 2DPNA 1GLBG 1GLAG 4C1NK 4DHYA 2VCPA 1TUUA 1IEZA 4FCXA 5AQQA 5M1KA 2HBMA 3HBTA 3HRGA 3CC4N 5C0YA 3WEEB 3L4IA 3CXCM 5GINA 3P4IA 4IO9L 4BRKA 3ATUA 2EWSA 2E2QA 2P9UB 3W0LA 1VQ9N 3R6MA 2PAVA 4XH4A 2A6AA 1MDUB 2Q0RA 3O80A 4IWVA 4IXCA 3VGLA 4FWSA 3LL3A 3VEYA 2QWRA 4U67L 5C2FA 5AZIB 3O9TA 4BC2A 5DM6L 3C7NB 2NRTA 4A62A 3LQUA 4JAXA 4BR9A 2P9NA 3SBTA 4B1YB 3O5BA 2HF4A 2HBKA 1QZ5A 2NNWA 3QB0A 1LOTB 2ASMA 4CD1A 1YITN 1KK9A 3MDQA 3MGZA 5AQRA 5KPZA 3ZX0A 4O5FA 3ENOA 1VQON 4H0OA 4MDAA 2JWKA 1LCUA 1JCFA 3EKUA 4PHTX 3AGRA 3ZIEA 3KK7A 3M6GA 3W3DA 4BREA 3ZEUB 4B1VA 4EAHD 1D4XA 1NWKA 3K9JA 4DKWA 2W40A 1HKCA 1YJNN 3CD6N 3VF4A 3DAWA 2OTLN 4IJNA 4MO5A 3C6AA 3O8MA 2P9SA 1NGIA 3VGMA 3SAHA 3WXMB 4YOWA 3EE8A 3VGKA 4EHUA 1TUYA 1X3NA 4XH1A 1BA1A 2A40A 2CGLA 3AARA 3H1VX 3J8AA 3QMLA 2JWLA 4H03B 3GG4A 3EZWA 3CJ7A 3KWGA 4XEIA 1TYQB 3HM8A 3WXIA 3CCEN 1VQ7N 2HBLA 4BG9A 3AY9A 2WUSA 3E9PA 1KD1O 3LM9A 3CF5L 3DXMB 5F1XA 2YJFA 2YHYA 2A41A 2BTFA 2VYPA 3MX2A 1T3VA 5CE3A 1KC8O 2V7ZA 3CERA 3ENHA 2FXUA 1SNNA 2P9IA 4JD2B 5F0XA 2P9LA 4JKGA 4WQ4C 4PKGA 2QWOA 1YXQA 4HWIA 3EO3A 4RTFD 4P77A 1SQKA 2QXLA 2YCHA 3QBWA 2WFBA 2YX6A 1VQ6N 3TTCA 2GUPA 3P31A 3WQUA 4BRCA 4WFBL 1ATRA 3FGUA 4IOCL 3A5MC 3CPWM 3G4SN 5AQIA 5CHIA 1NMDA 3VEXA 4A2AA 3CPEA 3WT0A 3WXKA 5AQXA 3HTVA 3ZETB 3DJCA 3MN7A 5M1PA 1DGKN 3ULEA 4F9OA 4JKEA 1YI2N 3A8YA 4A5AA 2FSNA 1JCUA 1HPMA 2D0PA 5AFUA 3LDPA 1PVWA 4CZFA 1VQ4N 3J7ZO 4NZTM 4M63C 1DT9A 2ASOA 2NRRA 2WC9A 5AZJB 4FBWA 1JCGA 4JEPA 3R9PA 3VTIA 2E88A 3D2EB 4CJ7A 2QTDA 3EKSA 3O1BA 4H5WA 2F9TA 5FPNA 3TSQA 3CI5A 1XQSC 3UE5A 3L7VA 2D4WA 1U6ZA 2HMPA 3P38A 4B1WB 1VQKN 4FPAA 4IOXA 5H1SQ 1X3MA 4GV9A 3CIPA 4WCEL 5BPMA 1VQ5N 1BO5O 3LM2A 2QI2A 4C23A 3I56N 4E1BA 4O8UA 3G25A 2D0OA 3H45C 3TTDA 2NRWA 4H0YB 3VMFB 4J8FA 1ZXOA 3D2FA 5M1FA 3R3LA 4A5BA 4BR0A 3H07A 3I8BA 1HKBA 3H6EA 3MCAB 5JVHL 3LDOA 4CBXA 3ZX3A 3E9LA 5GAGP 4WFAL 3UKRA 3MN6A 5EY4A 4P6CA 3AGKA 3JXUA 3M1FA 5LJWA 4Z94A 4FWKA 3P04A 4FWRA 1BU6O 1K8KB 1K4IA 1Q82O 2NRXA 1PVYA 2QWMA 2E2NA 4H0XB 3G6EN 1TKUA 4FVUA 4FWMA 4AF1A 4UY8O 3WXLA 2W41A 4YOUA 4KH4A 2QWNA 1XUPO 2Q2RA 1P90A 3BF1A 4H0VB 4BGBA 2P9BA 3GL1A 4JKCA 3NVKA 1T6CA 1YF5L 1U2VA 3L4QA 2PBDA 3ATVA 1HJOA 2FSJA 3S41A 2KHOA 2I7NA 4JK7A 1G58A 4DB3A 2P9KA 3KHYA 4IOAL 4H5RA 3N4QA 3DXKB 4JHDA 2RHKA 3SMSA 4B1UB 3UKUA 1HUXA 2F7TA 3U8XA 2UYTA 4DQ8A 1KAXA 3CJ9A 2IVNA 4GVEA 5TKYA 2YJEA 5AQLA 3VEOA 4BRNA 4PL7A 4I6MA 4BRPA 3Q7BA 3O9UA 3ENBA 3TSPA 3AAQA 4IZ9A 2V7YA 4WYBA 1NGCA 3RSEA 4WQ5A 1NGHA 3VEZA 5AQNA 1K8AO 1S72N 3FZMA 5DM7L 5GIPA 1NGEA 1GLDG 1VQMN 1BG3A 1MWMA 3WUHA 1W2BM 5LY3A 3CJ1A 4QS7A 4CZGA 4DCHA 2YHXA 3GOIA 5HOOA 4BVPA 4OPAA 1VQNN 2I7PA 3GDQA 4FWOA 2FF3B 3DXMA 2IVPA 3O6WA 3CMAN 3CCJN 4BC4A 4B1XB 2CGJA 4L3QA 2ZGZA 4CZHA 3C0BA 3IUCA 1OVYA 3TTFA 3DWLA 4IEIA 3HI0A 3C65A 2CGKA 3LDNA 4ISGA 3L0QA 3MWPA 4HTLA 1KAZA 4JKHA 3UB5A 5C12A 1EQYA 4GNIA 4BRAA 5ELZA 4AM7A 4CZKA 1OKJA 2NRHA 3U9ZA 1JCEA 5AQYA 2RIUA 2QM1A 2A5XA 2P9NB 1ATNA 4ILGB 1GLCG 4BRFA 1BWFO 3SMPA 3SJHA 1BDGA 1G57A 1RDWX 3D6RA 3QDKA 5F2RA 3LS6A 2IVOA 4YOXA 3M3ZA 3O1WA 1M1KO 2GWJA 1K4LA 1CZAN 3MN5A 3IMXA 2ZGYA 3H3NO 5ADXA 4P8EA 4YDUC 4GY2B 2FLOA 3R1XA 4FWNA 5BREA 1KQSM 1GLEG 3T69A 1Q81O 2GWKA 2P9SB 1MWKA 1SZ2A 4FOIA 1NGJA 1YAGA 4BRMA 5EX5A 5AQUA 5BPNA 1E4GT 1YJ9N 5I9EB 3VERA 4P6PA 1QQNA 1NBWA 4BY9C 3ID8A 1J6ZA 1KAYA 5KPRA 1K4OA 4BGAA 5JLFA 2VGMA 5CR4A 5BR9A 1ATSA 5AQKA 3WXJA 3CJCA 2V52B 5GAEP 3E1YA 4CZJA 4M7XA 2PFUA 4A61A 4E1JA 4BQLA 1WUAA 5JMVA 1QVFM 2HSTA 3D7EO 2P9LB 2CH5A 4JKGB 3TPQA 4FPBA 4K41A 4HVZA 2Q36A 1T44A 1K7JA 4K25A 5AFUH 3CCQN 2P9PA 3SAGA 3H3OB 5B8HA 3EE9A 2HBJA 2EQAA 4H5NA 4IDHA 2AP1A 4FL9A 3CCLN 4R79A 5GAHP 3AJEA 4WQ4A 3GBTA 4KH6A 1Z05A 3SLCA 3HOSA 4JKAA 3SK3A 2IIRA 1IG8A 2FSKA 3KWIA 5AQOA 3ULEB 5C15A 4P8JA 3ZIIA 1N8RO 1RFQA 4BRIA 4GV6A 1IJJA 3VF6A 5AQJA 4FO0A 3ID6A 4H0TB 4BG8A 4BR7A 5FPDA 3WEEA 1HKGA 5BRHA 3OA9A 4CZMA 4YOVA 4B1ZA 4BC3A 3ZYYX 4FWPA 4JNEA 4BR4A 5AR0A 3I55N 4NLCA 3FLCO 3IFRA 2P9UA 1K9MO 2E1ZA 1NLVA 4BVOA 4BR2A 3MCPA 4WF9L 3CQYA 3OBYA 2FF6A 2NZTA 3C6HA 3VETA 3FFKB 5JVGL 2E1YA 4G9ZA 4IEEA 1SAZA 1V4TA 4AM6A 1C0FA 3PLAA 1Y64A 1S3XA 5AZIA 3U9DA 2ZJRL 5AQPA 3C7NA 4P6DA 3CQXA 3MN9A 4EFHA 3T7ZA 4CBWA 2RISA 5AQVA 2VGNA 5EOYA 4CZIA 1O13A 1VAZA 1XC3A 5FPMA 2BH1A 2KLAA 4YORA 1YUWA 3D2FB 3I33A 1GLJO 5GIOA 5BPLA 3A0IX 5M1OA 3Q7CA 5MLCQ 4U7BA 2NRZA 3NVMA 4RWTA 3HOTA 5KPTA 3EL2A 3FZLA 3CJAA 3KZBA 3TU5A 3ZEUA 3CHWA 3UKRB 2ASPA 2E2PA 3B8AX 4FWQA 3QFPA 2OTJN 2ZJQL 2ZWHA 2YI1A 1GLLO 3E9OA 4MLHA 4XH5A 4YOTA 3U4LA 1K49A 2KKZA 1BUPA 4BRDA 3CCVN 1DEJA 5EVZA 4CZLA 3BP8A 1P8ZA 4BROA 4FBQA 3CMEN 1MA9B 2QWQA 2WBNA 1TYQA 4ISFA 4CZEA 1RGIA 1HX1A 4H5TA 4ILHA 4JKFA 4KBOA 1SS6A 1U2VB 1X9JA 1W97L 3O9QA 2CH6A 1ILYA 4K43A 1HRUA 1Q18A 3VPZA 3VENA 4ISEA 3CC2N 2Q1NA 2E2OA 4JD2A 4IJAA 2E8AA 2QEXN 1E4FT 2P9KB 3MWTA 5BN9A 3L6QA 4JHDB 4BRHA 1QQMA 1G99A 4OPHA 2QA4N 2NRVA 3H46O 3WQTA 3VOVA 3UKUB 1V4SA 3F9MA 3QICA 4BQZA 5AQMA 1NGGA 2OANA 3QFUA 5KQDA 2ITMA 5LJVA 1NGDA 5M1QA 1Q86O 5BRFA 1NGBA 5JLHA 4I6MB 3OW2M 2AA4A 5BRDA 3BEXA 3NMUA 3ZX2A 3ZETA 2A42A 4PKHA 3RSEB 2MX1A 4EHTA 3EN9A 3FZHA 1NJIO 1HLUA 3A5NC 3JS6A 3P39A 4IFEA 4H5VA 4OO1J 2NLXA 2H3GX 4I14A 1C0GA 3MK6A 2HF3A 3OHRA 4FOEA 2GX9A 4MO4A 3LDQA 4BRGA 1XEZA 5AZJA 2J4RA 4FFJA 5AQHA 1VQPN 1JJ2M 1Z6RA 3D2EA 4GV3A 1ESVA 1VQLN 1R59O 5FPEA 4Y0WA 5HL7L 3CJBA 4K42A 3LRJA 1QHAA 5AQFA 3HZ6A 4BR5A 3F5TA 3HSCA 3N4PA 3FZKA 4JK9A 4CI6A 4BRLA 4YKEA 3T1IA 1GLFO 1T6DA 4FSVA 3MIOA 2ZF5O 3O9SA 4JKBA 4MDBA 3DLLL 5ADXH 3A5OC 4PKIA 2RE2A 1RDUA 3BUZB 4MLEA 3SBGA 3CC7N 2QW9A 2V51B 3LDLA 2P9IB 1H1VA 3KVGA 2ZJPL 3VESA 1TKSA 4PL8A 3R8EA 1M90O 3O4WA 5GADP 1ZBSA 2QWPA 4FBKA 3F2KA 4JKDA 2GTDA 3BF3A 3CCRN 3O9RA 1QVGM 4NZRM 4EO0A 4BRQA 3E66A 4A57A 3K9KA 3O08A 2QWLA 5AQZA 3CCSN 5BN8A 2F9WA 1BA0A 5C2DA 2E20A 4NO7A 5E84A 1K8KA 4IO8A 3VEVA 1DKGD 5C10A 1NGFA 5AQTA 4QS9A 4RCHA 5EXWA 1YHQN 3OBWA 4O8KA 5AQSA 3VTHA 4JN4A 3GE1A 1QQOA 2GELA 3G71N 4WFNL 4FWLA 2VWBA 2BUPA 4YDUA 4QS8A 3CCMN 3CCUN 3MX5A 4CD3A 2HOEA 3MMVA 2D1KA 4KH5A 4A59A 3IDHA 1YIJN 2GEMA 3VEWA 5JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TTC A;  3VEX A;  3TSP A;  3VES A;  3VEN A;  3TSU A;  3TTF A;  3VTH A;  3TTD A;  3VEO A;  3VER A;  3TSQ A;  3VEZ A;  3VEW A;  3VTI A;  3VF4 A;  3VF2 A;  3VET A; 
#chains in the Genus database with same CATH topology
 2A3Z A;  3QBX A;  1BOT O;  4DSF A;  4BC5 A;  1FKP A;  2YHA A;  4KRF A;  2Z1G A;  3DXK A;  5LMN K;  4RW4 A;  3PIP L;  3K0S A;  1C0T A;  1NGA A;  3T1H K;  4JK8 A;  3TSU A;  4H0P A;  3RVC A;  4LC9 B;  3QIN A;  4CHY A;  3ZSX A;  3CQ8 A;  2Q0U A;  2OZS A;  5AQW A;  2G8F A;  1K4P A;  3IKM A;  2F8T A;  4ELT A;  2Q31 A;  2DPN A;  2VCP A;  1IEZ A;  3THW A;  5C0Y A;  3HBT A;  3K58 A;  2EX3 A;  1HPZ A;  3L4I A;  3CXC M;  5GIN A;  1KFS A;  1CXU A;  5FDL A;  3RMA A;  3R6M A;  4XH4 A;  1BI4 B;  2OPS A;  3BZK A;  3OYG A;  3VGL A;  3SUQ A;  3PO5 A;  4DFM A;  3VEY A;  4DLG A;  3C7N B;  4A62 A;  3LQU A;  3P83 D;  4Z4C A;  2H9U A;  2O4I A;  4DF4 A;  2P9N A;  3SBT A;  4B1Y B;  1S6Q A;  2HBK A;  1QZ5 A;  2NNW A;  1KK9 A;  3MGZ A;  4LF6 K;  4O5F A;  3ENO A;  1VQO N;  4MDA A;  3KK7 A;  3W3D A;  4KO0 A;  3TAM A;  2A1R A;  1X9S A;  4KHS A;  4DKW A;  3CD6 N;  3VF4 A;  4IJN A;  2E6L A;  3C6A A;  4E1N A;  2P9S A;  3SAH A;  1CLQ A;  1BIU A;  3AO3 A;  3WXM B;  4YOW A;  3VGK A;  2NUB A;  1BA1 A;  4B9V A;  3J8A A;  2JWL A;  4X62 K;  1KTQ A;  3KWG A;  4XEI A;  1YTU A;  3V9Z A;  2WUS A;  3LVK B;  3DXM B;  3MX2 A;  2YNI A;  2V7Z A;  2FXU A;  4CJW A;  2GV9 A;  4RTF D;  2DY4 A;  2YCH A;  3QBW A;  2UUC K;  1TK5 A;  3TTC A;  4BRC A;  2HHX A;  1JDQ A;  1XC9 A;  4IDK A;  5AQI A;  1KLM A;  3EEQ A;  4A2A A;  3OYL A;  3CPE A;  4DV2 K;  1DGK N;  1TK0 A;  3A8Y A;  5FRM A;  3AVM A;  3LDP A;  4DU1 A;  4CZF A;  4NZT M;  4KB0 A;  4JEP A;  4OLA A;  3D2E B;  4LF7 K;  2D0C A;  2QTD A;  3EKS A;  1Z25 A;  2KZZ A;  3TSQ A;  3CI5 A;  1FJG K;  4B1W B;  2XY8 A;  5H1S Q;  1D8Y A;  3LM2 A;  2QI2 A;  4OVL A;  4C23 A;  1WSE A;  4ELV A;  3G25 A;  2NRW A;  4H0Y B;  3VMF B;  3LP1 A;  4DV6 K;  4O4G A;  3I0S A;  5J2P A;  5J1E A;  3D2F A;  1W9H A;  1IBK K;  4A5B A;  4BR0 A;  3ZX3 A;  2G8U A;  3OJS A;  3LP0 A;  3ZSR A;  4B9M A;  4PY5 A;  3MN6 A;  3CG7 A;  4P6C A;  3JXU A;  1T8E A;  4Z94 A;  3HJF A;  3O3H A;  4AH9 A;  4UY8 O;  2W41 A;  2Q3V A;  5HRP A;  4KH4 A;  2E4L A;  1WB9 A;  1P90 A;  3BF1 A;  2ITG A;  1BHL A;  1NU0 A;  4B8A B;  3GL1 A;  3TAF A;  3QIP A;  3V1R A;  4JKC A;  1T6C A;  1U2V A;  3L4Q A;  2PBD A;  4CE9 A;  4FXD A;  2KQ2 A;  2I7N A;  2W6K A;  1G58 A;  4BDP A;  3TWH A;  4H5R A;  2B4J A;  3MAQ A;  4KHY A;  3SMS A;  2RPI A;  3QET A;  1HUX A;  1VSD A;  3TOE A;  5HRO A;  2IVN A;  2YJE A;  3S3M A;  2BKY X;  4PL7 A;  4I6M A;  3K59 A;  1I94 K;  3O9U A;  3ENB A;  3K2P A;  2VG5 A;  4IZ9 A;  5AQN A;  4LF9 K;  4DF8 A;  5GIP A;  1W2B M;  5LY3 A;  4CIF A;  1O1W A;  4CZG A;  3DRP A;  3NF9 A;  1Q9Y A;  4LFC K;  1U04 A;  1RTJ A;  1WSF A;  1NJ8 A;  1C1C A;  2IVP A;  3EZ5 A;  3CMA N;  2Y1B A;  2CGJ A;  1XMO K;  3IAB B;  4CK2 A;  3C0B A;  3L0Q A;  4FZZ A;  1KAZ A;  4FJL A;  1SKS A;  1EQY A;  4GNI A;  4AM7 A;  4CEE A;  1QHT A;  2ZQB A;  4E7L A;  3V9U A;  2NRH A;  1JCE A;  3BY5 A;  1REV A;  2QM1 A;  1JLQ A;  1GLC G;  3SMP A;  1G57 A;  3QDK A;  4DS5 A;  3LS6 A;  3J7Y P;  3V4I A;  5C24 A;  3G0Z A;  2GWJ A;  1VR4 A;  1K4L A;  3U6F A;  3JSM A;  3H3N O;  4P8E A;  2FBY A;  4FWN A;  1GLE G;  1LW0 A;  2Z1J A;  2GWK A;  1MWK A;  1SZ2 A;  5CY4 A;  3PO4 A;  1E4G T;  5I9E B;  1NKE A;  3K5O A;  4DWI A;  1L3U A;  5JLF A;  4B3T K;  1ATS A;  5AQK A;  4DR4 K;  1ASU A;  4CZJ A;  1QVF M;  2PFU A;  4TSX A;  5JMV A;  3LP2 A;  1NJW A;  2CH5 A;  4FPB A;  4K41 A;  4DS4 A;  3AVN A;  1K6Y A;  3CCQ N;  1OH5 A;  3SAG A;  3HK2 A;  3MEC A;  3TAE A;  1VSH A;  1HRH A;  1NG9 A;  4IDH A;  5GAH P;  1Z05 A;  1RT4 A;  2X74 A;  3SK3 A;  1IG8 A;  3KWI A;  4IFY A;  2UXC K;  1N8R O;  2O8B A;  4BRI A;  4DQS A;  3VF6 A;  4GV6 A;  5LL6 Z;  3WEE A;  3OYC A;  5BRH A;  3KD1 E;  4Q15 A;  2UXD K;  4RG8 A;  3NHG A;  3I55 N;  2O8C B;  1K9M O;  2E1Z A;  1J5E K;  4BVO A;  2FF6 A;  2NZT A;  3FFK B;  1NMN A;  2G8H A;  3PSF A;  2OYQ A;  1C0F A;  3AVJ A;  5AZI A;  2HVH A;  3MN9 A;  1OVQ A;  4I2P A;  1TAU A;  4YFU A;  1NK5 A;  4CBW A;  4CZI A;  3VQQ A;  4F2S A;  3LPT A;  3I33 A;  1GLJ O;  5BPL A;  5M1O A;  5MLC Q;  2NRZ A;  3LP3 A;  5KPT A;  1H0X A;  1FKO A;  4M3Z A;  3CFP A;  3HPH A;  4DQQ A;  3UKR B;  4N5S A;  2A1S A;  1ZBH A;  4QCL A;  4KV8 A;  4JI4 K;  3HYF A;  4YOT A;  1K49 A;  2OPR A;  4BRD A;  3CCV N;  1DEJ A;  2VG7 A;  5EVZ A;  4Y1C A;  1B92 A;  4BRO A;  3OYN A;  2QWQ A;  1OH6 A;  4CZE A;  4CFA A;  1RGI A;  1HX1 A;  4ILH A;  4JKF A;  3QER A;  3BZC A;  1ILY A;  4K43 A;  1HRU A;  3HVR A;  2YNF A;  3IS9 A;  4IJA A;  3OS2 A;  3MWT A;  3L6Q A;  4JHD B;  1QQM A;  4OPH A;  2QA4 N;  2NRV A;  3UKU B;  3QIC A;  4BQZ A;  2OAN A;  3PX0 A;  1RBS A;  4DTU A;  1IG9 A;  4HUE A;  2F8S A;  3VQB A;  4F4K A;  1EWR A;  5SWM A;  3RSE B;  2MX1 A;  4MQ3 A;  1NJI O;  3MED A;  4RW8 A;  2PYL A;  4OO1 J;  1W0H A;  5AJ3 K;  3LDQ A;  1Z6R A;  4CIE A;  2PYJ A;  2YKN A;  2O8F A;  1JKH A;  3RWU A;  1KVB A;  4K42 A;  4DU3 A;  1SKR A;  4JV5 K;  3LRJ A;  3V6D A;  3JAM O;  4B8C A;  1RBR A;  3N4P A;  1RTH A;  2FBX A;  4CI6 A;  4BRL A;  4YKE A;  3KJV A;  2Y1J A;  2OZM A;  4MDB A;  5ADX H;  2Y1I A;  3SBG A;  3BUZ B;  2QW9 A;  2YV0 X;  3TAP A;  4OGC A;  1M90 O;  4M3X A;  1NFH A;  3F2K A;  4BRQ A;  4EO0 A;  3E66 A;  5AQZ A;  2VQF K;  5BN8 A;  1XNR K;  1RT5 A;  4FVM A;  4YHH K;  1K8K A;  3LAK A;  1DKG D;  1JL2 A;  1WAJ A;  5C10 A;  1NGF A;  5EXW A;  4KI4 A;  4KTZ A;  2BUP A;  4QS8 A;  3AVG A;  4GKK K;  3RR8 A;  3IDH A;  4EP4 A;  4CK1 A;  5AQG A;  3CET A;  1RQ8 A;  2P9P B;  4FJ8 A;  4WQ5 C;  4C1N I;  2ZD1 A;  1Q7Y O;  2HMI A;  1YVN A;  3VQ9 A;  1JLF A;  1QZ6 A;  3VF2 A;  4GKJ K;  4FW1 A;  5HRN A;  1HNI A;  4M7Y A;  3TAB A;  5E26 A;  2LN3 A;  3DOK A;  1S22 A;  1OH8 A;  1TKT A;  2HVI A;  1GLA G;  4GVM A;  4FLX A;  3ZT3 A;  3CYM A;  3SJJ A;  3IG1 A;  4IO9 L;  4BRK A;  3ATU A;  2P9U B;  3OS0 A;  1VQ9 N;  1UWB A;  4AHR A;  1WLJ A;  1LAV A;  1MDU B;  2Q0R A;  1UDV A;  4FWS A;  3LL3 A;  4BE2 A;  4E3S A;  3MEG A;  4U67 L;  3FFI A;  3O9T A;  4CJK A;  5DM6 L;  4QAG A;  4FJX A;  3SI6 A;  4BR9 A;  2F96 A;  3SQ1 A;  3O5B A;  3KD5 E;  4CD1 A;  2ASM A;  1N6Q A;  2HND A;  5KPZ A;  3VA0 A;  4H0O A;  4I9L A;  5FRO A;  1LCU A;  1VSK A;  1JCF A;  1XHX A;  3EKU A;  4CJR A;  3LZI A;  4KPY A;  4BRE A;  3ZEU B;  4EAH D;  3VA3 A;  1NWK A;  4WI1 A;  5FLX O;  3NE6 A;  3DAW A;  3LWL A;  3EE8 A;  3OYE A;  4EHU A;  4AHT A;  1TUY A;  1X3N A;  1TIG A;  4JI1 K;  3AAR A;  1D9F A;  4R5P A;  3CJ7 A;  4Z4F A;  1EXQ A;  2HBL A;  4FCY A;  1KD1 O;  3LM9 A;  5F1X A;  4IFV A;  3BDP A;  3NDK A;  2YJF A;  2A41 A;  4CER A;  1KC8 O;  1SNN A;  1WAF A;  5F0X A;  3DLB A;  2P9L A;  3T1A A;  2QWO A;  4ZTF A;  4FJG A;  1QSS A;  3PSI A;  1VQ6 N;  4LSN A;  4WFB L;  4DQI A;  3FGU A;  4IOC L;  4CES A;  3RTV A;  3VEX A;  5J2Q A;  3ZET B;  2ZE2 A;  3MN7 A;  4F9O A;  1U45 A;  4JKE A;  4A5A A;  3MXM A;  2P51 A;  3J7Z O;  2HHU A;  1DT9 A;  5JS2 A;  3AVL A;  2O8D B;  2E88 A;  2X6N A;  3SPZ A;  5HBM A;  3HST B;  3L7V A;  2D4W A;  1U6Z A;  3P38 A;  4B3M K;  4IOX A;  4GV9 A;  3RMB A;  4WCE L;  1VQ5 N;  1BO5 O;  3ZSO A;  3H45 C;  1ZXO A;  4ZTJ A;  3H07 A;  4X66 K;  1C0M A;  1HKB A;  1UAX A;  5JVH L;  3E9L A;  1HR0 K;  5SZT A;  1L3V A;  5EY4 A;  1QS4 A;  3AGK A;  3M1F A;  5LJW A;  3DLK A;  1Q82 O;  2E2N A;  3B6P A;  4FWM A;  4AF1 A;  4CF9 A;  4DLE A;  3T19 A;  1BI4 A;  3WXL A;  4O44 A;  4YOU A;  1T7P A;  3KLI A;  2Q2R A;  2DFF A;  3VQA A;  4CGG A;  5J2N A;  4LFA K;  2P9B A;  2VG6 A;  3K5L A;  1HJR A;  2HHV A;  3ATV A;  4CJS A;  1HJO A;  4FJN A;  3S41 A;  1L3T A;  4UQG A;  1KCF A;  4B9S A;  4DB3 A;  3KHY A;  3DXK B;  4NYF A;  4FLW A;  4B1U B;  4FJK A;  4IG3 A;  2F7T A;  4JYA K;  4DUY K;  4NXM K;  1TVR A;  5AQL A;  3VEO A;  4ID5 A;  4J2E A;  3C6U A;  3JYT A;  1JL1 A;  3Q7B A;  1FK9 A;  2V7Y A;  4WQ5 A;  3VEZ A;  1N36 K;  4CEO A;  3FZM A;  4JRQ A;  1NGE A;  1GLD G;  2HHW A;  3QES A;  3THW B;  1C0U A;  4O0I A;  3C94 A;  4DU4 A;  4DCH A;  4OLF A;  4CGI A;  5HOO A;  4OPA A;  3V81 A;  2I7P A;  2XY6 A;  1VQN N;  3GDQ A;  3AVB A;  3DXM A;  3HP9 A;  3O6W A;  3CCJ N;  4DUZ K;  3SUP A;  4L3Q A;  3NH2 A;  4FK0 A;  1LN4 A;  3C65 A;  4C8K A;  3LDN A;  3MWP A;  3NFA A;  3UB5 A;  4DR5 K;  5ELZ A;  3SQ0 A;  3AVK A;  3KK2 A;  1QSL A;  4DV4 K;  2A5X A;  2P9N B;  3VQC A;  4BWJ A;  1BWF O;  2IVO A;  3VN5 A;  3M3Z A;  1M1K O;  1D9D A;  1CZA N;  2W6L A;  3IMX A;  5ADX A;  2ZM6 K;  2FLO A;  4PWD A;  2P9S B;  4CFB A;  1TKZ A;  3PX6 A;  1LV5 A;  3ZLJ A;  4FLU A;  1HMV A;  2OCE A;  1KVC A;  4P6P A;  5KGW A;  3KK3 A;  3EY1 A;  1J6Z A;  1NKB A;  4B9L A;  1VRT A;  3ZSY A;  2WTU A;  1WSH A;  4DR6 K;  3VQD A;  3CJC A;  3E1Y A;  4E1J A;  4M7X A;  4A61 A;  4BQL A;  4RW6 A;  3KLF A;  3VQE A;  1Y9X A;  1QTM A;  1U47 A;  1S6P A;  5B8H A;  3EE9 A;  2HBJ A;  4PUO A;  2YKM A;  4CHN A;  3CCL N;  3AJE A;  4DQR A;  3GBT A;  2UU9 K;  1U4B A;  4K86 A;  2FSK A;  5AQO A;  4F8R A;  3I8D A;  4P8J A;  3ZII A;  1IJJ A;  4CHZ A;  4JI7 K;  1RT2 A;  3QKB A;  3TI0 A;  2YHB A;  3ID6 A;  4BR7 A;  3THX A;  1HKG A;  4KHQ A;  3ZYY X;  4FWP A;  4BR4 A;  1I3A A;  4NLC A;  3IFR A;  4FJ7 A;  4M3W A;  1RNH A;  1NLV A;  3CQY A;  3OBY A;  4DFK A;  3VET A;  4CEC A;  5CZ2 A;  3OYI A;  5JVG L;  4F3T A;  2E1Y A;  1SAZ A;  1V4T A;  3RRG A;  3ZSV A;  1BCO A;  1XWL A;  3V1O A;  4Q0B A;  4EFH A;  1BQN A;  5A2Q O;  3CFR A;  4HD0 A;  3T7Z A;  2VGN A;  5EOY A;  2QK9 A;  4OLB A;  1VAZ A;  4W5T A;  2QKK A;  2BH1 A;  1YUW A;  3D2F B;  3TAR A;  3I0R A;  3IRX A;  4U7B A;  3NVM A;  1BIZ A;  5DK5 A;  1A5V A;  2CRQ A;  3CJA A;  1XNQ K;  3OJU A;  4CGH A;  3ZT4 A;  3CHW A;  1WSG A;  3G10 A;  3U3G A;  3QFP A;  1XI1 A;  2ZJQ L;  2ZWH A;  2YI1 A;  1GLL O;  4XH5 A;  3U4L A;  1JLE A;  1BUP A;  4JI2 K;  4CEQ A;  3NF6 A;  3BP8 A;  4CF1 A;  1TYQ A;  4KTQ A;  3KK1 A;  4H5T A;  1S1V A;  4O5B A;  4KBO A;  4FJ5 A;  1U2V B;  1W97 L;  2CH6 A;  1N32 K;  3VEN A;  4ISE A;  2E2O A;  4JD2 A;  2E8A A;  1TK8 A;  4HVC A;  1CZ9 A;  1S1X A;  3H46 O;  3WQT A;  3VOV A;  3HO1 A;  3LVJ C;  5IWA K;  5LJV A;  1Q86 O;  1NGB A;  4KTW A;  5JLH A;  4I6M B;  3OW2 M;  4V19 S;  5BRD A;  3BEX A;  4LH5 A;  3NMU A;  1SUQ A;  4DV5 K;  2O8E A;  1J5O A;  4LF8 K;  4JI5 K;  3EN9 A;  3FZH A;  1HYV A;  3P39 A;  3LDS A;  4JI8 K;  4H5V A;  2NLX A;  3CM5 A;  1C0G A;  2G8I A;  4MO4 A;  1RBT A;  5AZJ A;  4F2R A;  4NCG A;  1JXE A;  5AQH A;  4M3T A;  4OPK A;  1W7A A;  4GV3 A;  1VQL N;  5FPE A;  3CJB A;  2B6A A;  1QHA A;  1IH7 A;  2IDO A;  3K5N A;  4FLZ A;  3WNG A;  3SYZ A;  1GOA A;  1RBU A;  3MIO A;  3P1G A;  4PKI A;  1VSM A;  2RE2 A;  4MLE A;  3LDL A;  2P9I B;  2ZJP L;  3LAN A;  4LF4 K;  3IAL A;  5GAD P;  3THY B;  4JKD A;  1E3M A;  1T03 A;  2UXB K;  3V1Q A;  3K9K A;  4QOZ B;  1DLO A;  2E20 A;  4NO7 A;  3LAM A;  3QEI A;  4DR3 K;  1DTQ A;  1YTA A;  4QS9 A;  3SV3 A;  5AQS A;  5LMU K;  3VTH A;  4JN4 A;  4LF5 K;  3G71 N;  3CCM N;  1NK4 A;  2D1K A;  5C42 A;  1KVA A;  2Q3S A;  4A59 A;  5FRN A;  2WON A;  5JIC A;  3IAY A;  3PIO L;  3A5L C;  2E5L K;  3FZF A;  4K8X A;  3H1Q A;  1SL1 A;  4CGD A;  1MU2 A;  2HHQ A;  3OYB A;  4NXN K;  2IAJ A;  3ZIG A;  3MEE A;  1K73 O;  1VQ8 N;  1NM1 A;  3WNF A;  1NJY A;  3ALY A;  4NB4 A;  1S1W A;  2HNZ A;  3M5R A;  4DSJ A;  1RT6 A;  1ZC6 A;  1YJW N;  3T3F A;  4DG1 A;  3MK5 A;  4A2B A;  3B6O A;  1TUU A;  5C25 A;  1ASV A;  5AQQ A;  5M1K A;  3WEE B;  2JLE A;  3L3V A;  5KTQ A;  3PV8 A;  1NJ2 A;  3W0L A;  3HPO A;  3OYM A;  4LFB K;  2A6A A;  3F9K A;  2W42 A;  3O80 A;  3V9W A;  4IXC A;  4AQY K;  4YY3 K;  2QWR A;  4M3U A;  5C2F A;  2A2Y A;  5AZI B;  4BC2 A;  4K8Z A;  1TV6 A;  3K5M A;  3LZJ A;  4FZY A;  2HF4 A;  3V9X A;  2VQE K;  2DFH A;  4CEF A;  1RIL A;  4KHN A;  3AGR A;  3M6G A;  4EZ6 A;  4B1V A;  4J2D A;  1D4X A;  3K9J A;  1YJN N;  2W40 A;  1KSP A;  2M71 A;  4E1M A;  3TAQ A;  3O8M A;  4FLT A;  3VGM A;  3AO5 A;  3ASM A;  1ZBU A;  2CGL A;  2A40 A;  3QML A;  4H03 B;  4RW9 A;  3OYD A;  3GG4 A;  1RT7 A;  1TKX A;  3AY9 A;  1EET A;  3E9P A;  3ZSQ A;  4IG0 A;  3CF5 L;  1NK9 A;  2YHY A;  2BTF A;  3J80 O;  5CE3 A;  3CER A;  4HUG A;  1JLG A;  4JKG A;  4PKG A;  4P77 A;  1JXB A;  1YXQ A;  3EO3 A;  4FK4 A;  2P5G A;  4FLY A;  1SQK A;  3SZ2 A;  4H4O A;  2WFB A;  2YX6 A;  2GUP A;  3HZ7 A;  2X6S A;  3CPW M;  4B3O A;  3G4S N;  3M8S A;  2QXF A;  1NMD A;  1DCJ A;  3WT0 A;  5AQX A;  3ULE A;  5M1P A;  4CGJ A;  1NNE A;  1YI2 N;  4TWA A;  4OPJ A;  1RTD A;  1LWC A;  3NGI A;  1HPM A;  4E7I A;  1PVW A;  1JLA A;  4CJF A;  2F4V K;  3ISN C;  3VQ8 A;  1VQ4 N;  3AVF A;  1C6V A;  2WC9 A;  2NRR A;  3D45 A;  1HYZ A;  4BE0 A;  1JCG A;  2EK0 A;  3TAN A;  3L2Q A;  4CJ7 A;  3AA2 A;  2O8F B;  3O1B A;  1SV5 A;  4H5W A;  4CJE A;  2HMP A;  2UUA K;  1VQK N;  2P1J A;  4FPA A;  5HLF A;  3QO9 A;  1NJ5 A;  1S9E A;  3L2V A;  1KRP A;  4JRP A;  3I56 N;  2D0O A;  4EP5 A;  1J54 A;  4J8F A;  2VWJ A;  1NK7 A;  4YNQ A;  3MCA B;  1EP4 A;  3LDO A;  3RMC A;  5GAG P;  4HCC A;  3NBP A;  1RT1 A;  4FWK A;  3P04 A;  4FWR A;  4FM1 A;  1BU6 O;  1K8K B;  2NRX A;  2QWM A;  3G6E N;  4DTP A;  1TKU A;  4I9Q A;  3SCX A;  2QWN A;  1XUP O;  4H0V B;  2IC3 A;  1WN7 A;  1HNW K;  4E7J A;  1JLB A;  1YT3 A;  4PA1 A;  3NVK A;  1YF5 L;  4FYD A;  1WBB A;  4JI3 K;  2FSJ A;  4GW6 A;  4Q5V A;  1IKX A;  2P9K A;  4IOA L;  3OTO K;  2GBZ A;  3N4Q A;  1WBD A;  2RHK A;  4ICL A;  2EHG A;  3U8X A;  2UYT A;  4DQ8 A;  1HQE A;  5KGX A;  4GVE A;  3V9S A;  3J81 O;  4BRN A;  3LWM A;  4BRP A;  3AAQ A;  1NGC A;  2KFN A;  1NGH A;  4BE1 A;  1S72 N;  5DM7 L;  1VQM N;  4HVJ A;  1MWM A;  3WUH A;  4QS7 A;  3VQ4 A;  2IOC A;  1II7 A;  1EX4 A;  2YHX A;  3GOI A;  3QIO A;  4BVP A;  4ZHR A;  4FWO A;  2FF3 B;  2D0A A;  3OY9 A;  5IT9 O;  4K88 A;  4BC4 A;  4B1X B;  1PAV A;  3MXI A;  4JLH A;  4CZH A;  3VQ5 A;  3DWL A;  3TTF A;  2HB5 A;  3HI0 A;  4FW2 A;  2CGK A;  4I2Q A;  4HTL A;  5C12 A;  3NF8 A;  4CEA A;  3AA5 X;  4CZK A;  2IS3 A;  5K14 A;  4DSI A;  5AQY A;  2RIU A;  2D5R A;  1ATN A;  4BRF A;  4CVN E;  1Y97 A;  1C1B A;  1BDG A;  1RDW X;  1H4T A;  3D6R A;  2AJQ A;  4BDZ A;  4BAC A;  3HPG A;  1CZB A;  4X64 K;  3H08 A;  4GY2 B;  2EH1 A;  4HTU A;  3R1X A;  4M41 A;  1KQS M;  4FOI A;  4BRM A;  1OH7 A;  2HHH K;  5EX5 A;  5AQU A;  4B3S K;  3VER A;  1QQN A;  1NBW A;  1XMQ K;  4BY9 C;  5KPR A;  3KTQ A;  4BGA A;  2VGM A;  5CR4 A;  1NJ6 A;  2KFZ A;  1UOC A;  4AHC A;  3WXJ A;  5GAE P;  4CEZ A;  2RN2 A;  1WUA A;  2IGI A;  2HST A;  3D7E O;  2P9L B;  1J53 A;  3TPQ A;  4HVZ A;  2Q36 A;  1T44 A;  1BCM A;  4K25 A;  5AFU H;  3OYA A;  3H3O B;  3WBM A;  1IKV A;  3HVT A;  2EQA A;  2AP1 A;  1TGO A;  4R79 A;  3QNN A;  4KKO A;  3SLC A;  3HOS A;  4JKA A;  1IO2 A;  1LW2 A;  5C15 A;  4JS5 A;  2E6M A;  4CCH A;  1EWQ A;  3SQ4 A;  1BIS A;  5FPD A;  2I5J A;  4OGE A;  4CZM A;  4B1Z A;  4BDY A;  5AR0 A;  3NH1 A;  2L8Y A;  3FLC O;  3NH0 A;  1HNV A;  4CJV A;  4WF9 L;  3F73 A;  3RMD A;  3SUN A;  2OPQ A;  3E01 A;  1HQU A;  3CM6 A;  5J2M A;  2FBT A;  1WNS A;  3THV A;  4YDQ A;  4G9Z A;  3WNH A;  1NK0 A;  3PLA A;  1S3X A;  3U9D A;  2ZJR L;  5AQP A;  3C7N A;  4P6D A;  3CQX A;  2RIS A;  2P5O A;  1O13 A;  5FPM A;  2KLA A;  1TAQ A;  1HC7 A;  2DFE A;  3RR7 A;  1IKY A;  3UIQ A;  3PX4 A;  2Z1I A;  3EL2 A;  1BQM A;  2WOM A;  2BAN A;  1NK8 A;  3ZT1 A;  4HCB A;  3KZB A;  5KI6 A;  3TU5 A;  4CEB A;  3S3N A;  4FK2 A;  2ASP A;  3MXJ A;  3B8A X;  2OTJ N;  1R0A A;  1NH9 A;  1UA1 A;  1TKD A;  3E9O A;  4MLH A;  2KTQ A;  4CJ4 A;  1H4Q A;  1YVU A;  4DSE A;  2KKZ A;  3SUO A;  3SNN A;  1MA9 B;  2GTC A;  2WBN A;  4B9U A;  4ISF A;  4CF8 A;  4DR1 K;  2XHB A;  4B3R K;  1X9J A;  3O9Q A;  4IKF A;  3VPZ A;  2Q1N A;  3NF7 A;  2QEX N;  1E4F T;  3ITH A;  1G99 A;  4JI0 K;  1V4S A;  4CJ3 A;  3F9M A;  1NGG A;  3QFU A;  5KQD A;  2ITM A;  2HHS A;  5M1Q A;  4FZX C;  1EKE A;  1LAW A;  3OYH A;  2AA4 A;  3QEW A;  4AHU A;  3AA3 A;  4DTJ A;  3ZX2 A;  3A2F A;  4CHO A;  3DRR A;  1HLU A;  3EYZ A;  3JS6 A;  1H4S A;  3ZT2 A;  4I14 A;  3MK6 A;  4JS4 A;  4FOE A;  1XEZ A;  4FFJ A;  2J4R A;  1DTT A;  1VQP N;  1JJ2 M;  4CHP A;  1QE1 A;  3D2E A;  1ESV A;  3DYA A;  1N5Y A;  4Y0W A;  5HL7 L;  5AQF A;  4W5O A;  3DMJ A;  3HZ6 A;  5DMR A;  4BR5 A;  3F5T A;  3HSC A;  4JK9 A;  1LWE A;  3T1I A;  1GLF O;  1T6D A;  4FSV A;  2ZF5 O;  3L2U A;  3P5J A;  3DLL L;  1SL2 A;  3A5O C;  3CC7 N;  4B9N A;  2V51 B;  2HW3 A;  3KVG A;  3VES A;  3PY8 A;  3SV4 A;  3O4W A;  4CGF A;  2QWP A;  1RDC A;  4FBK A;  3CCR N;  3O9R A;  4CHQ A;  3O08 A;  2ETJ A;  2F9W A;  4NCB A;  1S8E A;  2B5J A;  4IO8 A;  3VEV A;  3QEX A;  4KAZ A;  1KLN A;  1BGX T;  5AQT A;  4DFP A;  1YHQ N;  4FJI A;  3GE1 A;  2GEL A;  4CJU A;  5JS1 A;  3HM9 A;  3CCU N;  3ZCM A;  4DV0 K;  4AM6 A;  3ZSZ A;  1YIJ N;  4CBU A;  3FE1 A;  5TKW A;  4E7K A;  1QSY A;  1KXP A;  1NOZ A;  3FR0 A;  3QLH A;  2Q97 A;  4B9Q A;  4EIA A;  5M1N A;  3AA4 A;  4B08 A;  1EO1 A;  4AHV A;  3OYF A;  4ILJ A;  3ZIH A;  1VSL A;  4YOY A;  1WOQ A;  3AAP A;  4LD0 A;  4ID1 A;  4NLB A;  4OKE A;  2YHW A;  3CFO A;  5KQ8 A;  1X9W A;  1NFJ A;  3ZT0 A;  3QEP A;  4NCA A;  1HNX K;  2OPP A;  3DOL A;  3DLG A;  3SAF A;  1GLB G;  4C1N K;  4DHY A;  4FCX A;  4LH4 A;  2HBM A;  3HRG A;  3CC4 N;  4Z4I A;  3THX B;  4C8O A;  4H8K A;  3P4I A;  4FJM A;  1NOY A;  3DRS A;  2EWS A;  2E2Q A;  3AVA A;  4BWM A;  3VQ7 A;  3HXM A;  2PAV A;  3NAE A;  3IAB A;  4CW7 B;  1FW6 A;  4IWV A;  2XY5 A;  4G1Q A;  1BL3 A;  4E19 A;  2NRT A;  3BGR A;  5HRS A;  4JAX A;  4DTO A;  4AHS A;  1HYS A;  3QB0 A;  1YIT N;  1LOT B;  3MDQ A;  5AQR A;  1S9G A;  3ZX0 A;  2KZM A;  2JWK A;  4X65 K;  4Z4G A;  4PHT X;  1U49 A;  3ZIE A;  3M8R A;  1HKC A;  5BR8 K;  2OTL N;  4MO5 A;  2UUB K;  1NGI A;  3ULD A;  5KRS A;  4CF0 A;  4XH1 A;  4CIG A;  4CK3 A;  3H1V X;  2IFE A;  3EZW A;  3WXI A;  1S5J A;  3CCE N;  1TYQ B;  3HM8 A;  2OA8 A;  5CYQ A;  1VQ7 N;  4BG9 A;  4FJJ A;  1H0Y A;  1L3S A;  3L2W A;  4HUF A;  4C8M A;  2VYP A;  1T3V A;  4Z0U A;  3ENH A;  4E7H A;  2P9I A;  3HL8 A;  4JD2 B;  4W5R A;  4WQ4 C;  4HWI A;  4Z9E A;  2QXL A;  5KRT A;  3THY A;  3P31 A;  3WQU A;  1ATR A;  4C8L A;  3A5M C;  4ELU A;  4M3Y A;  5CHI A;  2O8E B;  3WXK A;  1RTI A;  3HTV A;  3DJC A;  3SPY A;  2PZS A;  3KLE A;  1VSF A;  5T7B A;  4FM0 A;  1WSI A;  2FSN A;  1JCU A;  2D0P A;  3J7A P;  5AFU A;  3AO4 A;  1JE3 A;  4M63 C;  1TL3 A;  5AZJ B;  2ASO A;  3T1Y K;  5CYM A;  4FBW A;  2O8C A;  3R9P A;  1ASW A;  3VTI A;  3VQ6 A;  1N34 K;  2F9T A;  5FPN A;  1ZYQ A;  1Y2I A;  4W5Q A;  1XQS C;  4CJP A;  2XY7 A;  3UE5 A;  4CED A;  3NGZ A;  2HHT A;  1VK0 A;  1X3M A;  3CIP A;  5BPM A;  4FM2 A;  3HT3 A;  5EU7 A;  4E1B A;  4O8U A;  3NCI A;  3TTD A;  4EZ9 A;  1L5U A;  1G15 A;  1RDB A;  4DTS A;  3DLR A;  5M1F A;  3R3L A;  3OVN A;  3I8B A;  3H6E A;  5HRR A;  4N41 A;  4CBX A;  4M3R A;  1J9A A;  3DM2 A;  4WFA L;  3UKR A;  3RRH A;  4OKJ A;  2R7Y A;  1K4I A;  1NKC A;  1PVY A;  4H0X B;  4FVU A;  2O8B B;  4KFB A;  4BGB A;  4CJ5 A;  4CF2 A;  3QEV A;  3LPU A;  2O4G A;  2KHO A;  5E41 A;  3QNO A;  4JK7 A;  4JHD A;  3L8B A;  4LY7 A;  4CFC A;  4OKK A;  3TR8 A;  3UKU A;  1FXX A;  1KAX A;  3CJ9 A;  5TKY A;  4N56 A;  4KB1 A;  4AIL C;  4RW7 A;  3TSP A;  4WYB A;  3RSE A;  1K8A O;  4W5N A;  4OJR A;  4DSK A;  1BG3 A;  4Z4E A;  3CJ1 A;  4CJL A;  3DSC A;  4DV1 K;  2DTU A;  2G8V A;  3AVC A;  4DV7 K;  2BGG A;  3KLG A;  3ZSW A;  2ZGZ A;  2X78 A;  3IUC A;  3VQP A;  1OVY A;  1Z26 A;  4CJQ A;  4IEI A;  1RT3 A;  4ISG A;  4JKH A;  1I39 A;  4BRA A;  1ZBF A;  1OKJ A;  3U9Z A;  3OYJ A;  3D0P A;  4M42 A;  1C1A A;  2JGU A;  1N33 K;  2FC0 A;  4H4M A;  1A5W A;  2XRI A;  4KHW A;  4ILG B;  1X1P A;  2XO7 A;  4JI6 K;  3SJH A;  5F2R A;  4YOX A;  3C6T A;  4K0K K;  3O1W A;  1HNZ K;  4LSL A;  3MN5 A;  2ZGY A;  4YDU C;  4DR7 K;  2FBV A;  4E0D A;  2HNY A;  5BRE A;  4KRE A;  4CJT A;  3T69 A;  1RCH A;  1Q81 O;  2ATQ A;  1Q9X A;  1NGJ A;  1Q8I A;  1YAG A;  5BPN A;  4DTR A;  1UA0 A;  4F3O A;  1YJ9 N;  5HP1 A;  1GOB A;  4J2A A;  3ID8 A;  3U6Y A;  1KAY A;  1U48 A;  1K4O A;  5BR9 A;  3AVI A;  1B9F A;  3AV9 A;  2V52 B;  3L3U A;  1T05 A;  4JKG B;  1VSJ A;  1NJX A;  1NK6 A;  1K7J A;  3TAG A;  2P9P A;  4Z4H A;  1LWF A;  1XHZ A;  2G8K A;  1VSI A;  4H5N A;  4FL9 A;  4WQ4 A;  1IBM K;  4OX9 K;  4KH6 A;  2GUI A;  3PUF A;  3L2R A;  4DV3 K;  4FJH A;  2IIR A;  3ULE B;  4Y1D A;  1RFQ A;  1IBL K;  3M8P A;  5AQJ A;  4DTM A;  4FO0 A;  4BG8 A;  4H0T B;  5D3G A;  4YOV A;  3OA9 A;  4BC3 A;  1TL1 A;  4JNE A;  4GMJ B;  3KLH A;  4DTX A;  2BE2 A;  1F21 A;  2P9U A;  4FJ9 A;  4BR2 A;  3MCP A;  4L8R B;  2YNG A;  1VSE A;  3C6H A;  3SQ2 A;  3O3G A;  3NGY A;  4IEE A;  4KHU A;  1Y64 A;  4E89 A;  5AQV A;  1RDA A;  4NCX A;  4DMN A;  2RF2 A;  1XC3 A;  4YOR A;  1ZBI A;  4C8N A;  5GIO A;  3A0I X;  3Q7C A;  1ZBL A;  4RWT A;  3HOT A;  1KFD A;  2Z7C A;  3FZL A;  1RDD A;  3WNE A;  3ZEU A;  4DTN A;  2E2P A;  2YNH A;  4K87 A;  4FWQ A;  4J2B A;  2G8W A;  1VM0 A;  1D5A A;  1SKW A;  4IBN A;  3S3O A;  4CZL A;  1CXQ A;  1P8Z A;  4FBQ A;  3CME N;  3AO2 A;  4DFJ A;  1X9M A;  1S1U A;  2LSN A;  4CFD A;  2BDP A;  1SS6 A;  3AVH A;  3O4N A;  1QQC A;  1Q18 A;  4DSL A;  3CC2 N;  2P9K B;  5BN9 A;  4DR2 K;  4BRH A;  4B9T A;  1JLC A;  1IKW A;  4PQU A;  3OYK A;  5AQM A;  5I42 A;  1NGD A;  5BRF A;  1B9D A;  3O3F A;  4NYN A;  4DQP A;  3DSD A;  3AO1 A;  4XIU A;  3ZET A;  1A5X A;  2A42 A;  4PKH A;  4N47 A;  4EHT A;  1ITG A;  2PY5 A;  3A5N C;  4IFE A;  3U3Y A;  1VRU A;  2H3G X;  4FLV A;  2LXR A;  2HF3 A;  3OHR A;  4BRG A;  2GX9 A;  3O4Q A;  3M8Q A;  2O8D A;  1WSJ A;  1JO0 A;  4KHP K;  4KI6 A;  1R59 O;  3DI6 A;  3LAL A;  1NJ1 A;  3KKR A;  3FZK A;  1IV0 A;  3DLH A;  2VWK A;  3O9S A;  4JKB A;  1GOC A;  1RDU A;  4O55 A;  3DLE A;  1H1V A;  3KKS A;  3OS1 A;  2RKI A;  1TKS A;  4PL8 A;  3R8E A;  2QKB A;  1ZBS A;  1S1T A;  4MFB A;  3KIO A;  2GTD A;  3BF3 A;  1QVG M;  4NZR M;  2KW4 A;  4A57 A;  2QWL A;  3C95 A;  2Z1H A;  3CCS N;  1BA0 A;  5C2D A;  5E84 A;  1NJZ A;  4WE1 A;  3S9H A;  3HP6 A;  3K57 A;  1VHX A;  5I3U A;  4RCH A;  3OBW A;  4O8K A;  1QQO A;  4WFN L;  4FWL A;  2VWB A;  4YDU A;  4M45 A;  3MX5 A;  4O0J A;  4CD3 A;  2HOE A;  3MMV A;  5CZ1 A;  2D0B A;  4N76 A;  4HHT A;  4KH5 A;  1RBV A;  1SL0 A;  2GEM A;  4I7F A;  3VEW A; 
#chains in the Genus database with same CATH homology
 4CBU A;  2A3Z A;  5AQG A;  3QBX A;  1BOT O;  3FE1 A;  5TKW A;  3A5L C;  4BC5 A;  3PIO L;  3DXK A;  3FZF A;  3CET A;  1KXP A;  3PIP L;  3H1Q A;  1NGA A;  3FR0 A;  2P9P B;  4JK8 A;  3TSU A;  4H0P A;  4WQ5 C;  2Q97 A;  4B9Q A;  4C1N I;  4EIA A;  5M1N A;  3RVC A;  1Q7Y O;  1EO1 A;  3ZIG A;  1YVN A;  1K73 O;  4ILJ A;  3ZIH A;  1QZ6 A;  4YOY A;  4LC9 B;  1VQ8 N;  3VF2 A;  1WOQ A;  3AAP A;  1NM1 A;  4NLB A;  4M7Y A;  2Q0U A;  4NB4 A;  5E26 A;  5AQW A;  2LN3 A;  1K4P A;  1S22 A;  2YHW A;  3IKM A;  3M5R A;  5KQ8 A;  1ZC6 A;  1YJW N;  2Q31 A;  3SAF A;  3MK5 A;  4A2B A;  2DPN A;  1GLB G;  1GLA G;  4C1N K;  4DHY A;  2VCP A;  1TUU A;  1IEZ A;  4FCX A;  5AQQ A;  5M1K A;  2HBM A;  3HBT A;  3HRG A;  3CC4 N;  5C0Y A;  3WEE B;  3L4I A;  3CXC M;  5GIN A;  3P4I A;  4IO9 L;  4BRK A;  3ATU A;  2EWS A;  2E2Q A;  2P9U B;  3W0L A;  1VQ9 N;  3R6M A;  2PAV A;  4XH4 A;  2A6A A;  1MDU B;  2Q0R A;  3O80 A;  4IWV A;  4IXC A;  3VGL A;  4FWS A;  3LL3 A;  3VEY A;  2QWR A;  4U67 L;  5C2F A;  5AZI B;  3O9T A;  4BC2 A;  5DM6 L;  3C7N B;  2NRT A;  4A62 A;  3LQU A;  4JAX A;  4BR9 A;  2P9N A;  3SBT A;  4B1Y B;  3O5B A;  2HF4 A;  2HBK A;  1QZ5 A;  2NNW A;  3QB0 A;  1LOT B;  2ASM A;  4CD1 A;  1YIT N;  1KK9 A;  3MDQ A;  3MGZ A;  5AQR A;  5KPZ A;  3ZX0 A;  4O5F A;  3ENO A;  1VQO N;  4H0O A;  4MDA A;  2JWK A;  1LCU A;  1JCF A;  3EKU A;  4PHT X;  3AGR A;  3ZIE A;  3KK7 A;  3M6G A;  3W3D A;  4BRE A;  3ZEU B;  4B1V A;  4EAH D;  1D4X A;  1NWK A;  3K9J A;  4DKW A;  2W40 A;  1HKC A;  1YJN N;  3CD6 N;  3VF4 A;  3DAW A;  2OTL N;  4IJN A;  4MO5 A;  3C6A A;  3O8M A;  2P9S A;  1NGI A;  3VGM A;  3SAH A;  3WXM B;  4YOW A;  3EE8 A;  3VGK A;  4EHU A;  1TUY A;  1X3N A;  4XH1 A;  1BA1 A;  2A40 A;  2CGL A;  3AAR A;  3H1V X;  3J8A A;  3QML A;  2JWL A;  4H03 B;  3GG4 A;  3EZW A;  3CJ7 A;  3KWG A;  4XEI A;  1TYQ B;  3HM8 A;  3WXI A;  3CCE N;  1VQ7 N;  2HBL A;  4BG9 A;  3AY9 A;  2WUS A;  3E9P A;  1KD1 O;  3LM9 A;  3CF5 L;  3DXM B;  5F1X A;  2YJF A;  2YHY A;  2A41 A;  2BTF A;  2VYP A;  3MX2 A;  1T3V A;  5CE3 A;  1KC8 O;  2V7Z A;  3CER A;  3ENH A;  2FXU A;  1SNN A;  2P9I A;  4JD2 B;  5F0X A;  2P9L A;  4JKG A;  4WQ4 C;  4PKG A;  2QWO A;  1YXQ A;  4HWI A;  3EO3 A;  4RTF D;  4P77 A;  1SQK A;  2QXL A;  2YCH A;  3QBW A;  2WFB A;  2YX6 A;  1VQ6 N;  3TTC A;  2GUP A;  3P31 A;  3WQU A;  4BRC A;  4WFB L;  1ATR A;  3FGU A;  4IOC L;  3A5M C;  3CPW M;  3G4S N;  5AQI A;  5CHI A;  1NMD A;  3VEX A;  4A2A A;  3CPE A;  3WT0 A;  3WXK A;  5AQX A;  3HTV A;  3ZET B;  3DJC A;  3MN7 A;  5M1P A;  1DGK N;  3ULE A;  4F9O A;  4JKE A;  1YI2 N;  3A8Y A;  4A5A A;  2FSN A;  1JCU A;  1HPM A;  2D0P A;  5AFU A;  3LDP A;  1PVW A;  4CZF A;  1VQ4 N;  3J7Z O;  4NZT M;  4M63 C;  1DT9 A;  2ASO A;  2NRR A;  2WC9 A;  5AZJ B;  4FBW A;  1JCG A;  4JEP A;  3R9P A;  3VTI A;  2E88 A;  3D2E B;  4CJ7 A;  2QTD A;  3EKS A;  3O1B A;  4H5W A;  2F9T A;  5FPN A;  3TSQ A;  3CI5 A;  1XQS C;  3UE5 A;  3L7V A;  2D4W A;  1U6Z A;  2HMP A;  3P38 A;  4B1W B;  1VQK N;  4FPA A;  4IOX A;  5H1S Q;  1X3M A;  4GV9 A;  3CIP A;  4WCE L;  5BPM A;  1VQ5 N;  1BO5 O;  3LM2 A;  2QI2 A;  4C23 A;  3I56 N;  4E1B A;  4O8U A;  3G25 A;  2D0O A;  3H45 C;  3TTD A;  2NRW A;  4H0Y B;  3VMF B;  4J8F A;  1ZXO A;  3D2F A;  5M1F A;  3R3L A;  4A5B A;  4BR0 A;  3H07 A;  3I8B A;  1HKB A;  3H6E A;  3MCA B;  5JVH L;  3LDO A;  4CBX A;  3ZX3 A;  3E9L A;  5GAG P;  4WFA L;  3UKR A;  3MN6 A;  5EY4 A;  4P6C A;  3AGK A;  3JXU A;  3M1F A;  5LJW A;  4Z94 A;  4FWK A;  3P04 A;  4FWR A;  1BU6 O;  1K8K B;  1K4I A;  1Q82 O;  2NRX A;  1PVY A;  2QWM A;  2E2N A;  4H0X B;  3G6E N;  1TKU A;  4FVU A;  4FWM A;  4AF1 A;  4UY8 O;  3WXL A;  2W41 A;  4YOU A;  4KH4 A;  2QWN A;  1XUP O;  2Q2R A;  1P90 A;  3BF1 A;  4H0V B;  4BGB A;  2P9B A;  3GL1 A;  4JKC A;  3NVK A;  1T6C A;  1YF5 L;  1U2V A;  3L4Q A;  2PBD A;  3ATV A;  1HJO A;  2FSJ A;  3S41 A;  2KHO A;  2I7N A;  4JK7 A;  1G58 A;  4DB3 A;  2P9K A;  3KHY A;  4IOA L;  4H5R A;  3N4Q A;  3DXK B;  4JHD A;  2RHK A;  3SMS A;  4B1U B;  3UKU A;  1HUX A;  2F7T A;  3U8X A;  2UYT A;  4DQ8 A;  1KAX A;  3CJ9 A;  2IVN A;  4GVE A;  5TKY A;  2YJE A;  5AQL A;  3VEO A;  4BRN A;  4PL7 A;  4I6M A;  4BRP A;  3Q7B A;  3O9U A;  3ENB A;  3TSP A;  3AAQ A;  4IZ9 A;  2V7Y A;  4WYB A;  1NGC A;  3RSE A;  4WQ5 A;  1NGH A;  3VEZ A;  5AQN A;  1K8A O;  1S72 N;  3FZM A;  5DM7 L;  5GIP A;  1NGE A;  1GLD G;  1VQM N;  1BG3 A;  1MWM A;  3WUH A;  1W2B M;  5LY3 A;  3CJ1 A;  4QS7 A;  4CZG A;  4DCH A;  2YHX A;  3GOI A;  5HOO A;  4BVP A;  4OPA A;  1VQN N;  2I7P A;  3GDQ A;  4FWO A;  2FF3 B;  3DXM A;  2IVP A;  3O6W A;  3CMA N;  3CCJ N;  4BC4 A;  4B1X B;  2CGJ A;  4L3Q A;  2ZGZ A;  4CZH A;  3C0B A;  3IUC A;  1OVY A;  3TTF A;  3DWL A;  4IEI A;  3HI0 A;  3C65 A;  2CGK A;  3LDN A;  4ISG A;  3L0Q A;  3MWP A;  4HTL A;  1KAZ A;  4JKH A;  3UB5 A;  5C12 A;  1EQY A;  4GNI A;  4BRA A;  5ELZ A;  4AM7 A;  4CZK A;  1OKJ A;  2NRH A;  3U9Z A;  1JCE A;  5AQY A;  2RIU A;  2QM1 A;  2A5X A;  2P9N B;  1ATN A;  4ILG B;  1GLC G;  4BRF A;  1BWF O;  3SMP A;  3SJH A;  1BDG A;  1G57 A;  1RDW X;  3D6R A;  3QDK A;  5F2R A;  3LS6 A;  2IVO A;  4YOX A;  3M3Z A;  3O1W A;  1M1K O;  2GWJ A;  1K4L A;  1CZA N;  3MN5 A;  3IMX A;  2ZGY A;  3H3N O;  5ADX A;  4P8E A;  4YDU C;  4GY2 B;  2FLO A;  3R1X A;  4FWN A;  5BRE A;  1KQS M;  1GLE G;  3T69 A;  1Q81 O;  2GWK A;  2P9S B;  1MWK A;  1SZ2 A;  4FOI A;  1NGJ A;  1YAG A;  4BRM A;  5EX5 A;  5AQU A;  5BPN A;  1E4G T;  1YJ9 N;  5I9E B;  3VER A;  4P6P A;  1QQN A;  1NBW A;  4BY9 C;  3ID8 A;  1J6Z A;  1KAY A;  5KPR A;  1K4O A;  4BGA A;  5JLF A;  2VGM A;  5CR4 A;  5BR9 A;  1ATS A;  5AQK A;  3WXJ A;  3CJC A;  2V52 B;  5GAE P;  3E1Y A;  4CZJ A;  4M7X A;  2PFU A;  4A61 A;  4E1J A;  4BQL A;  1WUA A;  5JMV A;  1QVF M;  2HST A;  3D7E O;  2P9L B;  2CH5 A;  4JKG B;  3TPQ A;  4FPB A;  4K41 A;  4HVZ A;  2Q36 A;  1T44 A;  1K7J A;  4K25 A;  5AFU H;  3CCQ N;  2P9P A;  3SAG A;  3H3O B;  5B8H A;  3EE9 A;  2HBJ A;  2EQA A;  4H5N A;  4IDH A;  2AP1 A;  4FL9 A;  3CCL N;  4R79 A;  5GAH P;  3AJE A;  4WQ4 A;  3GBT A;  4KH6 A;  1Z05 A;  3SLC A;  3HOS A;  4JKA A;  3SK3 A;  2IIR A;  1IG8 A;  2FSK A;  3KWI A;  5AQO A;  3ULE B;  5C15 A;  4P8J A;  3ZII A;  1N8R O;  1RFQ A;  4BRI A;  4GV6 A;  1IJJ A;  3VF6 A;  5AQJ A;  4FO0 A;  3ID6 A;  4H0T B;  4BG8 A;  4BR7 A;  5FPD A;  3WEE A;  1HKG A;  5BRH A;  3OA9 A;  4CZM A;  4YOV A;  4B1Z A;  4BC3 A;  3ZYY X;  4FWP A;  4JNE A;  4BR4 A;  5AR0 A;  3I55 N;  4NLC A;  3FLC O;  3IFR A;  2P9U A;  1K9M O;  2E1Z A;  1NLV A;  4BVO A;  4BR2 A;  3MCP A;  4WF9 L;  3CQY A;  3OBY A;  2FF6 A;  2NZT A;  3C6H A;  3VET A;  3FFK B;  5JVG L;  2E1Y A;  4G9Z A;  4IEE A;  1SAZ A;  1V4T A;  4AM6 A;  1C0F A;  3PLA A;  1Y64 A;  1S3X A;  5AZI A;  3U9D A;  2ZJR L;  5AQP A;  3C7N A;  4P6D A;  3CQX A;  3MN9 A;  4EFH A;  3T7Z A;  4CBW A;  2RIS A;  5AQV A;  2VGN A;  5EOY A;  4CZI A;  1O13 A;  1VAZ A;  1XC3 A;  5FPM A;  2BH1 A;  2KLA A;  4YOR A;  1YUW A;  3D2F B;  3I33 A;  1GLJ O;  5GIO A;  5BPL A;  3A0I X;  5M1O A;  3Q7C A;  5MLC Q;  4U7B A;  2NRZ A;  3NVM A;  4RWT A;  3HOT A;  5KPT A;  3EL2 A;  3FZL A;  3CJA A;  3KZB A;  3TU5 A;  3ZEU A;  3CHW A;  3UKR B;  2ASP A;  2E2P A;  3B8A X;  4FWQ A;  3QFP A;  2OTJ N;  2ZJQ L;  2ZWH A;  2YI1 A;  1GLL O;  3E9O A;  4MLH A;  4XH5 A;  4YOT A;  3U4L A;  1K49 A;  2KKZ A;  1BUP A;  4BRD A;  3CCV N;  1DEJ A;  5EVZ A;  4CZL A;  3BP8 A;  1P8Z A;  4BRO A;  4FBQ A;  3CME N;  1MA9 B;  2QWQ A;  2WBN A;  1TYQ A;  4ISF A;  4CZE A;  1RGI A;  1HX1 A;  4H5T A;  4ILH A;  4JKF A;  4KBO A;  1SS6 A;  1U2V B;  1X9J A;  1W97 L;  3O9Q A;  2CH6 A;  1ILY A;  4K43 A;  1HRU A;  1Q18 A;  3VPZ A;  3VEN A;  4ISE A;  3CC2 N;  2Q1N A;  2E2O A;  4JD2 A;  4IJA A;  2E8A A;  2QEX N;  1E4F T;  2P9K B;  3MWT A;  5BN9 A;  3L6Q A;  4JHD B;  4BRH A;  1QQM A;  1G99 A;  4OPH A;  2QA4 N;  2NRV A;  3H46 O;  3WQT A;  3VOV A;  3UKU B;  1V4S A;  3F9M A;  3QIC A;  4BQZ A;  5AQM A;  1NGG A;  2OAN A;  3QFU A;  5KQD A;  2ITM A;  5LJV A;  1NGD A;  5M1Q A;  1Q86 O;  5BRF A;  1NGB A;  5JLH A;  4I6M B;  3OW2 M;  2AA4 A;  5BRD A;  3BEX A;  3NMU A;  3ZX2 A;  3ZET A;  2A42 A;  4PKH A;  3RSE B;  2MX1 A;  4EHT A;  3EN9 A;  3FZH A;  1NJI O;  1HLU A;  3A5N C;  3JS6 A;  3P39 A;  4IFE A;  4H5V A;  4OO1 J;  2NLX A;  2H3G X;  4I14 A;  1C0G A;  3MK6 A;  2HF3 A;  3OHR A;  4FOE A;  2GX9 A;  4MO4 A;  3LDQ A;  4BRG A;  1XEZ A;  5AZJ A;  2J4R A;  4FFJ A;  5AQH A;  1VQP N;  1JJ2 M;  1Z6R A;  3D2E A;  4GV3 A;  1ESV A;  1VQL N;  1R59 O;  5FPE A;  4Y0W A;  5HL7 L;  3CJB A;  4K42 A;  3LRJ A;  1QHA A;  5AQF A;  3HZ6 A;  4BR5 A;  3F5T A;  3HSC A;  3N4P A;  3FZK A;  4JK9 A;  4CI6 A;  4BRL A;  4YKE A;  3T1I A;  1GLF O;  1T6D A;  4FSV A;  3MIO A;  2ZF5 O;  3O9S A;  4JKB A;  4MDB A;  3DLL L;  5ADX H;  3A5O C;  4PKI A;  2RE2 A;  1RDU A;  3BUZ B;  4MLE A;  3SBG A;  3CC7 N;  2QW9 A;  2V51 B;  3LDL A;  2P9I B;  1H1V A;  3KVG A;  2ZJP L;  3VES A;  1TKS A;  4PL8 A;  3R8E A;  1M90 O;  3O4W A;  5GAD P;  1ZBS A;  2QWP A;  4FBK A;  3F2K A;  4JKD A;  2GTD A;  3BF3 A;  3CCR N;  3O9R A;  1QVG M;  4NZR M;  4EO0 A;  4BRQ A;  3E66 A;  4A57 A;  3K9K A;  3O08 A;  2QWL A;  5AQZ A;  3CCS N;  5BN8 A;  2F9W A;  1BA0 A;  5C2D A;  2E20 A;  4NO7 A;  5E84 A;  1K8K A;  4IO8 A;  3VEV A;  1DKG D;  5C10 A;  1NGF A;  5AQT A;  4QS9 A;  4RCH A;  5EXW A;  1YHQ N;  3OBW A;  4O8K A;  5AQS A;  3VTH A;  4JN4 A;  3GE1 A;  1QQO A;  2GEL A;  3G71 N;  4WFN L;  4FWL A;  2VWB A;  2BUP A;  4YDU A;  4QS8 A;  3CCM N;  3CCU N;  3MX5 A;  4CD3 A;  2HOE A;  3MMV A;  2D1K A;  4KH5 A;  4A59 A;  3IDH A;  1YIJ N;  2GEM A;  3VEW A;  5JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...