3TTCA

Crystal structure of e. coli hypf with adp and carbamoyl phosphate
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords Transcriptional regulatory protein
total genus 215
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttcA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttcA01
3TSQA 3TSUA 3TTFA 3VTHA 3VEZA 3VEWA 3VESA 3VEXA 3VENA 3TTCA 3TTDA 3VTIA 3VERA 3TSPA 3VETA 3VF4A 3VEOA 3VF2A
chains in the Genus database with same CATH superfamily
1NJ5A 4JAXA 4BR2A 3TTDA 3VERA 5IWAK 2E5LK 2OPRA 3DI6A 1HMVA 5GAEP 1HX1A 4YOVA 5KPZA 2DFEA 3PUFA 1KXPA 1XC9A 2WOMA 3CJ9A 1BGXT 3EKSA 1BU6O 1N32K 1RQ8A 4DQ8A 2IIRA 3U3GA 4M42A 3TTCA 3OYLA 1C0GA 1YT3A 1S3XA 1NKEA 1NOYA 1WAFA 4N41A 1RT4A 3SBTA 4F3OA 2IGIA 4H4OA 3GOIA 1RT6A 3THYA 4HCCA 4BC2A 1Q86O 4KPYA 4H4MA 3RMAA 5C10A 1BL3A 4AH9A 3P04A 4KB0A 3OYEA 4C8OA 3CCQN 1BISA 1TYQB 5AQVA 1BI4B 4W5RA 1K4PA 1OVYA 3LDLA 4FWLA 1ASVA 4NXMK 3CD6N 3UE5A 4DV0K 2UXDK 3CQXA 3G4SN 3HM8A 4BQZA 3NFAA 4ID5A 4A61A 1K8AO 4BRLA 4CJKA 3CJAA 4H5VA 3HPGA 1W2BM 2QKKA 2QWQA 4YY3K 2W6LA 4CZFA 2V51B 1RT1A 2Q0UA 1ZBHA 2R7YA 3F5TA 3C6AA 4DSEA 2ZF5O 1LCUA 1VSKA 4FW2A 4CJWA 4PQUA 3MK5A 2YX6A 4PUOA 3H6EA 3CCSN 3D6RA 2NRRA 4RW9A 3CFPA 1U2VA 4DR1K 2O8CA 4FXDA 2PYLA 3CPEA 4I6MA 2ZE2A 4H5WA 3V9SA 1KC8O 3VEVA 3KD1E 3JXUA 3AO3A 3O4QA 4M7YA 3IALA 1QSLA 1CXQA 3VQ8A 1Q82O 3NVKA 2VWBA 2OZMA 4BDZA 3RR7A 1S22A 3LZJA 4CZJA 4CHNA 1XC3A 2KZMA 2KLAA 1BOTO 4JYAK 4H5TA 3G6EN 3CCMN 1H4TA 3F2KA 3KK1A 4LF7K 3DLEA 1KLNA 1RDWX 2P9IA 4KI4A 3L4QA 3O3HA 3LANA 4A5BA 2YI1A 1JO0A 2BANA 4IO9L 3O9UA 1SZ2A 3AA4A 2QEXN 3DLHA 4B3TK 3A8YA 1YAGA 4CGDA 3ENBA 3CCVN 3S3NA 2HF4A 4BGBA 3OYJA 5BN9A 2OTLN 1IEZA 2Y1IA 1CZAN 3FR0A 4QAGA 4GKJK 4CEOA 5DK5A 4Z4CA 4DF8A 3OYCA 3WNEA 2OTJN 1TAQA 5GINA 2GTCA 1ZYQA 2YHXA 1BHLA 1BA1A 3RR8A 3AVGA 4CIGA 3DLGA 4OLBA 2P9IB 1EP4A 3VEOA 3IABA 5GIPA 3OBWA 3Q7BA 4E7IA 4DQQA 3THWB 1SKWA 1JDQA 5LJVA 3RSEA 3V9WA 1L3UA 4Z0UA 1IKYA 4HUGA 2P9SB 4JKCA 1G99A 3N4QA 1B9FA 2FSNA 4BDPA 3BGRA 3P4IA 1LV5A 4CEFA 3DAWA 5C12A 3NDKA 4FJ5A 1HKGA 4CJ7A 1OH7A 4P77A 2ASOA 2D0OA 4P6CA 4CESA 4B9SA 3M8RA 3S3MA 3ZSVA 1X1PA 3QFUA 1RT2A 1NM1A 1TIGA 4ZHRA 1XMOK 4B3SK 1QVFM 4KREA 2G8UA 2A40A 1BO5O 3WT0A 4CHQA 3ZLJA 5I9EB 1X9WA 4HD0A 4PL8A 4FK0A 1XHZA 1NGHA 4CJ3A 1TKUA 4NB4A 4JKBA 4CK2A 5CHIA 1CZBA 1IG9A 1MDUB 4KHSA 4CI6A 1O13A 3ULEA 1QVGM 4C8LA 4CEZA 3MN7A 5ADXA 3LVJC 3TR8A 4CERA 1S72N 3BDPA 2NRHA 5M1OA 1ILYA 4FM2A 3O8MA 2PAVA 5AQZA 5BPMA 3RMBA 3ZX3A 4FJHA 1RT7A 4AILC 4DSLA 4MDBA 1TYQA 2JLEA 1JCEA 3ISNC 1X9JA 4FJKA 3HSCA 3TAGA 4JD2B 1YXQA 3CFRA 3CF5L 4FJ7A 4DU3A 5AQMA 3MN5A 1GOAA 4CVNE 4DLGA 4CJ4A 1RBRA 2A41A 3L3UA 3FZHA 4FBKA 2WBNA 4HHTA 3HI0A 2VWJA 1ZBLA 4KHYA 2HHTA 4RW4A 1R0AA 1SAZA 5J2MA 3S9HA 4M7XA 4CHOA 1B92A 4DU4A 1SL1A 3OYNA 2RF2A 4K0KK 4CGHA 4JN4A 4OPAA 3BY5A 3A5LC 2HHVA 5GIOA 4FPAA 3IG1A 4LF6K 3IKMA 2ETJA 4A59A 1RT3A 4CBWA 2GBZA 3E66A 4LD0A 4DTSA 3CXCM 3NF8A 1NGFA 1X3MA 1RNHA 3T7ZA 3ID8A 1WSHA 4FL9A 4JLHA 2OPPA 2IS3A 3KIOA 4W5QA 2XO7A 4LSLA 2HNYA 1SL0A 1NG9A 3DOKA 3QLHA 4HUEA 3NVMA 1NGDA 2HMIA 2Q31A 1NGCA 4B8AB 1DKGD 4O5BA 3QEPA 3SPYA 3OS2A 2A42A 2IC3A 4K43A 1TGOA 1K8KA 4IFVA 3QBWA 1VQKN 1KAYA 1NJXA 4Q15A 4PWDA 2XY7A 2NUBA 2KFZA 3KWIA 1RTDA 3AO1A 2AP1A 2FXUA 1KVBA 1KQSM 1T6CA 1Q18A 3C7NB 3MDQA 4AHCA 3P83D 3T3FA 4AQYK 4P6PA 4DTMA 4KBOA 4I2QA 3HJFA 1GOBA 2O8EA 3CM6A 2HF3A 3VF6A 1ESVA 1KAZA 3JS6A 1UOCA 2FBTA 3TSQA 2RISA 3M8SA 4BRIA 5JVHL 3KD5E 4KKOA 1JXBA 3AVIA 1RTIA 5AQRA 2W42A 3L0QA 3FE1A 2EX3A 3CJBA 3V1RA 4RW8A 2FBVA 4K88A 2EHGA 4JI8K 3AGKA 4Z9EA 5I3UA 3VQDA 5FPMA 1HC7A 2PFUA 1YVNA 2O4GA 1HQUA 5JICA 3MCPA 4BE1A 1B9DA 3TSUA 4DR6K 4A2AA 3A0IX 4JI2K 4LF5K 3VPZA 2NLXA 3WEEA 1BCOA 4W5NA 1TK8A 1PVWA 3CHWA 1GLEG 4DTJA 4YDUC 4B1VA 4FW1A 4J2DA 4DCHA 3ZT3A 4EZ6A 3SQ4A 2CH5A 2LXRA 3QDKA 1JL1A 4PL7A 3ATVA 1HYSA 3WBMA 4CGGA 1WBDA 1S1WA 4JRQA 4WI1A 1QE1A 1NGEA 3QB0A 2PZSA 3SAFA 3SYZA 1S9EA 1MA9B 1WSGA 3T1YK 4EIAA 1XI1A 3DLBA 4BRPA 1YTAA 4JS5A 1E4FT 3HSTB 3AJEA 5LL6Z 4WF9L 2HBJA 2VCPA 1TKXA 1GLDG 2KKZA 3G0ZA 3VA3A 3M8QA 2UUCK 1TUYA 4KAZA 4LFBK 4BRDA 4CJUA 5AJ3K 3RRGA 4CFDA 1HNIA 1NGBA 3DM2A 4E7KA 4M41A 3IMXA 2KHOA 5KPRA 1PAVA 1K73O 2HVIA 1LWFA 1YJNN 1WNSA 2F9TA 5AQOA 1UDVA 3O9QA 5KGWA 4BG9A 3MXMA 3DJCA 4H0VB 3LP2A 5J2PA 3J7ZO 1N8RO 5JLHA 5M1FA 3PO5A 4FJXA 5AZJA 4CIFA 1JLFA 3HP9A 4EFHA 2PY5A 4FM1A 4J8FA 3KVGA 5C25A 4E89A 4DTUA 1K7JA 4EHUA 4DV4K 1K8KB 1HRUA 1RGIA 4I9LA 1N36K 4CEAA 3MWPA 3I8DA 3LWLA 1K4LA 2O8BA 4K8ZA 2GWJA 3L8BA 3SBGA 5C42A 3TAFA 5C2DA 4DUZK 4JK9A 4FJLA 1Z05A 2YHWA 4CJRA 4CF9A 5SWMA 2VQEK 1WAJA 3DXMB 2XY6A 1C1AA 1SL2A 3NGZA 1LAVA 4CJLA 4DTPA 1ZXOA 3RVCA 3I33A 4K41A 3UKUB 4NO7A 3ZYYX 4B1XB 4BRGA 4NXNK 1BIUA 4CHZA 3HXMA 3DRPA 2GEMA 4L8RB 4CFCA 3JAMO 4Q5VA 3PIPL 1I39A 2O8DB 4B1WB 5TKYA 1ITGA 1BQNA 3HL8A 2I7NA 5BRHA 1NLVA 3TOEA 3ZSOA 3OVNA 4FLYA 5AQJA 3HOSA 4YKEA 1WBBA 4B1UB 1QS4A 1U6ZA 4DFPA 2G8VA 2ASPA 3B6PA 3U6FA 1Q9XA 3QINA 4IO8A 1RTJA 3A5MC 1VM0A 4M3XA 5DMRA 3HVTA 4IOAL 5TKWA 3KK2A 3QKBA 4JD2A 1JLEA 3L4IA 3LALA 4RG8A 4BACA 4BG8A 1JL2A 2NRZA 4IKFA 4CGFA 1IH7A 3SQ0A 1KD1O 1VQLN 5MLCQ 4FZZA 3ENOA 4H5RA 4B9MA 4ELTA 4OPKA 1TKDA 2QWRA 1HNZK 1FKOA 2BGGA 1Z25A 2E2QA 4FSVA 3KLFA 3SUOA 3SUNA 3H45C 3HP6A 4BE0A 3L7VA 3CC2N 5AQTA 3R3LA 4NCBA 3CG7A 3DLKA 3KLGA 1TAUA 3M1FA 2Y1JA 3K5LA 3VQEA 1S1VA 1DCJA 3MX2A 5EY4A 3O9TA 3EE8A 2VG5A 2BH1A 3N4PA 3I8BA 4DG1A 2OPSA 4BC5A 4FJ9A 3LP3A 2G8IA 4LF8K 4JHDA 1NK7A 4FJNA 3J80O 4DR7K 3OW2M 1T8EA 1JXEA 3I0SA 1U4BA 4JHDB 3WNFA 5KRSA 3G71N 1HLUA 1YHQN 4M3TA 3VOVA 2Q3VA 2YCHA 3PV8A 3DSDA 4LH4A 2QWNA 4AM7A 3T1IA 4WFAL 4GVEA 4JKGB 2YNFA 4HCBA 2F8SA 2E2PA 4CZIA 3ALYA 3QETA 4DTNA 4MO4A 1T3VA 4RW6A 4E1JA 5HL7L 2IDOA 2FSJA 3OYBA 1XWLA 3RSEB 2V7ZA 3U9ZA 4M3RA 4F8RA 2P9NA 3QO9A 1WSJA 2HBKA 3AY9A 3B8AX 3UKRB 1YJ9N 2KQ2A 3J7AP 1Q7YO 1NJ1A 3ID6A 3IABB 4FJ8A 1VSFA 2CGKA 3DRRA 1C0UA 1REVA 4KHUA 5BREA 4NZRM 4B9LA 4YORA 1KVAA 3V4IA 2ZJRL 4CECA 2OCEA 2QI2A 4W5TA 2A6AA 3R6MA 2E20A 4E19A 5KGXA 4CD1A 3O3GA 2FLOA 3ATUA 1VQNN 3LPUA 1VHXA 4N76A 4O8KA 3THYB 3KLHA 2HHUA 3HVRA 4CIEA 3THXB 4IEEA 1YVUA 3IS9A 3QEXA 4DSJA 4ELVA 1YTUA 3IAYA 3W3DA 1MWKA 3T69A 1IO2A 1NJ8A 4OGEA 4G9ZA 2YV0X 1JLAA 1TV6A 2XHBA 1YJWN 1EO1A 3KTQA 4OLAA 2ZJPL 3RMCA 3D0PA 3U9DA 4HVJA 2KZZA 3DSCA 3MAQA 1J53A 2RE2A 1YUWA 3OJUA 2DTUA 3DXKA 4Z4GA 4CD3A 3MK6A 4OO1J 3BZKA 4I6MB 5KQDA 2O8BB 1XMQK 1JLQA 4FCXA 1G58A 3QBXA 1NJWA 4CJ5A 3PIOL 3PSIA 3C6HA 1RTHA 3R9PA 4N47A 1GLBG 3FZLA 4Y0WA 1VR4A 4B9UA 3ZSWA 2NNWA 3HM9A 5AZJB 3C95A 4RTFD 5FRNA 3VENA 3LP1A 4GY2B 4M3UA 2YHBA 5B8HA 5F1XA 4ILJA 4AHVA 5HRRA 3MEGA 2OYQA 4FK2A 1RBVA 4W5OA 3NH1A 4BRKA 4DQRA 1QQOA 5J1EA 3NH0A 4DQSA 1S1UA 4FZYA 3OTOK 4NZTM 2FSKA 4UQGA 5AQWA 3C94A 4BR7A 3NAEA 5AFUH 4BROA 3VGMA 1U49A 4MLHA 4ZTJA 1GLLO 3K5OA 4EZ9A 1MWMA 4A2BA 4BREA 2P9PA 3QNOA 4JNEA 2X6NA 4HWIA 3V9UA 3FZFA 3WQTA 1WSFA 1VQ7N 2CGLA 4BR9A 4CJSA 1NGAA 3M6GA 2F4VK 1S1TA 4KRFA 1P8ZA 2X74A 1KTQA 4BVPA 3BF3A 4EO0A 3J81O 2HVHA 2EQAA 1NGIA 4FWNA 3AO4A 2P5GA 4DTRA 4KHNA 3OYHA 2EWSA 2IVOA 5HROA 5BPNA 4Z4IA 2A2YA 1ATNA 1GOCA 4FZXC 2HHHK 3TI0A 3TAQA 3HZ6A 4DV1K 4E1BA 1IKXA 4WFNL 3I55N 4ILGB 1R59O 3AO2A 4OVLA 2ZM6K 4OKEA 3SI6A 3MIOA 1S1XA 3MEDA 4KFBA 2UUAK 1NGGA 4K42A 4FO0A 3CIPA 4PKHA 4AHTA 5M1PA 3A2FA 1OH6A 4CEDA 2RKIA 3ZIIA 2E6LA 2YJFA 4FBQA 3EZWA 4KTWA 2G8WA 4FLTA 5CR4A 4YOUA 1GLAG 4DKWA 4IG3A 3HYFA 3DOLA 2I5JA 2D1KA 2Q2RA 1HYZA 3CJ7A 4DR2K 4V19S 3K58A 4BRQA 3C7NA 4IDHA 4FLUA 3I56N 1SNNA 1C1CA 4QS8A 4LFAK 5CE3A 5J2NA 1LW0A 4YNQA 3KJVA 3CMEN 5F0XA 4B9QA 1D9FA 3ITHA 3M5RA 4CE9A 2NRWA 2OZSA 3SZ2A 3A5OC 3V1OA 4F2RA 4CEBA 1LW2A 1RCHA 3ZIHA 3ZT0A 5E41A 2QWPA 5AQYA 2W6KA 1XEZA 5AQIA 1QQCA 3L2UA 4BR0A 4H5NA 4C8NA 1KLMA 3P1GA 2VWKA 5HRPA 2HBLA 4TSXA 5C2FA 3VEYA 4TWAA 3F73A 3QESA 1SUQA 4Z4HA 4DSFA 5DM6L 4CFAA 2JWKA 5AQKA 2L8YA 2PBDA 4KTQA 4ICLA 4CJQA 2E1ZA 3AVNA 3ZSRA 2UU9K 4QOZB 2IOCA 3O08A 4DV6K 3Q7CA 2HNDA 1RBTA 5KQ8A 3O80A 3O1BA 4FLXA 4X64K 4DSIA 3C65A 4A62A 5AQLA 3HOTA 3NH2A 1SKRA 3AA5X 1U47A 1QZ5A 1RFQA 5LMUK 3EE9A 1HNVA 1HRHA 3VQQA 4YOWA 4CHPA 2V52B 3U8XA 1K4OA 4P8EA 3O3FA 1WSEA 4OPHA 2W40A 1NK4A 4E7HA 3ZX0A 3OYIA 3OYFA 3EZ5A 3H1QA 4QS7A 4F2SA 2HNZA 3H3NO 1J5OA 1H1VA 1ATRA 3CJ1A 4IWVA 3ASMA 3BF1A 3SK3A 4YFUA 1NKBA 5E26A 3VQ4A 1K49A 2WONA 4KV8A 1NMDA 2A5XA 1OH5A 4M3ZA 1QQMA 1NFHA 4IJAA 4JV5K 1NJ2A 3D2EA 5EXWA 1VRTA 3ZIEA 5FPEA 2NRXA 3MX5A 3F9KA 4PY5A 2UXBK 3TAPA 2GELA 3L3VA 4JI4K 3AVHA 1JKHA 5K14A 2Q3SA 2P1JA 2Z1IA 1TK5A 3J7YP 4GV6A 1K9MO 4BVOA 1UAXA 1IBLK 3DRSA 4O0JA 4FCYA 1IBKK 3H46O 1J5EK 4NCXA 3MN6A 5BRDA 3MXIA 1JE3A 1HKCA 1EWQA 3WNHA 4CF0A 1K4IA 4DFJA 3U3YA 3TTFA 3VQ7A 2HBMA 4U7BA 1L3VA 3E9LA 5CZ2A 4FJMA 3VN5A 1TVRA 1Q8IA 2B4JA 4RCHA 1TKSA 3KK3A 4C8MA 4CF2A 1N5YA 3CJCA 3LZIA 4CJTA 1PVYA 1SV5A 5KI6A 1VK0A 4DUYK 1NOZA 1RDDA 1X3NA 3OYGA 2P5OA 4HTUA 1EKEA 1NGJA 3AVLA 1HPMA 1FJGK 3V9XA 1JCGA 3CPWM 4CZLA 1VQ6N 1NK6A 3OA9A 3QERA 2NRTA 1MU2A 3CQ8A 4JRPA 2P9SA 1C0FA 3R1XA 3SMPA 4DF4A 1QSYA 2QKBA 4CEEA 1BIZA 1BG3A 3E01A 3LPTA 4O4GA 3O9SA 3HPOA 1TKTA 3AVMA 4F9OA 2Z1GA 3O6WA 3NCIA 4Z4EA 2QWOA 1BA0A 2Z7CA 1KK9A 1HYVA 4R5PA 4I14A 3OBYA 2O8FA 4M63C 4BQLA 4BRNA 3DMJA 2BUPA 3KK7A 4B9NA 3ZCMA 2XY5A 3CERA 3NMUA 3SAHA 3HT3A 1OH8A 5AR0A 4FJGA 4E7LA 2QWMA 4BGAA 1K6YA 4C1NK 4CHYA 3ZT4A 2YNGA 1XQSC 1JCFA 2RIUA 3OS1A 3L2VA 3NF7A 3IUCA 4CW7B 3AVFA 3P39A 2Q97A 3LRJA 2BDPA 4J2BA 5AQXA 4BWMA 4GVMA 4JK8A 3TWHA 1T05A 1FXXA 2O8DA 2PYJA 3GG4A 4O55A 2CRQA 4IOCL 2AJQA 4ELUA 2HHQA 3IDHA 3AAPA 2I7PA 4O0IA 3IFRA 3V9ZA 3AV9A 3AVCA 4KO0A 4FFJA 3QMLA 4FLZA 2HHWA 2VQFK 3KZBA 3E9PA 4JKEA 4JKGA 4EAHD 3NF6A 4E1NA 1NWKA 4FK4A 1JCUA 5C15A 2O4IA 3VTIA 2O8CB 4CZHA 2E88A 4WYBA 3WXJA 3VGKA 4YHHK 4E7JA 4B1YB 3AVJA 2W41A 2Z1JA 5FPDA 1VQMN 5BR9A 2DFHA 2EK0A 2Y1BA 4EP5A 4FLVA 4AHSA 3D2FB 4B3OA 5KPTA 4AM6A 4CZEA 1BQMA 5CZ1A 2IFEA 3JSMA 1EXQA 5AQUA 3TAMA 1J6ZA 4FOIA 4BDYA 1IJJA 4P6DA 1LN4A 2QWLA 3R8EA 5EVZA 3TPQA 3NE6A 5EOYA 4JK7A 3K57A 2HHXA 1GLJO 2GV9A 4G1QA 3JYTA 2XY8A 4BC3A 1HQEA 3NF9A 2X78A 2P51A 2ATQA 2B5JA 4CZKA 4JI7K 3M3ZA 1OVQA 4XEIA 4NYNA 5HOOA 3P31A 3TU5A 2RN2A 1RDBA 3G10A 4YOXA 2X6SA 1IBMK 4H0YB 2QXLA 1EX4A 2ZD1A 2A3ZA 4L3QA 3KKRA 1QTMA 1FW6A 1S6PA 3IRXA 3LDOA 4B8CA 4UY8O 3WXIA 1VQON 1LWCA 5E84A 2YNIA 4KB1A 4RWTA 4BRFA 5M1NA 1YF5L 4IFYA 1N33K 2D5RA 4HTLA 5BPLA 1Q81O 2E1YA 3NGIA 2KW4A 1II7A 4ILHA 1RBUA 4FJJA 3ULDA 4DV2K 2ASMA 4XH4A 3BUZB 2OANA 1X9MA 3C0BA 4IZ9A 1WOQA 3SUQA 5BRFA 4K87A 4BE2A 4FYDA 3HO1A 2BKYX 1ASWA 3EN9A 4MDAA 5LY3A 4JI3K 3QFPA 3HRGA 4IG0A 2ITMA 2H3GX 2GUIA 3BP8A 4ISFA 3VQBA 3UKUA 3GBTA 4A5AA 5HRSA 3TARA 1WN7A 1S8EA 3SV3A 1VQ4N 3H08A 5F2RA 3E9OA 4LSNA 4MO5A 4WQ4A 3L2WA 1TKZA 3ZSQA 3WEEB 3SUPA 3ZX2A 2F8TA 4KTZA 2E2NA 4CZMA 3PSFA 4DFKA 4CJEA 2MX1A 2D4WA 3P5JA 2KFNA 4WE1A 1Y2IA 3VMFB 3MMVA 2VYPA 1E3MA 2E6MA 1Y97A 3TABA 1NJIO 3LM9A 4FWSA 2BE2A 4YDUA 5HRNA 1M90O 2E4LA 4O5FA 3SAGA 1NBWA 4DR4K 1RT5A 2P9KA 3CCEN 4H8KA 5JVGL 1SQKA 1KCFA 3MGZA 3L2QA 3PX6A 4KH6A 4GW6A 4O44A 3CFOA 3AGRA 1EETA 3AARA 1NU0A 1RBSA 2ZQBA 1ZBSA 4LC9B 1NKCA 5JMVA 3D7EO 4IJNA 3WQUA 2B6AA 4XH5A 4JI1K 3ZSYA 3B6OA 3DLRA 4FPBA 3QIOA 1O1WA 1QQNA 4K25A 1IG8A 2FBXA 2P9KB 4CF1A 1JLGA 1D4XA 1VSJA 4BR4A 1A5VA 1VAZA 5KRTA 5EU7A 4AHUA 5AZIB 2VG7A 4FOEA 3VQPA 4E3SA 1VSEA 2M71A 3EL2A 3V81A 2ZJQL 2QK9A 3BEXA 3OS0A 5H1SQ 3LVKB 2F96A 1IKWA 4K86A 4F3TA 1N34K 4C1NI 3ZSXA 3VQCA 4PKGA 4JI6K 5FDLA 3NGYA 1OKJA 1VSIA 2Q0RA 3DWLA 4A57A 4X66K 1CZ9A 3OYAA 4OLFA 3KLEA 4JKDA 3QICA 1CXUA 3CM5A 4H03B 4MQ3A 4CGJA 1NH9A 1Q9YA 4H0OA 3T19A 3T1HK 2D0CA 4DS4A 4IBNA 3A5NC 4N56A 4PKIA 1HR0K 3VEWA 2P9PB 3CCRN 4DV3K 4HVZA 2LN3A 1CLQA 4M3YA 5ELZA 3LDPA 4JEPA 1DEJA 3T1AA 1DLOA 1W7AA 2FBYA 5JS2A 1JJ2M 3ZT1A 3SQ2A 4WCEL 3QEWA 3ZEUB 3AAQA 4FM0A 4IOXA 4U67L 3FFIA 4DWIA 2O8EB 1UA0A 4FVMA 3VEZA 4DFMA 1WUAA 2D0BA 2DPNA 1F21A 2DFFA 3OY9A 2VGNA 4E0DA 5CYMA 3SNNA 4KH5A 1KFDA 1NFJA 1G15A 1FK9A 5KTQA 3G25A 4EHTA 3FZMA 2XRIA 3ZIGA 3OYDA 1JLCA 1SS6A 3CI5A 4M3WA 1U45A 1VSLA 1RDCA 4C23A 2HOEA 2LSNA 3DLLL 4KHPK 1S5JA 1TL1A 4OPJA 3K59A 5A2QO 2ITGA 4DSKA 3GL1A 3DXKB 1HUXA 1VSHA 3D2FA 3QEIA 3VTHA 2G8HA 4HVCA 4I9QA 4DTXA 5AQQA 3O4NA 2P9UA 4CCHA 2Q36A 1L5UA 3K2PA 3HZ7A 3TAEA 1W9HA 2D0AA 2P9BA 2WTUA 3WUHA 2YHAA 4HUFA 2E8AA 4OX9K 3ZETB 2EH1A 3PO4A 4WQ4C 1KSPA 1FKPA 1QZ6A 4H0XB 3SPZA 1HKBA 1LOTB 1E4GT 4R79A 4DQIA 3AO5A 3K5MA 1W0HA 2D0PA 1A5XA 3EKUA 4ID1A 3EEQA 4KH4A 3CCJN 4QS9A 3ENHA 2FF3B 4JKHA 3THWA 5SZTA 1LWEA 4FWRA 4YDQA 1VRUA 3SJJA 1J54A 4BRHA 1UWBA 5FRMA 1T03A 3VA0A 4Z4FA 4LH5A 3CQYA 3THXA 1KAXA 5D3GA 4N5SA 5C0YA 3KWGA 3SQ1A 2YKNA 4FWMA 1U48A 3CETA 4FWKA 3C6TA 4YOTA 4BY9C 3VF2A 3HBTA 3WNGA 5CYQA 3K5NA 3NBPA 3SMSA 3TSPA 3OYKA 1WB9A 2NZTA 3E1YA 3AA3A 1NK0A 2GTDA 2RPIA 2FF6A 1P90A 1QSSA 3OHRA 2A1SA 2WC9A 4DR5K 1W97L 3O4WA 5HP1A 3EY1A 3C6UA 1EWRA 4JS4A 5LJWA 1RDAA 5AQGA 3UKRA 2P9NB 2Q1NA 3S41A 1EQYA 1ZBIA 4B9TA 3PX4A 1QHTA 4AF1A 4DS5A 3MN9A 4GV3A 3ULEB 3MXJA 4DHYA 4KHQA 5DM7L 1IV0A 3HPHA 4MFBA 1J9AA 1U2VB 5BR8K 3BZCA 4NCAA 1TK0A 4DV5K 2NRVA 3MEEA 4ZTFA 4B1ZA 3VQAA 3QNNA 4C8KA 1HNXK 3UB5A 3QIPA 4EP4A 3O1WA 4JI5K 1VSDA 4CGIA 3VESA 2ZWHA 2UUBK 3P38A 4CJFA 1M1KO 2HB5A 5I42A 5T7BA 4CBXA 3K9KA 4XIUA 1XHXA 1KVCA 4Q0BA 2UXCK 2YHYA 3K9JA 3FZKA 2CH6A 3TANA 3LS6A 2KTQA 4B9VA 3WXMB 3RMDA 4NLBA 1NNEA 3CC4N 3M8PA 3SCXA 3H3OB 1NMNA 1BWFO 1GLCG 1BI4A 1RDUA 2RHKA 3OJSA 1V4TA 2HSTA 4IFEA 4BWJA 5FROA 1Y9XA 1T44A 1KFSA 5CY4A 1YI2N 4O8UA 1ZBUA 2V7YA 1BUPA 3VQ5A 3FGUA 3KHYA 4JKFA 4NLCA 5FLXO 4RW7A 1XNRK 1V4SA 2E2OA 3GDQA 4X62K 3AVKA 3CCUN 2O8FB 3U4LA 1N6QA 3V1QA 4BR5A 4JKAA 3I0RA 4FBWA 3LAKA 1NK8A 1T7PA 4OKJA 4GMJB 5LMNK 3L6QA 4OKKA 2G8FA 2P9UB 4ISEA 1IKVA 4E1MA 1H0XA 2G8KA 3SLCA 2HW3A 3LM2A 3LL3A 1NK5A 3OYMA 2IVPA 3CYMA 2IAJA 2HHSA 5GAHP 3KKSA 2YKMA 3K0SA 5GADP 3LDSA 4BRMA 1C0MA 3ZETA 5JLFA 4CF8A 3DYAA 4M45A 1U04A 1UA1A 4GNIA 2ZGZA 3DXMA 4B3RK 4Z94A 4CK3A 3VEXA 5C24A 4MLEA 4XH1A 3RTVA 3FLCO 3W0LA 4H0PA 1YITN 2Z1HA 1NJYA 5AQFA 3VETA 3CCLN 2QTDA 1VQ5N 1S9GA 2WUSA 3LP0A 5M1KA 4BRCA 3F9MA 4GV9A 2P9LB 5BN8A 4I2PA 4FJIA 4IDKA 4WQ5C 3VQ6A 4FWPA 1ZC6A 4QCLA 3PX0A 2QA4N 2OPQA 5FPNA 3NHGA 3ZEUA 2YJEA 1DTTA 1NK9A 4AHRA 1HPZA 3LQUA 3WXKA 2CGJA 4PA1A 1ASUA 1L3TA 2J4RA 4BRAA 3H1VX 4LF4K 2IVNA 5M1QA 3H07A 4DMNA 4CZGA 1C6VA 3SJHA 3D2EB 4DR3K 5J2QA 1NJ6A 4OJRA 1I3AA 4IEIA 4CEQA 5JS1A 1XUPO 5EX5A 5HLFA 4LY7A 5ADXH 1QHAA 3MECA 3ZSZA 5AQNA 1NJZA 1HJRA 2VG6A 4B3MK 4P8JA 1DGKN 2GUPA 3MWTA 1LAWA 4NCGA 3PLAA 3LAMA 2OA8A 4YOYA 1KRPA 5AFUA 1T6DA 2F7TA 4OGCA 3LWMA 2JWLA 3V6DA 5IT9O 1BCMA 2DY4A 4FVUA 5AQPA 4H0TB 1H4QA 4FWOA 1YIJN 2ZGYA 1X9SA 4DB3A 2H9UA 1ATSA 1C1BA 3RRHA 4NYFA 1VQ8N 1TL3A 4F4KA 2JGUA 4CJPA 3THVA 1H0YA 5GAGP 1VSMA 1SKSA 2F9WA 4DQPA 2QXFA 3GE1A 5AZIA 3VF4A 3AVAA 3RWUA 4DU1A 1HJOA 3UIQA 4ISGA 5AQHA 1Y64A 1S6QA 4KHWA 3HK2A 4Y1DA 3D45A 4B08A 3PY8A 4GKKK 1VQ9N 4CK1A 3HTVA 3VQ9A 3J8AA 1WLJA 3VGLA 3FFKB 1VQPN 1H4SA 4KI6A 1DT9A 5AQSA 1GLFO 2QM1A 5HBMA 4J2EA 3ZT2A 1I94K 3SV4A 3LDQA 1XNQK 4I7FA 4LF9K 2GX9A 4DV7K 1RILA 4K8XA 1D9DA 1BDGA 4X65K 3EO3A 1Z26A 2QW9A 4CFBA 3AA2A 2P9LA 2WFBA 4IXCA 4FWQA 3U6YA 4LFCK 2YNHA 1HNWK 1G57A 2BTFA 1L3SA 3AVBA 3CC7N 1A5WA 1ZBFA 2AA4A 3CMAN 2HMPA 2UYTA 3MCAB 4CBUA 4CJVA 4BC4A 4Y1CA 2A1RA 3O5BA 1Z6RA 1WSIA 2FC0A 3S3OA 4JI0K 3O9RA 1TUUA 2GWKA 4DTOA 3LDNA 4PHTX 3L2RA 3EYZA 3WXLA 1JLBA 4FLWA 1D8YA 3QEVA 4J2AA 4WQ5A 4DLEA 1C0TA 4WFBL 1D5AA 2VGMA 3KLIA 1DTQA
chains in the Genus database with same CATH topology
1QZ5A 2F9TA 1YJNN 5AQOA 3VEZA 3O9QA 1RFQA 4JAXA 3TTDA 1WUAA 3VERA 4BG9A 3EE9A 4BR2A 2DPNA 4YOWA 3DJCA 4H0VB 3J7ZO 1N8RO 5GAEP 2VGNA 5JLHA 2V52B 1HX1A 3U8XA 1K4OA 4P8EA 4YOVA 4KH5A 5M1FA 4OPHA 5AZJA 5KPZA 2W40A 3ZX0A 4EFHA 1KXPA 3H1QA 3CJ9A 3EKSA 1BU6O 3KVGA 4J8FA 4QS7A 3G25A 4DQ8A 1K7JA 4EHTA 3FZMA 3ZIGA 3H3NO 4EHUA 1K8KB 2IIRA 1HRUA 1RGIA 3TTCA 1ATRA 1H1VA 1SS6A 3CJ1A 1C0GA 3CI5A 3MWPA 4IWVA 3BF1A 1S3XA 3SK3A 4C23A 1K4LA 2HOEA 3SBTA 5E26A 3DLLL 1K49A 3GOIA 4BC2A 1Q86O 1NMDA 2GWJA 2A5XA 3GL1A 3DXKB 1QQMA 1HUXA 3SBGA 5C10A 3D2FA 3P04A 4IJAA 3VTHA 5C2DA 3D2EA 5EXWA 3ZIEA 5FPEA 2NRXA 3CCQN 4JK9A 3MX5A 1TYQB 1Z05A 2YHWA 5AQVA 5AQQA 1K4PA 1OVYA 3DXMB 2GELA 2P9UA 2Q36A 3LDLA 4FWLA 2P9BA 4GV6A 1K9MO 3WUHA 4BVOA 1ZXOA 2E8AA 3UE5A 3CD6N 3ZETB 3CQXA 3G4SN 3HM8A 3I33A 4WQ4C 3RVCA 4K41A 4BQZA 3H46O 1QZ6A 4H0XB 3MN6A 4A61A 3UKUB 1HKBA 1LOTB 4NO7A 3ZYYX 4B1XB 4BRGA 5BRDA 1HKCA 1K8AO 4BRLA 1E4GT 4R79A 1K4IA 3TTFA 3CJAA 2D0PA 3EKUA 4H5VA 1W2BM 2HBMA 2QWQA 4U7BA 2GEMA 4KH4A 3CCJN 4QS9A 3ENHA 2FF3B 4CZFA 3E9LA 4JKHA 2V51B 3PIPL 2Q0UA 3F5TA 3C6AA 4RCHA 4B1WB 2ZF5O 1LCUA 5TKYA 1TKSA 4FWRA 3MK5A 2I7NA 5BRHA 1NLVA 2YX6A 4BRHA 3CJCA 3H6EA 3CCSN 1PVYA 5AQJA 3HOSA 4YKEA 4B1UB 1X3NA 1U6ZA 3D6RA 2NRRA 2ASPA 3CQYA 1KAXA 5C0YA 1U2VA 4IO8A 3KWGA 3A5MC 4FWMA 3CPEA 3CETA 4FWKA 4I6MA 4IOAL 5TKWA 1NGJA 4H5WA 4YOTA 1KC8O 1HPMA 4BY9C 3VEVA 3VF2A 1JCGA 3HBTA 3CPWM 4JD2A 4CZLA 3JXUA 1VQ6N 4M7YA 3L4IA 3SMSA 3OA9A 3TSPA 2NRTA 2NZTA 3E1YA 2P9SA 4BG8A 1C0FA 1Q82O 2VWBA 3NVKA 2NRZA 3R1XA 3SMPA 2GTDA 2FF6A 1KD1O 1P90A 1VQLN 1S22A 3OHRA 2WC9A 3ENOA 4CZJA 4H5RA 1BG3A 1W97L 1XC3A 5MLCQ 3O4WA 2KLAA 2QWRA 3O9SA 1BOTO 4H5TA 2E2QA 4FSVA 3G6EN 3CCMN 5LJWA 3F2KA 5AQGA 3UKRA 4F9OA 1RDWX 3H45C 2P9NB 3O6WA 2P9IA 2Q1NA 3L7VA 3CC2N 3S41A 3L4QA 5AQTA 1EQYA 4A5BA 2QWOA 1BA0A 2YI1A 4IO9L 3R3LA 3O9UA 1SZ2A 1KK9A 4I14A 3OBYA 2QEXN 3M1FA 3A8YA 4AF1A 1YAGA 4M63C 3ENBA 3CCVN 3MN9A 4BQLA 2HF4A 3ULEB 4BGBA 4BRNA 5BN9A 2OTLN 4GV3A 1IEZA 2BUPA 3KK7A 1CZAN 4DHYA 3FR0A 5DM7L 3CERA 3NMUA 3MX2A 5EY4A 3SAHA 3O9TA 1U2VB 5AR0A 3EE8A 3N4PA 2BH1A 3I8BA 2QWMA 2NRVA 4BGAA 4C1NK 4BC5A 5GINA 2OTJN 4B1ZA 1XQSC 1JCFA 2YHXA 4JHDA 2RIUA 3IUCA 1BA1A 3P39A 2Q97A 3UB5A 3LRJA 3OW2M 3O1WA 2P9IB 5AQXA 3VEOA 4JHDB 5GIPA 4JK8A 3G71N 1HLUA 3OBWA 3VESA 1YHQN 3Q7BA 3VOVA 2ZWHA 3GG4A 3P38A 4IOCL 2YCHA 1M1KO 3IDHA 3AAPA 2I7PA 5LJVA 3RSEA 4CBXA 3IFRA 2QWNA 3K9KA 4AM7A 3T1IA 4WFAL 4GVEA 4JKGB 2P9SB 2YHYA 4JKCA 1G99A 3K9JA 3N4QA 2E2PA 2CH6A 2FSNA 3FZKA 3QMLA 4CZIA 3KZBA 3E9PA 4FFJA 3LS6A 3P4IA 1T3VA 4JKEA 4JKGA 3DAWA 4MO4A 3WXMB 4E1JA 2FSJA 4EAHD 5C12A 5HL7L 1NWKA 3RSEB 2V7ZA 3U9ZA 4NLBA 1HKGA 1JCUA 5C15A 2P9NA 3VTIA 4CJ7A 3CC4N 3B8AX 2HBKA 3AY9A 3UKRB 2E88A 4CZHA 2ASOA 1YJ9N 2D0OA 3H3OB 1Q7YO 4WYBA 4P6CA 3WXJA 3VGKA 3ID6A 1BWFO 1GLCG 1RDUA 2CGKA 2RHKA 2W41A 4B1YB 1V4TA 3QFUA 5BR9A 5FPDA 1VQMN 5BREA 1NM1A 4NZRM 2HSTA 4YORA 1QVFM 4IFEA 2ZJRL 2QI2A 2A6AA 1T44A 2A40A 3R6MA 3D2FB 2E20A 1BO5O 1YI2N 3WT0A 5KPTA 4O8UA 4AM6A 4CD1A 4CZEA 5I9EB 2FLOA 3ATUA 4PL8A 1VQNN 1NGHA 1TKUA 2V7YA 1BUPA 3FGUA 3KHYA 5AQUA 4NB4A 1J6ZA 4O8KA 4FOIA 4JKBA 4JKFA 5CHIA 1IJJA 4NLCA 4P6DA 2QWLA 3R8EA 1MDUB 1V4SA 2E2OA 3GDQA 5EVZA 3TPQA 4CI6A 1O13A 3CCUN 4IEEA 5EOYA 4JK7A 3ULEA 1QVGM 1GLJO 3MN7A 3U4LA 5ADXA 3W3DA 4BC3A 1MWKA 4BR5A 4JKAA 3T69A 1S72N 2NRHA 4FBWA 4CZKA 5M1OA 4G9ZA 1ILYA 3O8MA 3M3ZA 2PAVA 5AQZA 5BPMA 3L6QA 4XEIA 5HOOA 2P9UB 3P31A 4ISEA 3ZX3A 3TU5A 1YJWN 4MDBA 1EO1A 3SLCA 2ZJPL 3LM2A 3LL3A 1TYQA 4YOXA 4H0YB 2QXLA 1JCEA 2A3ZA 4L3QA 1X9JA 3U9DA 3HSCA 2IVPA 3LDOA 4UY8O 3WXIA 5GAHP 2RE2A 1VQON 1YUWA 5E84A 4JD2B 1YXQA 3DXKA 5GADP 4CD3A 3MK6A 4BRMA 4RWTA 3CF5L 4BRFA 3ZETA 1YF5L 4I6MB 5JLFA 5M1NA 4OO1J 5KQDA 5AQMA 3MN5A 4GNIA 4FCXA 4HTLA 2ZGZA 5BPLA 1Q81O 1G58A 3QBXA 2E1YA 3DXMA 4Z94A 4ILHA 3PIOL 3VEXA 3C6HA 2A41A 3R9PA 3FZHA 1GLBG 3FZLA 4Y0WA 4FBKA 4MLEA 2WBNA 4XH1A 3FLCO 3HI0A 3W0LA 2ASMA 2NNWA 4H0PA 4XH4A 1YITN 3BUZB 2OANA 5AQFA 3VETA 3CCLN 3C0BA 4IZ9A 5AZJB 1WOQA 1SAZA 2QTDA 5BRFA 4M7XA 4RTFD 1VQ5N 3VENA 4GY2B 2WUSA 5M1KA 4BRCA 3F9MA 4JN4A 4OPAA 5B8HA 2P9LB 4ILJA 5F1XA 4GV9A 4MDAA 5BN8A 3EN9A 5LY3A 4WQ5C 3QFPA 3A5LC 3HRGA 4FWPA 2ITMA 1ZC6A 4FPAA 2H3GX 5GIOA 3BP8A 3IKMA 4ISFA 4A59A 4BRKA 4CBWA 3UKUA 2QA4N 3E66A 5FPNA 3GBTA 4A5AA 1QQOA 3ZEUA 2YJEA 3CXCM 1NGFA 1VQ4N 5F2RA 1X3MA 3E9OA 3WXKA 4MO5A 4WQ4A 4NZTM 2CGJA 3LQUA 2FSKA 2J4RA 5AQWA 4BRAA 3H1VX 3T7ZA 4BR7A 3ID8A 3WEEB 3ZX2A 4FL9A 2IVNA 5M1QA 5AFUH 2E2NA 4CZMA 3H07A 4BROA 3VGMA 4MLHA 1GLLO 4CZGA 3SJHA 3D2EB 2MX1A 1MWMA 2D4WA 4A2BA 4BREA 2P9PA 4JNEA 4HWIA 4IEIA 3FZFA 3WQTA 1VQ7N 3NVMA 3VMFB 2CGLA 1NGDA 3MMVA 4BR9A 2VYPA 1NGAA 3M6GA 1XUPO 5EX5A 2Q31A 5ADXH 1NGCA 1NJIO 3LM9A 4FWSA 1QHAA 1DKGD 1P8ZA 4BVPA 3BF3A 2A42A 4YDUA 5AQNA 4EO0A 1M90O 4O5FA 4K43A 2EQAA 4P8JA 1NGIA 4FWNA 3SAGA 1K8KA 1DGKN 1NBWA 3QBWA 2GUPA 3MWTA 2P9KA 2EWSA 3CCEN 3PLAA 2IVOA 1VQKN 5JVGL 4YOYA 1KAYA 1SQKA 5BPNA 5AFUA 1ATNA 3MGZA 1T6DA 2F7TA 4KH6A 2JWLA 3AGRA 3AARA 3KWIA 3HZ6A 1ZBSA 4LC9B 5JMVA 4E1BA 3D7EO 2AP1A 4IJNA 4WFNL 3WQUA 2FXUA 4XH5A 1KQSM 4FVUA 3I55N 4ILGB 1T6CA 1Q18A 3C7NB 4FPBA 3MDQA 1R59O 4H0TB 5AQPA 1QQNA 4P6PA 4KBOA 4K25A 4FWOA 1YIJN 1IG8A 2P9KB 2ZGYA 3MIOA 2HF3A 4DB3A 1ATSA 1D4XA 3VF6A 1ESVA 1KAZA 1NGGA 3JS6A 4BR4A 4K42A 1VAZA 1VQ8N 5AZIB 3TSQA 4FO0A 3CIPA 4PKHA 2RISA 4FOEA 5M1PA 4BRIA 5GAGP 5JVHL 2F9WA 3GE1A 5AQRA 3EL2A 3ZIIA 5AZIA 3VF4A 2ZJQL 3BEXA 3EZWA 2YJFA 4FBQA 1HJOA 3L0QA 4ISGA 5CR4A 5H1SQ 1Y64A 3FE1A 4YOUA 5AQHA 3CJBA 1GLAG 4DKWA 3CJ7A 2D1KA 2Q2RA 3AGKA 5FPMA 2PFUA 1YVNA 5JICA 3MCPA 4BRQA 3C7NA 4IDHA 4C1NI 3I56N 1SNNA 3TSUA 4A2AA 3A0IX 1VQ9N 4PKGA 3HTVA 3VPZA 4QS8A 2NLXA 3J8AA 3WEEA 3VGLA 3FFKB 5CE3A 1VQPN 1DT9A 1OKJA 5AQSA 1PVWA 1GLFO 2Q0RA 1GLEG 2QM1A 3CHWA 3DWLA 4YDUC 4A57A 4B1VA 5F0XA 4B9QA 3CMEN 4DCHA 3LDQA 3M5RA 4JKDA 2NRWA 2CH5A 3QICA 2GX9A 3A5OC 3QDKA 4H03B 4PL7A 1BDGA 3ATVA 3ZIHA 3EO3A 4H0OA 2QWPA 2QW9A 5AQYA 1XEZA 5AQIA 1NGEA 2P9LA 3QB0A 2WFBA 4IXCA 4BR0A 4FWQA 3SAFA 4H5NA 1MA9B 3A5NC 4EIAA 2HBLA 5C2FA 3VEYA 4BRPA 1G57A 4PKIA 2BTFA 1E4FT 3VEWA 2AA4A 2P9PB 3CC7N 3AJEA 3CCRN 4WF9L 3CMAN 4HVZA 5DM6L 2HMPA 2HBJA 2JWKA 2UYTA 3MCAB 5AQKA 4CBUA 2LN3A 2PBDA 5ELZA 3LDPA 4BC4A 2VCPA 2KKZA 1GLDG 1Z6RA 3O5BA 4JEPA 1DEJA 2E1ZA 3O9RA 1TUUA 2GWKA 1JJ2M 3LDNA 1TUYA 4PHTX 3O08A 3WXLA 4BRDA 3Q7CA 4WCEL 4P77A 5KQ8A 3O80A 1NGBA 3O1BA 4WQ5A 3ZEUB 3AAQA 3C65A 3IMXA 4A62A 2KHOA 5KPRA 4IOXA 5AQLA 4WFBL 3HOTA 4U67L 1K73O 2VGMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TSQ A;  3TSU A;  3TTF A;  3VTH A;  3VEZ A;  3VEW A;  3VES A;  3VEX A;  3VEN A;  3TTC A;  3TTD A;  3VTI A;  3VER A;  3TSP A;  3VET A;  3VF4 A;  3VEO A;  3VF2 A; 
#chains in the Genus database with same CATH topology
 1NJ5 A;  4JAX A;  4BR2 A;  3TTD A;  3VER A;  5IWA K;  2E5L K;  2OPR A;  3DI6 A;  1HMV A;  5GAE P;  1HX1 A;  4YOV A;  5KPZ A;  2DFE A;  3PUF A;  1KXP A;  1XC9 A;  2WOM A;  3CJ9 A;  1BGX T;  3EKS A;  1BU6 O;  1N32 K;  1RQ8 A;  4DQ8 A;  2IIR A;  3U3G A;  4M42 A;  3TTC A;  3OYL A;  1C0G A;  1YT3 A;  1S3X A;  1NKE A;  1NOY A;  1WAF A;  4N41 A;  1RT4 A;  3SBT A;  4F3O A;  2IGI A;  4H4O A;  3GOI A;  1RT6 A;  3THY A;  4HCC A;  4BC2 A;  1Q86 O;  4KPY A;  4H4M A;  3RMA A;  5C10 A;  1BL3 A;  4AH9 A;  3P04 A;  4KB0 A;  3OYE A;  4C8O A;  3CCQ N;  1BIS A;  1TYQ B;  5AQV A;  1BI4 B;  4W5R A;  1K4P A;  1OVY A;  3LDL A;  4FWL A;  1ASV A;  4NXM K;  3CD6 N;  3UE5 A;  4DV0 K;  2UXD K;  3CQX A;  3G4S N;  3HM8 A;  4BQZ A;  3NFA A;  4ID5 A;  4A61 A;  1K8A O;  4BRL A;  4CJK A;  3CJA A;  4H5V A;  3HPG A;  1W2B M;  2QKK A;  2QWQ A;  4YY3 K;  2W6L A;  4CZF A;  2V51 B;  1RT1 A;  2Q0U A;  1ZBH A;  2R7Y A;  3F5T A;  3C6A A;  4DSE A;  2ZF5 O;  1LCU A;  1VSK A;  4FW2 A;  4CJW A;  4PQU A;  3MK5 A;  2YX6 A;  4PUO A;  3H6E A;  3CCS N;  3D6R A;  2NRR A;  4RW9 A;  3CFP A;  1U2V A;  4DR1 K;  2O8C A;  4FXD A;  2PYL A;  3CPE A;  4I6M A;  2ZE2 A;  4H5W A;  3V9S A;  1KC8 O;  3VEV A;  3KD1 E;  3JXU A;  3AO3 A;  3O4Q A;  4M7Y A;  3IAL A;  1QSL A;  1CXQ A;  3VQ8 A;  1Q82 O;  3NVK A;  2VWB A;  2OZM A;  4BDZ A;  3RR7 A;  1S22 A;  3LZJ A;  4CZJ A;  4CHN A;  1XC3 A;  2KZM A;  2KLA A;  1BOT O;  4JYA K;  4H5T A;  3G6E N;  3CCM N;  1H4T A;  3F2K A;  3KK1 A;  4LF7 K;  3DLE A;  1KLN A;  1RDW X;  2P9I A;  4KI4 A;  3L4Q A;  3O3H A;  3LAN A;  4A5B A;  2YI1 A;  1JO0 A;  2BAN A;  4IO9 L;  3O9U A;  1SZ2 A;  3AA4 A;  2QEX N;  3DLH A;  4B3T K;  3A8Y A;  1YAG A;  4CGD A;  3ENB A;  3CCV N;  3S3N A;  2HF4 A;  4BGB A;  3OYJ A;  5BN9 A;  2OTL N;  1IEZ A;  2Y1I A;  1CZA N;  3FR0 A;  4QAG A;  4GKJ K;  4CEO A;  5DK5 A;  4Z4C A;  4DF8 A;  3OYC A;  3WNE A;  2OTJ N;  1TAQ A;  5GIN A;  2GTC A;  1ZYQ A;  2YHX A;  1BHL A;  1BA1 A;  3RR8 A;  3AVG A;  4CIG A;  3DLG A;  4OLB A;  2P9I B;  1EP4 A;  3VEO A;  3IAB A;  5GIP A;  3OBW A;  3Q7B A;  4E7I A;  4DQQ A;  3THW B;  1SKW A;  1JDQ A;  5LJV A;  3RSE A;  3V9W A;  1L3U A;  4Z0U A;  1IKY A;  4HUG A;  2P9S B;  4JKC A;  1G99 A;  3N4Q A;  1B9F A;  2FSN A;  4BDP A;  3BGR A;  3P4I A;  1LV5 A;  4CEF A;  3DAW A;  5C12 A;  3NDK A;  4FJ5 A;  1HKG A;  4CJ7 A;  1OH7 A;  4P77 A;  2ASO A;  2D0O A;  4P6C A;  4CES A;  4B9S A;  3M8R A;  3S3M A;  3ZSV A;  1X1P A;  3QFU A;  1RT2 A;  1NM1 A;  1TIG A;  4ZHR A;  1XMO K;  4B3S K;  1QVF M;  4KRE A;  2G8U A;  2A40 A;  1BO5 O;  3WT0 A;  4CHQ A;  3ZLJ A;  5I9E B;  1X9W A;  4HD0 A;  4PL8 A;  4FK0 A;  1XHZ A;  1NGH A;  4CJ3 A;  1TKU A;  4NB4 A;  4JKB A;  4CK2 A;  5CHI A;  1CZB A;  1IG9 A;  1MDU B;  4KHS A;  4CI6 A;  1O13 A;  3ULE A;  1QVG M;  4C8L A;  4CEZ A;  3MN7 A;  5ADX A;  3LVJ C;  3TR8 A;  4CER A;  1S72 N;  3BDP A;  2NRH A;  5M1O A;  1ILY A;  4FM2 A;  3O8M A;  2PAV A;  5AQZ A;  5BPM A;  3RMB A;  3ZX3 A;  4FJH A;  1RT7 A;  4AIL C;  4DSL A;  4MDB A;  1TYQ A;  2JLE A;  1JCE A;  3ISN C;  1X9J A;  4FJK A;  3HSC A;  3TAG A;  4JD2 B;  1YXQ A;  3CFR A;  3CF5 L;  4FJ7 A;  4DU3 A;  5AQM A;  3MN5 A;  1GOA A;  4CVN E;  4DLG A;  4CJ4 A;  1RBR A;  2A41 A;  3L3U A;  3FZH A;  4FBK A;  2WBN A;  4HHT A;  3HI0 A;  2VWJ A;  1ZBL A;  4KHY A;  2HHT A;  4RW4 A;  1R0A A;  1SAZ A;  5J2M A;  3S9H A;  4M7X A;  4CHO A;  1B92 A;  4DU4 A;  1SL1 A;  3OYN A;  2RF2 A;  4K0K K;  4CGH A;  4JN4 A;  4OPA A;  3BY5 A;  3A5L C;  2HHV A;  5GIO A;  4FPA A;  3IG1 A;  4LF6 K;  3IKM A;  2ETJ A;  4A59 A;  1RT3 A;  4CBW A;  2GBZ A;  3E66 A;  4LD0 A;  4DTS A;  3CXC M;  3NF8 A;  1NGF A;  1X3M A;  1RNH A;  3T7Z A;  3ID8 A;  1WSH A;  4FL9 A;  4JLH A;  2OPP A;  2IS3 A;  3KIO A;  4W5Q A;  2XO7 A;  4LSL A;  2HNY A;  1SL0 A;  1NG9 A;  3DOK A;  3QLH A;  4HUE A;  3NVM A;  1NGD A;  2HMI A;  2Q31 A;  1NGC A;  4B8A B;  1DKG D;  4O5B A;  3QEP A;  3SPY A;  3OS2 A;  2A42 A;  2IC3 A;  4K43 A;  1TGO A;  1K8K A;  4IFV A;  3QBW A;  1VQK N;  1KAY A;  1NJX A;  4Q15 A;  4PWD A;  2XY7 A;  2NUB A;  2KFZ A;  3KWI A;  1RTD A;  3AO1 A;  2AP1 A;  2FXU A;  1KVB A;  1KQS M;  1T6C A;  1Q18 A;  3C7N B;  3MDQ A;  4AHC A;  3P83 D;  3T3F A;  4AQY K;  4P6P A;  4DTM A;  4KBO A;  4I2Q A;  3HJF A;  1GOB A;  2O8E A;  3CM6 A;  2HF3 A;  3VF6 A;  1ESV A;  1KAZ A;  3JS6 A;  1UOC A;  2FBT A;  3TSQ A;  2RIS A;  3M8S A;  4BRI A;  5JVH L;  3KD5 E;  4KKO A;  1JXB A;  3AVI A;  1RTI A;  5AQR A;  2W42 A;  3L0Q A;  3FE1 A;  2EX3 A;  3CJB A;  3V1R A;  4RW8 A;  2FBV A;  4K88 A;  2EHG A;  4JI8 K;  3AGK A;  4Z9E A;  5I3U A;  3VQD A;  5FPM A;  1HC7 A;  2PFU A;  1YVN A;  2O4G A;  1HQU A;  5JIC A;  3MCP A;  4BE1 A;  1B9D A;  3TSU A;  4DR6 K;  4A2A A;  3A0I X;  4JI2 K;  4LF5 K;  3VPZ A;  2NLX A;  3WEE A;  1BCO A;  4W5N A;  1TK8 A;  1PVW A;  3CHW A;  1GLE G;  4DTJ A;  4YDU C;  4B1V A;  4FW1 A;  4J2D A;  4DCH A;  3ZT3 A;  4EZ6 A;  3SQ4 A;  2CH5 A;  2LXR A;  3QDK A;  1JL1 A;  4PL7 A;  3ATV A;  1HYS A;  3WBM A;  4CGG A;  1WBD A;  1S1W A;  4JRQ A;  4WI1 A;  1QE1 A;  1NGE A;  3QB0 A;  2PZS A;  3SAF A;  3SYZ A;  1S9E A;  1MA9 B;  1WSG A;  3T1Y K;  4EIA A;  1XI1 A;  3DLB A;  4BRP A;  1YTA A;  4JS5 A;  1E4F T;  3HST B;  3AJE A;  5LL6 Z;  4WF9 L;  2HBJ A;  2VCP A;  1TKX A;  1GLD G;  2KKZ A;  3G0Z A;  3VA3 A;  3M8Q A;  2UUC K;  1TUY A;  4KAZ A;  4LFB K;  4BRD A;  4CJU A;  5AJ3 K;  3RRG A;  4CFD A;  1HNI A;  1NGB A;  3DM2 A;  4E7K A;  4M41 A;  3IMX A;  2KHO A;  5KPR A;  1PAV A;  1K73 O;  2HVI A;  1LWF A;  1YJN N;  1WNS A;  2F9T A;  5AQO A;  1UDV A;  3O9Q A;  5KGW A;  4BG9 A;  3MXM A;  3DJC A;  4H0V B;  3LP2 A;  5J2P A;  3J7Z O;  1N8R O;  5JLH A;  5M1F A;  3PO5 A;  4FJX A;  5AZJ A;  4CIF A;  1JLF A;  3HP9 A;  4EFH A;  2PY5 A;  4FM1 A;  4J8F A;  3KVG A;  5C25 A;  4E89 A;  4DTU A;  1K7J A;  4EHU A;  4DV4 K;  1K8K B;  1HRU A;  1RGI A;  4I9L A;  1N36 K;  4CEA A;  3MWP A;  3I8D A;  3LWL A;  1K4L A;  2O8B A;  4K8Z A;  2GWJ A;  3L8B A;  3SBG A;  5C42 A;  3TAF A;  5C2D A;  4DUZ K;  4JK9 A;  4FJL A;  1Z05 A;  2YHW A;  4CJR A;  4CF9 A;  5SWM A;  2VQE K;  1WAJ A;  3DXM B;  2XY6 A;  1C1A A;  1SL2 A;  3NGZ A;  1LAV A;  4CJL A;  4DTP A;  1ZXO A;  3RVC A;  3I33 A;  4K41 A;  3UKU B;  4NO7 A;  3ZYY X;  4B1X B;  4BRG A;  4NXN K;  1BIU A;  4CHZ A;  3HXM A;  3DRP A;  2GEM A;  4L8R B;  4CFC A;  3JAM O;  4Q5V A;  3PIP L;  1I39 A;  2O8D B;  4B1W B;  5TKY A;  1ITG A;  1BQN A;  3HL8 A;  2I7N A;  5BRH A;  1NLV A;  3TOE A;  3ZSO A;  3OVN A;  4FLY A;  5AQJ A;  3HOS A;  4YKE A;  1WBB A;  4B1U B;  1QS4 A;  1U6Z A;  4DFP A;  2G8V A;  2ASP A;  3B6P A;  3U6F A;  1Q9X A;  3QIN A;  4IO8 A;  1RTJ A;  3A5M C;  1VM0 A;  4M3X A;  5DMR A;  3HVT A;  4IOA L;  5TKW A;  3KK2 A;  3QKB A;  4JD2 A;  1JLE A;  3L4I A;  3LAL A;  4RG8 A;  4BAC A;  4BG8 A;  1JL2 A;  2NRZ A;  4IKF A;  4CGF A;  1IH7 A;  3SQ0 A;  1KD1 O;  1VQL N;  5MLC Q;  4FZZ A;  3ENO A;  4H5R A;  4B9M A;  4ELT A;  4OPK A;  1TKD A;  2QWR A;  1HNZ K;  1FKO A;  2BGG A;  1Z25 A;  2E2Q A;  4FSV A;  3KLF A;  3SUO A;  3SUN A;  3H45 C;  3HP6 A;  4BE0 A;  3L7V A;  3CC2 N;  5AQT A;  3R3L A;  4NCB A;  3CG7 A;  3DLK A;  3KLG A;  1TAU A;  3M1F A;  2Y1J A;  3K5L A;  3VQE A;  1S1V A;  1DCJ A;  3MX2 A;  5EY4 A;  3O9T A;  3EE8 A;  2VG5 A;  2BH1 A;  3N4P A;  3I8B A;  4DG1 A;  2OPS A;  4BC5 A;  4FJ9 A;  3LP3 A;  2G8I A;  4LF8 K;  4JHD A;  1NK7 A;  4FJN A;  3J80 O;  4DR7 K;  3OW2 M;  1T8E A;  1JXE A;  3I0S A;  1U4B A;  4JHD B;  3WNF A;  5KRS A;  3G71 N;  1HLU A;  1YHQ N;  4M3T A;  3VOV A;  2Q3V A;  2YCH A;  3PV8 A;  3DSD A;  4LH4 A;  2QWN A;  4AM7 A;  3T1I A;  4WFA L;  4GVE A;  4JKG B;  2YNF A;  4HCB A;  2F8S A;  2E2P A;  4CZI A;  3ALY A;  3QET A;  4DTN A;  4MO4 A;  1T3V A;  4RW6 A;  4E1J A;  5HL7 L;  2IDO A;  2FSJ A;  3OYB A;  1XWL A;  3RSE B;  2V7Z A;  3U9Z A;  4M3R A;  4F8R A;  2P9N A;  3QO9 A;  1WSJ A;  2HBK A;  3AY9 A;  3B8A X;  3UKR B;  1YJ9 N;  2KQ2 A;  3J7A P;  1Q7Y O;  1NJ1 A;  3ID6 A;  3IAB B;  4FJ8 A;  1VSF A;  2CGK A;  3DRR A;  1C0U A;  1REV A;  4KHU A;  5BRE A;  4NZR M;  4B9L A;  4YOR A;  1KVA A;  3V4I A;  2ZJR L;  4CEC A;  2OCE A;  2QI2 A;  4W5T A;  2A6A A;  3R6M A;  2E20 A;  4E19 A;  5KGX A;  4CD1 A;  3O3G A;  2FLO A;  3ATU A;  1VQN N;  3LPU A;  1VHX A;  4N76 A;  4O8K A;  3THY B;  3KLH A;  2HHU A;  3HVR A;  4CIE A;  3THX B;  4IEE A;  1YVU A;  3IS9 A;  3QEX A;  4DSJ A;  4ELV A;  1YTU A;  3IAY A;  3W3D A;  1MWK A;  3T69 A;  1IO2 A;  1NJ8 A;  4OGE A;  4G9Z A;  2YV0 X;  1JLA A;  1TV6 A;  2XHB A;  1YJW N;  1EO1 A;  3KTQ A;  4OLA A;  2ZJP L;  3RMC A;  3D0P A;  3U9D A;  4HVJ A;  2KZZ A;  3DSC A;  3MAQ A;  1J53 A;  2RE2 A;  1YUW A;  3OJU A;  2DTU A;  3DXK A;  4Z4G A;  4CD3 A;  3MK6 A;  4OO1 J;  3BZK A;  4I6M B;  5KQD A;  2O8B B;  1XMQ K;  1JLQ A;  4FCX A;  1G58 A;  3QBX A;  1NJW A;  4CJ5 A;  3PIO L;  3PSI A;  3C6H A;  1RTH A;  3R9P A;  4N47 A;  1GLB G;  3FZL A;  4Y0W A;  1VR4 A;  4B9U A;  3ZSW A;  2NNW A;  3HM9 A;  5AZJ B;  3C95 A;  4RTF D;  5FRN A;  3VEN A;  3LP1 A;  4GY2 B;  4M3U A;  2YHB A;  5B8H A;  5F1X A;  4ILJ A;  4AHV A;  5HRR A;  3MEG A;  2OYQ A;  4FK2 A;  1RBV A;  4W5O A;  3NH1 A;  4BRK A;  4DQR A;  1QQO A;  5J1E A;  3NH0 A;  4DQS A;  1S1U A;  4FZY A;  3OTO K;  4NZT M;  2FSK A;  4UQG A;  5AQW A;  3C94 A;  4BR7 A;  3NAE A;  5AFU H;  4BRO A;  3VGM A;  1U49 A;  4MLH A;  4ZTJ A;  1GLL O;  3K5O A;  4EZ9 A;  1MWM A;  4A2B A;  4BRE A;  2P9P A;  3QNO A;  4JNE A;  2X6N A;  4HWI A;  3V9U A;  3FZF A;  3WQT A;  1WSF A;  1VQ7 N;  2CGL A;  4BR9 A;  4CJS A;  1NGA A;  3M6G A;  2F4V K;  1S1T A;  4KRF A;  1P8Z A;  2X74 A;  1KTQ A;  4BVP A;  3BF3 A;  4EO0 A;  3J81 O;  2HVH A;  2EQA A;  1NGI A;  4FWN A;  3AO4 A;  2P5G A;  4DTR A;  4KHN A;  3OYH A;  2EWS A;  2IVO A;  5HRO A;  5BPN A;  4Z4I A;  2A2Y A;  1ATN A;  1GOC A;  4FZX C;  2HHH K;  3TI0 A;  3TAQ A;  3HZ6 A;  4DV1 K;  4E1B A;  1IKX A;  4WFN L;  3I55 N;  4ILG B;  1R59 O;  3AO2 A;  4OVL A;  2ZM6 K;  4OKE A;  3SI6 A;  3MIO A;  1S1X A;  3MED A;  4KFB A;  2UUA K;  1NGG A;  4K42 A;  4FO0 A;  3CIP A;  4PKH A;  4AHT A;  5M1P A;  3A2F A;  1OH6 A;  4CED A;  2RKI A;  3ZII A;  2E6L A;  2YJF A;  4FBQ A;  3EZW A;  4KTW A;  2G8W A;  4FLT A;  5CR4 A;  4YOU A;  1GLA G;  4DKW A;  4IG3 A;  3HYF A;  3DOL A;  2I5J A;  2D1K A;  2Q2R A;  1HYZ A;  3CJ7 A;  4DR2 K;  4V19 S;  3K58 A;  4BRQ A;  3C7N A;  4IDH A;  4FLU A;  3I56 N;  1SNN A;  1C1C A;  4QS8 A;  4LFA K;  5CE3 A;  5J2N A;  1LW0 A;  4YNQ A;  3KJV A;  3CME N;  5F0X A;  4B9Q A;  1D9F A;  3ITH A;  3M5R A;  4CE9 A;  2NRW A;  2OZS A;  3SZ2 A;  3A5O C;  3V1O A;  4F2R A;  4CEB A;  1LW2 A;  1RCH A;  3ZIH A;  3ZT0 A;  5E41 A;  2QWP A;  5AQY A;  2W6K A;  1XEZ A;  5AQI A;  1QQC A;  3L2U A;  4BR0 A;  4H5N A;  4C8N A;  1KLM A;  3P1G A;  2VWK A;  5HRP A;  2HBL A;  4TSX A;  5C2F A;  3VEY A;  4TWA A;  3F73 A;  3QES A;  1SUQ A;  4Z4H A;  4DSF A;  5DM6 L;  4CFA A;  2JWK A;  5AQK A;  2L8Y A;  2PBD A;  4KTQ A;  4ICL A;  4CJQ A;  2E1Z A;  3AVN A;  3ZSR A;  2UU9 K;  4QOZ B;  2IOC A;  3O08 A;  4DV6 K;  3Q7C A;  2HND A;  1RBT A;  5KQ8 A;  3O80 A;  3O1B A;  4FLX A;  4X64 K;  4DSI A;  3C65 A;  4A62 A;  5AQL A;  3HOT A;  3NH2 A;  1SKR A;  3AA5 X;  1U47 A;  1QZ5 A;  1RFQ A;  5LMU K;  3EE9 A;  1HNV A;  1HRH A;  3VQQ A;  4YOW A;  4CHP A;  2V52 B;  3U8X A;  1K4O A;  4P8E A;  3O3F A;  1WSE A;  4OPH A;  2W40 A;  1NK4 A;  4E7H A;  3ZX0 A;  3OYI A;  3OYF A;  3EZ5 A;  3H1Q A;  4QS7 A;  4F2S A;  2HNZ A;  3H3N O;  1J5O A;  1H1V A;  1ATR A;  3CJ1 A;  4IWV A;  3ASM A;  3BF1 A;  3SK3 A;  4YFU A;  1NKB A;  5E26 A;  3VQ4 A;  1K49 A;  2WON A;  4KV8 A;  1NMD A;  2A5X A;  1OH5 A;  4M3Z A;  1QQM A;  1NFH A;  4IJA A;  4JV5 K;  1NJ2 A;  3D2E A;  5EXW A;  1VRT A;  3ZIE A;  5FPE A;  2NRX A;  3MX5 A;  3F9K A;  4PY5 A;  2UXB K;  3TAP A;  2GEL A;  3L3V A;  4JI4 K;  3AVH A;  1JKH A;  5K14 A;  2Q3S A;  2P1J A;  2Z1I A;  1TK5 A;  3J7Y P;  4GV6 A;  1K9M O;  4BVO A;  1UAX A;  1IBL K;  3DRS A;  4O0J A;  4FCY A;  1IBK K;  3H46 O;  1J5E K;  4NCX A;  3MN6 A;  5BRD A;  3MXI A;  1JE3 A;  1HKC A;  1EWQ A;  3WNH A;  4CF0 A;  1K4I A;  4DFJ A;  3U3Y A;  3TTF A;  3VQ7 A;  2HBM A;  4U7B A;  1L3V A;  3E9L A;  5CZ2 A;  4FJM A;  3VN5 A;  1TVR A;  1Q8I A;  2B4J A;  4RCH A;  1TKS A;  3KK3 A;  4C8M A;  4CF2 A;  1N5Y A;  3CJC A;  3LZI A;  4CJT A;  1PVY A;  1SV5 A;  5KI6 A;  1VK0 A;  4DUY K;  1NOZ A;  1RDD A;  1X3N A;  3OYG A;  2P5O A;  4HTU A;  1EKE A;  1NGJ A;  3AVL A;  1HPM A;  1FJG K;  3V9X A;  1JCG A;  3CPW M;  4CZL A;  1VQ6 N;  1NK6 A;  3OA9 A;  3QER A;  2NRT A;  1MU2 A;  3CQ8 A;  4JRP A;  2P9S A;  1C0F A;  3R1X A;  3SMP A;  4DF4 A;  1QSY A;  2QKB A;  4CEE A;  1BIZ A;  1BG3 A;  3E01 A;  3LPT A;  4O4G A;  3O9S A;  3HPO A;  1TKT A;  3AVM A;  4F9O A;  2Z1G A;  3O6W A;  3NCI A;  4Z4E A;  2QWO A;  1BA0 A;  2Z7C A;  1KK9 A;  1HYV A;  4R5P A;  4I14 A;  3OBY A;  2O8F A;  4M63 C;  4BQL A;  4BRN A;  3DMJ A;  2BUP A;  3KK7 A;  4B9N A;  3ZCM A;  2XY5 A;  3CER A;  3NMU A;  3SAH A;  3HT3 A;  1OH8 A;  5AR0 A;  4FJG A;  4E7L A;  2QWM A;  4BGA A;  1K6Y A;  4C1N K;  4CHY A;  3ZT4 A;  2YNG A;  1XQS C;  1JCF A;  2RIU A;  3OS1 A;  3L2V A;  3NF7 A;  3IUC A;  4CW7 B;  3AVF A;  3P39 A;  2Q97 A;  3LRJ A;  2BDP A;  4J2B A;  5AQX A;  4BWM A;  4GVM A;  4JK8 A;  3TWH A;  1T05 A;  1FXX A;  2O8D A;  2PYJ A;  3GG4 A;  4O55 A;  2CRQ A;  4IOC L;  2AJQ A;  4ELU A;  2HHQ A;  3IDH A;  3AAP A;  2I7P A;  4O0I A;  3IFR A;  3V9Z A;  3AV9 A;  3AVC A;  4KO0 A;  4FFJ A;  3QML A;  4FLZ A;  2HHW A;  2VQF K;  3KZB A;  3E9P A;  4JKE A;  4JKG A;  4EAH D;  3NF6 A;  4E1N A;  1NWK A;  4FK4 A;  1JCU A;  5C15 A;  2O4I A;  3VTI A;  2O8C B;  4CZH A;  2E88 A;  4WYB A;  3WXJ A;  3VGK A;  4YHH K;  4E7J A;  4B1Y B;  3AVJ A;  2W41 A;  2Z1J A;  5FPD A;  1VQM N;  5BR9 A;  2DFH A;  2EK0 A;  2Y1B A;  4EP5 A;  4FLV A;  4AHS A;  3D2F B;  4B3O A;  5KPT A;  4AM6 A;  4CZE A;  1BQM A;  5CZ1 A;  2IFE A;  3JSM A;  1EXQ A;  5AQU A;  3TAM A;  1J6Z A;  4FOI A;  4BDY A;  1IJJ A;  4P6D A;  1LN4 A;  2QWL A;  3R8E A;  5EVZ A;  3TPQ A;  3NE6 A;  5EOY A;  4JK7 A;  3K57 A;  2HHX A;  1GLJ O;  2GV9 A;  4G1Q A;  3JYT A;  2XY8 A;  4BC3 A;  1HQE A;  3NF9 A;  2X78 A;  2P51 A;  2ATQ A;  2B5J A;  4CZK A;  4JI7 K;  3M3Z A;  1OVQ A;  4XEI A;  4NYN A;  5HOO A;  3P31 A;  3TU5 A;  2RN2 A;  1RDB A;  3G10 A;  4YOX A;  2X6S A;  1IBM K;  4H0Y B;  2QXL A;  1EX4 A;  2ZD1 A;  2A3Z A;  4L3Q A;  3KKR A;  1QTM A;  1FW6 A;  1S6P A;  3IRX A;  3LDO A;  4B8C A;  4UY8 O;  3WXI A;  1VQO N;  1LWC A;  5E84 A;  2YNI A;  4KB1 A;  4RWT A;  4BRF A;  5M1N A;  1YF5 L;  4IFY A;  1N33 K;  2D5R A;  4HTL A;  5BPL A;  1Q81 O;  2E1Y A;  3NGI A;  2KW4 A;  1II7 A;  4ILH A;  1RBU A;  4FJJ A;  3ULD A;  4DV2 K;  2ASM A;  4XH4 A;  3BUZ B;  2OAN A;  1X9M A;  3C0B A;  4IZ9 A;  1WOQ A;  3SUQ A;  5BRF A;  4K87 A;  4BE2 A;  4FYD A;  3HO1 A;  2BKY X;  1ASW A;  3EN9 A;  4MDA A;  5LY3 A;  4JI3 K;  3QFP A;  3HRG A;  4IG0 A;  2ITM A;  2H3G X;  2GUI A;  3BP8 A;  4ISF A;  3VQB A;  3UKU A;  3GBT A;  4A5A A;  5HRS A;  3TAR A;  1WN7 A;  1S8E A;  3SV3 A;  1VQ4 N;  3H08 A;  5F2R A;  3E9O A;  4LSN A;  4MO5 A;  4WQ4 A;  3L2W A;  1TKZ A;  3ZSQ A;  3WEE B;  3SUP A;  3ZX2 A;  2F8T A;  4KTZ A;  2E2N A;  4CZM A;  3PSF A;  4DFK A;  4CJE A;  2MX1 A;  2D4W A;  3P5J A;  2KFN A;  4WE1 A;  1Y2I A;  3VMF B;  3MMV A;  2VYP A;  1E3M A;  2E6M A;  1Y97 A;  3TAB A;  1NJI O;  3LM9 A;  4FWS A;  2BE2 A;  4YDU A;  5HRN A;  1M90 O;  2E4L A;  4O5F A;  3SAG A;  1NBW A;  4DR4 K;  1RT5 A;  2P9K A;  3CCE N;  4H8K A;  5JVG L;  1SQK A;  1KCF A;  3MGZ A;  3L2Q A;  3PX6 A;  4KH6 A;  4GW6 A;  4O44 A;  3CFO A;  3AGR A;  1EET A;  3AAR A;  1NU0 A;  1RBS A;  2ZQB A;  1ZBS A;  4LC9 B;  1NKC A;  5JMV A;  3D7E O;  4IJN A;  3WQU A;  2B6A A;  4XH5 A;  4JI1 K;  3ZSY A;  3B6O A;  3DLR A;  4FPB A;  3QIO A;  1O1W A;  1QQN A;  4K25 A;  1IG8 A;  2FBX A;  2P9K B;  4CF1 A;  1JLG A;  1D4X A;  1VSJ A;  4BR4 A;  1A5V A;  1VAZ A;  5KRT A;  5EU7 A;  4AHU A;  5AZI B;  2VG7 A;  4FOE A;  3VQP A;  4E3S A;  1VSE A;  2M71 A;  3EL2 A;  3V81 A;  2ZJQ L;  2QK9 A;  3BEX A;  3OS0 A;  5H1S Q;  3LVK B;  2F96 A;  1IKW A;  4K86 A;  4F3T A;  1N34 K;  4C1N I;  3ZSX A;  3VQC A;  4PKG A;  4JI6 K;  5FDL A;  3NGY A;  1OKJ A;  1VSI A;  2Q0R A;  3DWL A;  4A57 A;  4X66 K;  1CZ9 A;  3OYA A;  4OLF A;  3KLE A;  4JKD A;  3QIC A;  1CXU A;  3CM5 A;  4H03 B;  4MQ3 A;  4CGJ A;  1NH9 A;  1Q9Y A;  4H0O A;  3T19 A;  3T1H K;  2D0C A;  4DS4 A;  4IBN A;  3A5N C;  4N56 A;  4PKI A;  1HR0 K;  3VEW A;  2P9P B;  3CCR N;  4DV3 K;  4HVZ A;  2LN3 A;  1CLQ A;  4M3Y A;  5ELZ A;  3LDP A;  4JEP A;  1DEJ A;  3T1A A;  1DLO A;  1W7A A;  2FBY A;  5JS2 A;  1JJ2 M;  3ZT1 A;  3SQ2 A;  4WCE L;  3QEW A;  3ZEU B;  3AAQ A;  4FM0 A;  4IOX A;  4U67 L;  3FFI A;  4DWI A;  2O8E B;  1UA0 A;  4FVM A;  3VEZ A;  4DFM A;  1WUA A;  2D0B A;  2DPN A;  1F21 A;  2DFF A;  3OY9 A;  2VGN A;  4E0D A;  5CYM A;  3SNN A;  4KH5 A;  1KFD A;  1NFJ A;  1G15 A;  1FK9 A;  5KTQ A;  3G25 A;  4EHT A;  3FZM A;  2XRI A;  3ZIG A;  3OYD A;  1JLC A;  1SS6 A;  3CI5 A;  4M3W A;  1U45 A;  1VSL A;  1RDC A;  4C23 A;  2HOE A;  2LSN A;  3DLL L;  4KHP K;  1S5J A;  1TL1 A;  4OPJ A;  3K59 A;  5A2Q O;  2ITG A;  4DSK A;  3GL1 A;  3DXK B;  1HUX A;  1VSH A;  3D2F A;  3QEI A;  3VTH A;  2G8H A;  4HVC A;  4I9Q A;  4DTX A;  5AQQ A;  3O4N A;  2P9U A;  4CCH A;  2Q36 A;  1L5U A;  3K2P A;  3HZ7 A;  3TAE A;  1W9H A;  2D0A A;  2P9B A;  2WTU A;  3WUH A;  2YHA A;  4HUF A;  2E8A A;  4OX9 K;  3ZET B;  2EH1 A;  3PO4 A;  4WQ4 C;  1KSP A;  1FKP A;  1QZ6 A;  4H0X B;  3SPZ A;  1HKB A;  1LOT B;  1E4G T;  4R79 A;  4DQI A;  3AO5 A;  3K5M A;  1W0H A;  2D0P A;  1A5X A;  3EKU A;  4ID1 A;  3EEQ A;  4KH4 A;  3CCJ N;  4QS9 A;  3ENH A;  2FF3 B;  4JKH A;  3THW A;  5SZT A;  1LWE A;  4FWR A;  4YDQ A;  1VRU A;  3SJJ A;  1J54 A;  4BRH A;  1UWB A;  5FRM A;  1T03 A;  3VA0 A;  4Z4F A;  4LH5 A;  3CQY A;  3THX A;  1KAX A;  5D3G A;  4N5S A;  5C0Y A;  3KWG A;  3SQ1 A;  2YKN A;  4FWM A;  1U48 A;  3CET A;  4FWK A;  3C6T A;  4YOT A;  4BY9 C;  3VF2 A;  3HBT A;  3WNG A;  5CYQ A;  3K5N A;  3NBP A;  3SMS A;  3TSP A;  3OYK A;  1WB9 A;  2NZT A;  3E1Y A;  3AA3 A;  1NK0 A;  2GTD A;  2RPI A;  2FF6 A;  1P90 A;  1QSS A;  3OHR A;  2A1S A;  2WC9 A;  4DR5 K;  1W97 L;  3O4W A;  5HP1 A;  3EY1 A;  3C6U A;  1EWR A;  4JS4 A;  5LJW A;  1RDA A;  5AQG A;  3UKR A;  2P9N B;  2Q1N A;  3S41 A;  1EQY A;  1ZBI A;  4B9T A;  3PX4 A;  1QHT A;  4AF1 A;  4DS5 A;  3MN9 A;  4GV3 A;  3ULE B;  3MXJ A;  4DHY A;  4KHQ A;  5DM7 L;  1IV0 A;  3HPH A;  4MFB A;  1J9A A;  1U2V B;  5BR8 K;  3BZC A;  4NCA A;  1TK0 A;  4DV5 K;  2NRV A;  3MEE A;  4ZTF A;  4B1Z A;  3VQA A;  3QNN A;  4C8K A;  1HNX K;  3UB5 A;  3QIP A;  4EP4 A;  3O1W A;  4JI5 K;  1VSD A;  4CGI A;  3VES A;  2ZWH A;  2UUB K;  3P38 A;  4CJF A;  1M1K O;  2HB5 A;  5I42 A;  5T7B A;  4CBX A;  3K9K A;  4XIU A;  1XHX A;  1KVC A;  4Q0B A;  2UXC K;  2YHY A;  3K9J A;  3FZK A;  2CH6 A;  3TAN A;  3LS6 A;  2KTQ A;  4B9V A;  3WXM B;  3RMD A;  4NLB A;  1NNE A;  3CC4 N;  3M8P A;  3SCX A;  3H3O B;  1NMN A;  1BWF O;  1GLC G;  1BI4 A;  1RDU A;  2RHK A;  3OJS A;  1V4T A;  2HST A;  4IFE A;  4BWJ A;  5FRO A;  1Y9X A;  1T44 A;  1KFS A;  5CY4 A;  1YI2 N;  4O8U A;  1ZBU A;  2V7Y A;  1BUP A;  3VQ5 A;  3FGU A;  3KHY A;  4JKF A;  4NLC A;  5FLX O;  4RW7 A;  1XNR K;  1V4S A;  2E2O A;  3GDQ A;  4X62 K;  3AVK A;  3CCU N;  2O8F B;  3U4L A;  1N6Q A;  3V1Q A;  4BR5 A;  4JKA A;  3I0R A;  4FBW A;  3LAK A;  1NK8 A;  1T7P A;  4OKJ A;  4GMJ B;  5LMN K;  3L6Q A;  4OKK A;  2G8F A;  2P9U B;  4ISE A;  1IKV A;  4E1M A;  1H0X A;  2G8K A;  3SLC A;  2HW3 A;  3LM2 A;  3LL3 A;  1NK5 A;  3OYM A;  2IVP A;  3CYM A;  2IAJ A;  2HHS A;  5GAH P;  3KKS A;  2YKM A;  3K0S A;  5GAD P;  3LDS A;  4BRM A;  1C0M A;  3ZET A;  5JLF A;  4CF8 A;  3DYA A;  4M45 A;  1U04 A;  1UA1 A;  4GNI A;  2ZGZ A;  3DXM A;  4B3R K;  4Z94 A;  4CK3 A;  3VEX A;  5C24 A;  4MLE A;  4XH1 A;  3RTV A;  3FLC O;  3W0L A;  4H0P A;  1YIT N;  2Z1H A;  1NJY A;  5AQF A;  3VET A;  3CCL N;  2QTD A;  1VQ5 N;  1S9G A;  2WUS A;  3LP0 A;  5M1K A;  4BRC A;  3F9M A;  4GV9 A;  2P9L B;  5BN8 A;  4I2P A;  4FJI A;  4IDK A;  4WQ5 C;  3VQ6 A;  4FWP A;  1ZC6 A;  4QCL A;  3PX0 A;  2QA4 N;  2OPQ A;  5FPN A;  3NHG A;  3ZEU A;  2YJE A;  1DTT A;  1NK9 A;  4AHR A;  1HPZ A;  3LQU A;  3WXK A;  2CGJ A;  4PA1 A;  1ASU A;  1L3T A;  2J4R A;  4BRA A;  3H1V X;  4LF4 K;  2IVN A;  5M1Q A;  3H07 A;  4DMN A;  4CZG A;  1C6V A;  3SJH A;  3D2E B;  4DR3 K;  5J2Q A;  1NJ6 A;  4OJR A;  1I3A A;  4IEI A;  4CEQ A;  5JS1 A;  1XUP O;  5EX5 A;  5HLF A;  4LY7 A;  5ADX H;  1QHA A;  3MEC A;  3ZSZ A;  5AQN A;  1NJZ A;  1HJR A;  2VG6 A;  4B3M K;  4P8J A;  1DGK N;  2GUP A;  3MWT A;  1LAW A;  4NCG A;  3PLA A;  3LAM A;  2OA8 A;  4YOY A;  1KRP A;  5AFU A;  1T6D A;  2F7T A;  4OGC A;  3LWM A;  2JWL A;  3V6D A;  5IT9 O;  1BCM A;  2DY4 A;  4FVU A;  5AQP A;  4H0T B;  1H4Q A;  4FWO A;  1YIJ N;  2ZGY A;  1X9S A;  4DB3 A;  2H9U A;  1ATS A;  1C1B A;  3RRH A;  4NYF A;  1VQ8 N;  1TL3 A;  4F4K A;  2JGU A;  4CJP A;  3THV A;  1H0Y A;  5GAG P;  1VSM A;  1SKS A;  2F9W A;  4DQP A;  2QXF A;  3GE1 A;  5AZI A;  3VF4 A;  3AVA A;  3RWU A;  4DU1 A;  1HJO A;  3UIQ A;  4ISG A;  5AQH A;  1Y64 A;  1S6Q A;  4KHW A;  3HK2 A;  4Y1D A;  3D45 A;  4B08 A;  3PY8 A;  4GKK K;  1VQ9 N;  4CK1 A;  3HTV A;  3VQ9 A;  3J8A A;  1WLJ A;  3VGL A;  3FFK B;  1VQP N;  1H4S A;  4KI6 A;  1DT9 A;  5AQS A;  1GLF O;  2QM1 A;  5HBM A;  4J2E A;  3ZT2 A;  1I94 K;  3SV4 A;  3LDQ A;  1XNQ K;  4I7F A;  4LF9 K;  2GX9 A;  4DV7 K;  1RIL A;  4K8X A;  1D9D A;  1BDG A;  4X65 K;  3EO3 A;  1Z26 A;  2QW9 A;  4CFB A;  3AA2 A;  2P9L A;  2WFB A;  4IXC A;  4FWQ A;  3U6Y A;  4LFC K;  2YNH A;  1HNW K;  1G57 A;  2BTF A;  1L3S A;  3AVB A;  3CC7 N;  1A5W A;  1ZBF A;  2AA4 A;  3CMA N;  2HMP A;  2UYT A;  3MCA B;  4CBU A;  4CJV A;  4BC4 A;  4Y1C A;  2A1R A;  3O5B A;  1Z6R A;  1WSI A;  2FC0 A;  3S3O A;  4JI0 K;  3O9R A;  1TUU A;  2GWK A;  4DTO A;  3LDN A;  4PHT X;  3L2R A;  3EYZ A;  3WXL A;  1JLB A;  4FLW A;  1D8Y A;  3QEV A;  4J2A A;  4WQ5 A;  4DLE A;  1C0T A;  4WFB L;  1D5A A;  2VGM A;  3KLI A;  1DTQ A; 
#chains in the Genus database with same CATH homology
 1QZ5 A;  2F9T A;  1YJN N;  5AQO A;  3VEZ A;  3O9Q A;  1RFQ A;  4JAX A;  3TTD A;  1WUA A;  3VER A;  4BG9 A;  3EE9 A;  4BR2 A;  2DPN A;  4YOW A;  3DJC A;  4H0V B;  3J7Z O;  1N8R O;  5GAE P;  2VGN A;  5JLH A;  2V52 B;  1HX1 A;  3U8X A;  1K4O A;  4P8E A;  4YOV A;  4KH5 A;  5M1F A;  4OPH A;  5AZJ A;  5KPZ A;  2W40 A;  3ZX0 A;  4EFH A;  1KXP A;  3H1Q A;  3CJ9 A;  3EKS A;  1BU6 O;  3KVG A;  4J8F A;  4QS7 A;  3G25 A;  4DQ8 A;  1K7J A;  4EHT A;  3FZM A;  3ZIG A;  3H3N O;  4EHU A;  1K8K B;  2IIR A;  1HRU A;  1RGI A;  3TTC A;  1ATR A;  1H1V A;  1SS6 A;  3CJ1 A;  1C0G A;  3CI5 A;  3MWP A;  4IWV A;  3BF1 A;  1S3X A;  3SK3 A;  4C23 A;  1K4L A;  2HOE A;  3SBT A;  5E26 A;  3DLL L;  1K49 A;  3GOI A;  4BC2 A;  1Q86 O;  1NMD A;  2GWJ A;  2A5X A;  3GL1 A;  3DXK B;  1QQM A;  1HUX A;  3SBG A;  5C10 A;  3D2F A;  3P04 A;  4IJA A;  3VTH A;  5C2D A;  3D2E A;  5EXW A;  3ZIE A;  5FPE A;  2NRX A;  3CCQ N;  4JK9 A;  3MX5 A;  1TYQ B;  1Z05 A;  2YHW A;  5AQV A;  5AQQ A;  1K4P A;  1OVY A;  3DXM B;  2GEL A;  2P9U A;  2Q36 A;  3LDL A;  4FWL A;  2P9B A;  4GV6 A;  1K9M O;  3WUH A;  4BVO A;  1ZXO A;  2E8A A;  3UE5 A;  3CD6 N;  3ZET B;  3CQX A;  3G4S N;  3HM8 A;  3I33 A;  4WQ4 C;  3RVC A;  4K41 A;  4BQZ A;  3H46 O;  1QZ6 A;  4H0X B;  3MN6 A;  4A61 A;  3UKU B;  1HKB A;  1LOT B;  4NO7 A;  3ZYY X;  4B1X B;  4BRG A;  5BRD A;  1HKC A;  1K8A O;  4BRL A;  1E4G T;  4R79 A;  1K4I A;  3TTF A;  3CJA A;  2D0P A;  3EKU A;  4H5V A;  1W2B M;  2HBM A;  2QWQ A;  4U7B A;  2GEM A;  4KH4 A;  3CCJ N;  4QS9 A;  3ENH A;  2FF3 B;  4CZF A;  3E9L A;  4JKH A;  2V51 B;  3PIP L;  2Q0U A;  3F5T A;  3C6A A;  4RCH A;  4B1W B;  2ZF5 O;  1LCU A;  5TKY A;  1TKS A;  4FWR A;  3MK5 A;  2I7N A;  5BRH A;  1NLV A;  2YX6 A;  4BRH A;  3CJC A;  3H6E A;  3CCS N;  1PVY A;  5AQJ A;  3HOS A;  4YKE A;  4B1U B;  1X3N A;  1U6Z A;  3D6R A;  2NRR A;  2ASP A;  3CQY A;  1KAX A;  5C0Y A;  1U2V A;  4IO8 A;  3KWG A;  3A5M C;  4FWM A;  3CPE A;  3CET A;  4FWK A;  4I6M A;  4IOA L;  5TKW A;  1NGJ A;  4H5W A;  4YOT A;  1KC8 O;  1HPM A;  4BY9 C;  3VEV A;  3VF2 A;  1JCG A;  3HBT A;  3CPW M;  4JD2 A;  4CZL A;  3JXU A;  1VQ6 N;  4M7Y A;  3L4I A;  3SMS A;  3OA9 A;  3TSP A;  2NRT A;  2NZT A;  3E1Y A;  2P9S A;  4BG8 A;  1C0F A;  1Q82 O;  2VWB A;  3NVK A;  2NRZ A;  3R1X A;  3SMP A;  2GTD A;  2FF6 A;  1KD1 O;  1P90 A;  1VQL N;  1S22 A;  3OHR A;  2WC9 A;  3ENO A;  4CZJ A;  4H5R A;  1BG3 A;  1W97 L;  1XC3 A;  5MLC Q;  3O4W A;  2KLA A;  2QWR A;  3O9S A;  1BOT O;  4H5T A;  2E2Q A;  4FSV A;  3G6E N;  3CCM N;  5LJW A;  3F2K A;  5AQG A;  3UKR A;  4F9O A;  1RDW X;  3H45 C;  2P9N B;  3O6W A;  2P9I A;  2Q1N A;  3L7V A;  3CC2 N;  3S41 A;  3L4Q A;  5AQT A;  1EQY A;  4A5B A;  2QWO A;  1BA0 A;  2YI1 A;  4IO9 L;  3R3L A;  3O9U A;  1SZ2 A;  1KK9 A;  4I14 A;  3OBY A;  2QEX N;  3M1F A;  3A8Y A;  4AF1 A;  1YAG A;  4M63 C;  3ENB A;  3CCV N;  3MN9 A;  4BQL A;  2HF4 A;  3ULE B;  4BGB A;  4BRN A;  5BN9 A;  2OTL N;  4GV3 A;  1IEZ A;  2BUP A;  3KK7 A;  1CZA N;  4DHY A;  3FR0 A;  5DM7 L;  3CER A;  3NMU A;  3MX2 A;  5EY4 A;  3SAH A;  3O9T A;  1U2V B;  5AR0 A;  3EE8 A;  3N4P A;  2BH1 A;  3I8B A;  2QWM A;  2NRV A;  4BGA A;  4C1N K;  4BC5 A;  5GIN A;  2OTJ N;  4B1Z A;  1XQS C;  1JCF A;  2YHX A;  4JHD A;  2RIU A;  3IUC A;  1BA1 A;  3P39 A;  2Q97 A;  3UB5 A;  3LRJ A;  3OW2 M;  3O1W A;  2P9I B;  5AQX A;  3VEO A;  4JHD B;  5GIP A;  4JK8 A;  3G71 N;  1HLU A;  3OBW A;  3VES A;  1YHQ N;  3Q7B A;  3VOV A;  2ZWH A;  3GG4 A;  3P38 A;  4IOC L;  2YCH A;  1M1K O;  3IDH A;  3AAP A;  2I7P A;  5LJV A;  3RSE A;  4CBX A;  3IFR A;  2QWN A;  3K9K A;  4AM7 A;  3T1I A;  4WFA L;  4GVE A;  4JKG B;  2P9S B;  2YHY A;  4JKC A;  1G99 A;  3K9J A;  3N4Q A;  2E2P A;  2CH6 A;  2FSN A;  3FZK A;  3QML A;  4CZI A;  3KZB A;  3E9P A;  4FFJ A;  3LS6 A;  3P4I A;  1T3V A;  4JKE A;  4JKG A;  3DAW A;  4MO4 A;  3WXM B;  4E1J A;  2FSJ A;  4EAH D;  5C12 A;  5HL7 L;  1NWK A;  3RSE B;  2V7Z A;  3U9Z A;  4NLB A;  1HKG A;  1JCU A;  5C15 A;  2P9N A;  3VTI A;  4CJ7 A;  3CC4 N;  3B8A X;  2HBK A;  3AY9 A;  3UKR B;  2E88 A;  4CZH A;  2ASO A;  1YJ9 N;  2D0O A;  3H3O B;  1Q7Y O;  4WYB A;  4P6C A;  3WXJ A;  3VGK A;  3ID6 A;  1BWF O;  1GLC G;  1RDU A;  2CGK A;  2RHK A;  2W41 A;  4B1Y B;  1V4T A;  3QFU A;  5BR9 A;  5FPD A;  1VQM N;  5BRE A;  1NM1 A;  4NZR M;  2HST A;  4YOR A;  1QVF M;  4IFE A;  2ZJR L;  2QI2 A;  2A6A A;  1T44 A;  2A40 A;  3R6M A;  3D2F B;  2E20 A;  1BO5 O;  1YI2 N;  3WT0 A;  5KPT A;  4O8U A;  4AM6 A;  4CD1 A;  4CZE A;  5I9E B;  2FLO A;  3ATU A;  4PL8 A;  1VQN N;  1NGH A;  1TKU A;  2V7Y A;  1BUP A;  3FGU A;  3KHY A;  5AQU A;  4NB4 A;  1J6Z A;  4O8K A;  4FOI A;  4JKB A;  4JKF A;  5CHI A;  1IJJ A;  4NLC A;  4P6D A;  2QWL A;  3R8E A;  1MDU B;  1V4S A;  2E2O A;  3GDQ A;  5EVZ A;  3TPQ A;  4CI6 A;  1O13 A;  3CCU N;  4IEE A;  5EOY A;  4JK7 A;  3ULE A;  1QVG M;  1GLJ O;  3MN7 A;  3U4L A;  5ADX A;  3W3D A;  4BC3 A;  1MWK A;  4BR5 A;  4JKA A;  3T69 A;  1S72 N;  2NRH A;  4FBW A;  4CZK A;  5M1O A;  4G9Z A;  1ILY A;  3O8M A;  3M3Z A;  2PAV A;  5AQZ A;  5BPM A;  3L6Q A;  4XEI A;  5HOO A;  2P9U B;  3P31 A;  4ISE A;  3ZX3 A;  3TU5 A;  1YJW N;  4MDB A;  1EO1 A;  3SLC A;  2ZJP L;  3LM2 A;  3LL3 A;  1TYQ A;  4YOX A;  4H0Y B;  2QXL A;  1JCE A;  2A3Z A;  4L3Q A;  1X9J A;  3U9D A;  3HSC A;  2IVP A;  3LDO A;  4UY8 O;  3WXI A;  5GAH P;  2RE2 A;  1VQO N;  1YUW A;  5E84 A;  4JD2 B;  1YXQ A;  3DXK A;  5GAD P;  4CD3 A;  3MK6 A;  4BRM A;  4RWT A;  3CF5 L;  4BRF A;  3ZET A;  1YF5 L;  4I6M B;  5JLF A;  5M1N A;  4OO1 J;  5KQD A;  5AQM A;  3MN5 A;  4GNI A;  4FCX A;  4HTL A;  2ZGZ A;  5BPL A;  1Q81 O;  1G58 A;  3QBX A;  2E1Y A;  3DXM A;  4Z94 A;  4ILH A;  3PIO L;  3VEX A;  3C6H A;  2A41 A;  3R9P A;  3FZH A;  1GLB G;  3FZL A;  4Y0W A;  4FBK A;  4MLE A;  2WBN A;  4XH1 A;  3FLC O;  3HI0 A;  3W0L A;  2ASM A;  2NNW A;  4H0P A;  4XH4 A;  1YIT N;  3BUZ B;  2OAN A;  5AQF A;  3VET A;  3CCL N;  3C0B A;  4IZ9 A;  5AZJ B;  1WOQ A;  1SAZ A;  2QTD A;  5BRF A;  4M7X A;  4RTF D;  1VQ5 N;  3VEN A;  4GY2 B;  2WUS A;  5M1K A;  4BRC A;  3F9M A;  4JN4 A;  4OPA A;  5B8H A;  2P9L B;  4ILJ A;  5F1X A;  4GV9 A;  4MDA A;  5BN8 A;  3EN9 A;  5LY3 A;  4WQ5 C;  3QFP A;  3A5L C;  3HRG A;  4FWP A;  2ITM A;  1ZC6 A;  4FPA A;  2H3G X;  5GIO A;  3BP8 A;  3IKM A;  4ISF A;  4A59 A;  4BRK A;  4CBW A;  3UKU A;  2QA4 N;  3E66 A;  5FPN A;  3GBT A;  4A5A A;  1QQO A;  3ZEU A;  2YJE A;  3CXC M;  1NGF A;  1VQ4 N;  5F2R A;  1X3M A;  3E9O A;  3WXK A;  4MO5 A;  4WQ4 A;  4NZT M;  2CGJ A;  3LQU A;  2FSK A;  2J4R A;  5AQW A;  4BRA A;  3H1V X;  3T7Z A;  4BR7 A;  3ID8 A;  3WEE B;  3ZX2 A;  4FL9 A;  2IVN A;  5M1Q A;  5AFU H;  2E2N A;  4CZM A;  3H07 A;  4BRO A;  3VGM A;  4MLH A;  1GLL O;  4CZG A;  3SJH A;  3D2E B;  2MX1 A;  1MWM A;  2D4W A;  4A2B A;  4BRE A;  2P9P A;  4JNE A;  4HWI A;  4IEI A;  3FZF A;  3WQT A;  1VQ7 N;  3NVM A;  3VMF B;  2CGL A;  1NGD A;  3MMV A;  4BR9 A;  2VYP A;  1NGA A;  3M6G A;  1XUP O;  5EX5 A;  2Q31 A;  5ADX H;  1NGC A;  1NJI O;  3LM9 A;  4FWS A;  1QHA A;  1DKG D;  1P8Z A;  4BVP A;  3BF3 A;  2A42 A;  4YDU A;  5AQN A;  4EO0 A;  1M90 O;  4O5F A;  4K43 A;  2EQA A;  4P8J A;  1NGI A;  4FWN A;  3SAG A;  1K8K A;  1DGK N;  1NBW A;  3QBW A;  2GUP A;  3MWT A;  2P9K A;  2EWS A;  3CCE N;  3PLA A;  2IVO A;  1VQK N;  5JVG L;  4YOY A;  1KAY A;  1SQK A;  5BPN A;  5AFU A;  1ATN A;  3MGZ A;  1T6D A;  2F7T A;  4KH6 A;  2JWL A;  3AGR A;  3AAR A;  3KWI A;  3HZ6 A;  1ZBS A;  4LC9 B;  5JMV A;  4E1B A;  3D7E O;  2AP1 A;  4IJN A;  4WFN L;  3WQU A;  2FXU A;  4XH5 A;  1KQS M;  4FVU A;  3I55 N;  4ILG B;  1T6C A;  1Q18 A;  3C7N B;  4FPB A;  3MDQ A;  1R59 O;  4H0T B;  5AQP A;  1QQN A;  4P6P A;  4KBO A;  4K25 A;  4FWO A;  1YIJ N;  1IG8 A;  2P9K B;  2ZGY A;  3MIO A;  2HF3 A;  4DB3 A;  1ATS A;  1D4X A;  3VF6 A;  1ESV A;  1KAZ A;  1NGG A;  3JS6 A;  4BR4 A;  4K42 A;  1VAZ A;  1VQ8 N;  5AZI B;  3TSQ A;  4FO0 A;  3CIP A;  4PKH A;  2RIS A;  4FOE A;  5M1P A;  4BRI A;  5GAG P;  5JVH L;  2F9W A;  3GE1 A;  5AQR A;  3EL2 A;  3ZII A;  5AZI A;  3VF4 A;  2ZJQ L;  3BEX A;  3EZW A;  2YJF A;  4FBQ A;  1HJO A;  3L0Q A;  4ISG A;  5CR4 A;  5H1S Q;  1Y64 A;  3FE1 A;  4YOU A;  5AQH A;  3CJB A;  1GLA G;  4DKW A;  3CJ7 A;  2D1K A;  2Q2R A;  3AGK A;  5FPM A;  2PFU A;  1YVN A;  5JIC A;  3MCP A;  4BRQ A;  3C7N A;  4IDH A;  4C1N I;  3I56 N;  1SNN A;  3TSU A;  4A2A A;  3A0I X;  1VQ9 N;  4PKG A;  3HTV A;  3VPZ A;  4QS8 A;  2NLX A;  3J8A A;  3WEE A;  3VGL A;  3FFK B;  5CE3 A;  1VQP N;  1DT9 A;  1OKJ A;  5AQS A;  1PVW A;  1GLF O;  2Q0R A;  1GLE G;  2QM1 A;  3CHW A;  3DWL A;  4YDU C;  4A57 A;  4B1V A;  5F0X A;  4B9Q A;  3CME N;  4DCH A;  3LDQ A;  3M5R A;  4JKD A;  2NRW A;  2CH5 A;  3QIC A;  2GX9 A;  3A5O C;  3QDK A;  4H03 B;  4PL7 A;  1BDG A;  3ATV A;  3ZIH A;  3EO3 A;  4H0O A;  2QWP A;  2QW9 A;  5AQY A;  1XEZ A;  5AQI A;  1NGE A;  2P9L A;  3QB0 A;  2WFB A;  4IXC A;  4BR0 A;  4FWQ A;  3SAF A;  4H5N A;  1MA9 B;  3A5N C;  4EIA A;  2HBL A;  5C2F A;  3VEY A;  4BRP A;  1G57 A;  4PKI A;  2BTF A;  1E4F T;  3VEW A;  2AA4 A;  2P9P B;  3CC7 N;  3AJE A;  3CCR N;  4WF9 L;  3CMA N;  4HVZ A;  5DM6 L;  2HMP A;  2HBJ A;  2JWK A;  2UYT A;  3MCA B;  5AQK A;  4CBU A;  2LN3 A;  2PBD A;  5ELZ A;  3LDP A;  4BC4 A;  2VCP A;  2KKZ A;  1GLD G;  1Z6R A;  3O5B A;  4JEP A;  1DEJ A;  2E1Z A;  3O9R A;  1TUU A;  2GWK A;  1JJ2 M;  3LDN A;  1TUY A;  4PHT X;  3O08 A;  3WXL A;  4BRD A;  3Q7C A;  4WCE L;  4P77 A;  5KQ8 A;  3O80 A;  1NGB A;  3O1B A;  4WQ5 A;  3ZEU B;  3AAQ A;  3C65 A;  3IMX A;  4A62 A;  2KHO A;  5KPR A;  4IOX A;  5AQL A;  4WFB L;  3HOT A;  4U67 L;  1K73 O;  2VGM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...