3TTCA

Crystal structure of e. coli hypf with adp and carbamoyl phosphate
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
total genus 215
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttcA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttcA01
3VETA 3VEOA 3TTFA 3TTDA 3VEZA 3TSQA 3TSPA 3VESA 3VEWA 3VF2A 3VTIA 3VERA 3VENA 3VF4A 3VTHA 3TSUA 3TTCA 3VEXA
chains in the Genus database with same CATH superfamily
3QEIA 3SLCA 4OLAA 4FZYA 5AZIA 4FLXA 4OPHA 4KTZA 4CEBA 3DWLA 1O13A 5CZ2A 4AHUA 3THWB 3RSEA 2P9LB 1U47A 5FLXO 3OYMA 3QB0A 4DFMA 5AQGA 1XMOK 2YI1A 4O8KA 2HHQA 2F8SA 3LP2A 4CJSA 1IV0A 2HW3A 3ULEB 4ELUA 3L3VA 2XHBA 2UUCK 2P9PB 4FJNA 1WSGA 2YNFA 3JAMO 3IUCA 1OH7A 4WFBL 4NO7A 4CI6A 1BCMA 3CD6N 1K49A 4K86A 3FZKA 4FK2A 4DQ8A 3LDSA 3C65A 3VOVA 3IMXA 4BGBA 2X74A 4A62A 4CFBA 3H08A 3TAPA 2HHXA 1CXQA 3L2UA 1T6DA 1JLEA 2GWJA 4X65K 4FJ5A 3L3UA 3ZSOA 3DLEA 1RBRA 3CMEN 4HUEA 2HHHK 3M8SA 3KLHA 5H1SQ 4LF8K 1X3NA 4FFJA 4CHNA 4M3XA 2HF3A 4HUGA 4LSLA 4TWAA 3ATVA 1MU2A 1IG8A 1KTQA 1X9MA 3MWPA 4CIFA 1XNQK 3P4IA 3I8DA 4CGGA 2QWNA 3MN6A 4CZEA 1NGDA 3PX0A 2UXCK 2KW4A 4B9UA 4IG3A 2ZGZA 3NHGA 1BISA 5JVHL 3LZIA 3P31A 3O5BA 4YFUA 1WB9A 1B92A 4NYFA 3A0IX 1QZ5A 4O44A 3CG7A 4MO4A 2NNWA 4CF1A 1LN4A 1BUPA 1OKJA 5CYQA 3ZT3A 2RISA 5HRNA 3VENA 3LM2A 3LDQA 4DSIA 4H0YB 3HSTB 4NCBA 3KK1A 4FJKA 3VQ9A 5KPTA 4FWNA 3DRSA 3CPWM 2QK9A 3R6MA 3F5TA 2F9WA 3C7NB 1EWQA 4M41A 4FWSA 3QLHA 3ZSQA 2ZJQL 4DTMA 4OPKA 2FSJA 4CZFA 4CJKA 1NGGA 4KHPK 1VK0A 1JO0A 2WBNA 3RWUA 2VG7A 4GY2B 4F2SA 1K4IA 4CCHA 5AQFA 1D9DA 1U4BA 1LWEA 3MCAB 2PAVA 1J6ZA 4IO9L 5J2MA 3RRHA 3KKSA 3VGKA 4DV7K 5I9EB 3MN9A 3D2EA 1NMDA 5FPMA 1VQ6N 2BKYX 3LP1A 4H5TA 3QEVA 3SUNA 3A8YA 1NNEA 4DTRA 2D0AA 4EIAA 3V9SA 4IO8A 5CZ1A 1VSDA 4O0IA 5EVZA 2A41A 3IALA 2P9NB 3H1VX 4KO0A 3WXIA 5C2FA 1LV5A 3U6YA 4N5SA 3KK3A 3HP6A 1S9GA 4IFEA 4KV8A 3G6EN 2QWQA 2FF6A 1JLFA 4CE9A 4H0VB 5FRNA 3DRRA 2VG5A 5I3UA 4H5WA 4PKIA 2LSNA 4Y1DA 4DTJA 4GKJK 4BC5A 3LDLA 4JK7A 1ESVA 4CHYA 4DSLA 2XY6A 3W3DA 3RMDA 3FZHA 4B9TA 3J7ZO 3T69A 1WSIA 5FRMA 3LPTA 2NRRA 2OCEA 4B08A 5JLHA 1W7AA 4DR7K 4CESA 1NG9A 3V9ZA 1DCJA 3J7AP 3ZIEA 1C6VA 4HVCA 3NGZA 3I56N 5BPMA 1WBBA 1DEJA 1CZBA 3C0BA 3ZT2A 5EY4A 3VQPA 2Q3SA 1QQCA 1LWCA 1N33K 1VQ4N 3OYAA 3PSFA 5AQWA 3QEPA 1N36K 3CC2N 1C0MA 1KAYA 1T05A 2BUPA 3LAMA 3E1YA 3MK6A 4CD3A 3O9UA 1ASVA 5BR9A 4CHPA 1VQ7N 2IVNA 3CIPA 2FSNA 3TSQA 4M42A 5D3GA 4AF1A 5J2PA 4BVOA 1U04A 3VQQA 2ZWHA 1RDBA 1NK9A 4BC2A 2CGLA 3ITHA 2O8BB 2OZSA 2FXUA 4DR6K 4I9LA 4F2RA 1KLMA 1BO5O 3VEXA 4DV4K 1S1WA 4CZLA 4YOYA 4QOZB 3MN5A 1SL1A 5CR4A 4YORA 3AGRA 2UU9K 3IABA 2CH6A 3ZX2A 4FWPA 3ZX0A 3J8AA 3QDKA 3H07A 2D4WA 4IDKA 2NRXA 1JCUA 1LAVA 1Q81O 2O8EA 3QEWA 4JKHA 1QSSA 1OH5A 3AVGA 1CZAN 1G57A 1ATSA 1Q86O 4JK8A 3P04A 1NBWA 3HM8A 1Z05A 5HBMA 1TGOA 4QS8A 3FE1A 3L4IA 1VAZA 4IBNA 4BRIA 1NK7A 2ZJRL 4P8JA 4JHDA 4MFBA 1BL3A 2IFEA 4XH4A 4OGCA 3QO9A 4K8XA 1RT3A 4ICLA 1MDUB 3D7EO 1SKSA 4FWQA 3J7YP 2J4RA 3L2VA 2HNDA 1MA9B 4FBKA 2P9KA 2M71A 4IWVA 2PYLA 1N32K 3U9DA 1VQ5N 3KVGA 1LW0A 4BDZA 1UWBA 2E6LA 4DU3A 3U3YA 2E5LK 4JI3K 4HTLA 4R5PA 3NF9A 4DQRA 4NZRM 4I6MB 4CZKA 4FJ9A 1TUYA 1S72N 3SQ2A 2R7YA 3LP3A 3SK3A 4DSEA 3GG4A 2JWLA 1B9DA 3ZT1A 1E3MA 2IC3A 3ULDA 2IAJA 4IFYA 4WI1A 3GOIA 2OA8A 2A1SA 4FJMA 4BR5A 5AZJA 3PO5A 4IDHA 4XH5A 3CCSN 5HP1A 1BIUA 4JI1K 3TAQA 4O0JA 3O9QA 4CGIA 4WCEL 3SMSA 4JEPA 3C6TA 1SZ2A 4CHZA 3CMAN 4CGHA 3WXKA 4HVZA 2Q31A 4DS4A 1L3TA 3TAGA 2FBVA 2YCHA 5MLCQ 5AQOA 2WOMA 5AQRA 4CVNE 4FLTA 1JE3A 4DV0K 4RW4A 3BP8A 4ZTFA 4KAZA 4OVLA 2IS3A 3OS0A 1NJ8A 1NJ5A 3M1FA 1C0TA 5AQKA 3V1OA 1VSHA 4H0PA 1EP4A 2Z1HA 3J81O 4QAGA 1VSIA 2P9IA 2KFZA 3AGKA 2CGJA 3DXKA 1XQSC 1YIJN 4CIEA 2B5JA 1J5EK 4CJUA 4N76A 2E2OA 1VRTA 4LH4A 1TAQA 4FWKA 3VTHA 1BDGA 3O3HA 4W5OA 1MWMA 4K43A 3OYBA 3L6QA 3THYA 2NUBA 2HHTA 1UAXA 3CQYA 3NH2A 4BRKA 3VQ4A 3NCIA 4CBWA 3QETA 5AQXA 2A6AA 5J1EA 4DV2K 4AQYK 1BA0A 2YHWA 3UKUB 1LOTB 1IKWA 5KRTA 3SMPA 3DXMB 3I55N 4J2DA 3DRPA 4CERA 3M8QA 4FLYA 3SV4A 4FJGA 1TYQB 5AQVA 4EHUA 4NLCA 3QEXA 4LFAK 3L4QA 5DM7L 1GLJO 1VSKA 4FJ8A 4BR0A 2XO7A 3LWLA 4FPAA 1YJ9N 2Y1JA 4N56A 2CH5A 3OYEA 3B6PA 1IBMK 3FZMA 1WUAA 3LS6A 4F3TA 4ISFA 3A5OC 3OYFA 4ZTJA 4FPBA 4FVUA 1PVWA 1NK6A 3A5MC 1NFHA 3SPYA 1SL0A 1RTDA 3O4NA 1K4OA 4AM6A 1X1PA 1K6YA 4BY9C 4BROA 1JKHA 2P1JA 2B4JA 5HOOA 2E4LA 1HNIA 3WQUA 3ZIIA 4C1NI 2PYJA 4FCYA 1Z26A 1K8KA 2P9BA 2YV0X 1K8AO 1KLNA 4LF7K 1J53A 2QWLA 4PKHA 1KRPA 5JICA 2E20A 2B6AA 4CFCA 5F2RA 2HSTA 4KI6A 3TU5A 2CRQA 4LF6K 4PY5A 3MDQA 3VF4A 3TSUA 1D9FA 1ASWA 4KHQA 3BUZB 3I0SA 4CJ3A 4EP5A 2KZZA 4CEOA 4OLBA 1SNNA 3EE8A 2GUIA 4CF0A 1SAZA 1YXQA 3L2RA 1N6QA 5IT9O 2A3ZA 2IIRA 3WNFA 3K2PA 4JNEA 3HP9A 4H5NA 4NCGA 3AVHA 5E84A 3T1AA 3OS1A 5J2NA 3AVLA 4KPYA 1UA1A 1HRUA 5TKWA 2XY7A 4HCBA 4WYBA 1OVQA 2IVPA 5AQNA 3QFPA 3MIOA 4FWLA 4FM0A 4PHTX 3R8EA 4YDUA 3KJVA 3CQ8A 1TL1A 4A59A 3RR8A 4OKKA 2NRWA 2ZD1A 1V4TA 2CGKA 3MECA 4CEQA 3TAMA 1H4SA 1IBLK 4O4GA 3D6RA 3BZKA 2EWSA 4AM7A 4CJ7A 2AP1A 3DLLL 2HHUA 1ZBFA 2VCPA 4RW6A 4N47A 4OO1J 1ZBHA 3THVA 4KFBA 1S9EA 1BCOA 1NJYA 3THXB 3CCRN 4YOVA 1L5UA 3AAPA 3SI6A 2VYPA 4GV9A 1TVRA 4PQUA 4JRQA 3H46O 1JJ2M 1DT9A 4H4OA 3VN5A 3CCUN 4I9QA 4WQ5C 4TSXA 2AJQA 1Q9YA 3LRJA 4YOUA 5HRSA 2HBJA 3FGUA 4GVMA 3TOEA 2W6KA 4GW6A 3LWMA 3F2KA 4PL7A 4P8EA 1PAVA 2OPPA 2QEXN 3U6FA 3O1BA 3K58A 1I94K 4ILHA 2G8IA 2HMPA 1IKVA 1VQPN 4B1UB 2AA4A 3AARA 4BRQA 4CBXA 4CGFA 3C6HA 2OANA 3LDOA 1WSHA 2UXBK 4CGJA 5F0XA 2OYQA 1L3UA 4RW9A 1HRHA 5ELZA 2O8FA 3ZSYA 1LWFA 2HHVA 4FWRA 4EZ6A 3I8BA 2QXFA 4IG0A 2Y1IA 2OTJN 3DLGA 4CZHA 4JLHA 3HI0A 1VQ8N 4Z4IA 4JKEA 3HOTA 3C94A 4M63C 3KLIA 3N4QA 1C1BA 3LL3A 3CFRA 4WE1A 3O3FA 4CD1A 2GUPA 2KZMA 5C0YA 2H3GX 1RDUA 2ITMA 2HB5A 3MN7A 3AVIA 4I7FA 1ZYQA 3OYGA 4FW1A 3HSCA 3OYIA 3KWIA 1NKEA 4CZIA 1OH8A 1NM1A 3WBMA 3DLHA 2ZJPL 4DR1K 3CC7N 4DTUA 4NLBA 3G4SN 5SWMA 3QFUA 1JLBA 4RW8A 4ID5A 1RDWX 1YAGA 3CCQN 3VQ5A 2X6SA 2QM1A 4L8RB 2YKNA 5AQZA 2GTCA 4JD2B 3ENOA 4HWIA 2G8HA 3IS9A 3SAHA 1OVYA 2YHAA 4RTFD 3ALYA 1L3VA 4IEIA 1RDCA 3NFAA 3LZJA 1RTHA 2RIUA 4ID1A 2W40A 1SS6A 4BDPA 1JLGA 1VSEA 3UKRA 3E9OA 1RBVA 4DR4K 5IWAK 2E88A 1KFSA 5C12A 2EK0A 4FWOA 4RG8A 1FK9A 3CXCM 1UDVA 4DSJA 3P38A 3UIQA 1RTIA 3VEWA 3VA0A 5AQIA 1GLEG 3ASMA 3L8BA 3VGLA 4FBQA 3CJ9A 1YHQN 3NGYA 5BRHA 3AJEA 3HXMA 1T03A 1Y64A 3TTDA 4CECA 1ILYA 4YDQA 2YHBA 3PX4A 1Q7YO 4E7LA 4BREA 2HNYA 1HQUA 4CIGA 3TAFA 1U2VA 1WSJA 3IABB 1Q18A 3A5NC 1RFQA 1RT2A 2RHKA 1VSJA 5AQPA 4PWDA 4ILJA 4JK9A 4BR2A 4WF9L 2D0OA 5JS2A 2YKMA 3NGIA 4MDBA 1NU0A 3EYZA 4Z0UA 2GEMA 3DAWA 5AJ3K 3HPHA 1XUPO 1V4SA 3DOLA 4NXNK 2P9UB 2Q1NA 2HHWA 3OVNA 4E1NA 5GAEP 1N5YA 4J2EA 1SL2A 1HNWK 2G8VA 3MEEA 4KTQA 4JHDB 2EQAA 5CYMA 3KIOA 4C1NK 2UXDK 1II7A 2PY5A 3CJBA 1ZXOA 3ZIHA 3HPGA 4E7IA 3AO3A 4GMJB 5A2QO 4PA1A 3MX5A 2G8KA 4LFCK 3SQ0A 3VETA 3P83D 4HUFA 2I7PA 4DV1K 1NJIO 3DYAA 4BGAA 1KFDA 4B9LA 1D5AA 4CJ4A 2YNIA 2P9LA 3HOSA 4BC4A 3SJHA 2A2YA 3DSCA 3QNNA 3KKRA 4B1ZA 3ULEA 4XIUA 4DQQA 2FBXA 5KQ8A 4BE0A 2P9PA 4CZMA 3L2QA 3EZWA 4DV6K 2O4GA 3QBWA 4ILGB 3HJFA 3OJSA 2L8YA 3O3GA 1T8EA 1GLDG 5TKYA 4CBUA 4DF4A 4DQPA 1YI2N 1A5VA 2FLOA 3AY9A 3NBPA 1N8RO 3HBTA 4CK2A 4DF8A 3KHYA 2HVHA 2X6NA 4FBWA 1KVBA 2WONA 3T7ZA 4RW7A 5M1OA 3VEVA 1WBDA 4DR3K 4FM1A 2DFHA 4JKBA 3OY9A 1EO1A 3TABA 2Q36A 2DY4A 3O6WA 4X64K 2OPSA 1RT6A 4FM2A 2EX3A 3QESA 1TK5A 3KD5E 2E8AA 1HLUA 4CK3A 5C24A 4JI7K 4BRHA 4F9OA 3KK2A 5LL6Z 4YNQA 2QWPA 4LY7A 1ZBUA 4ZHRA 2NRVA 3ID6A 4FZXC 2D0PA 4NYNA 2Z1JA 4EP4A 3AAQA 3DSDA 4IOAL 1XC9A 4YDUC 2JLEA 3S41A 4FK0A 1BI4B 3SBGA 3H3OB 3ZT4A 2ATQA 4P77A 3CCMN 3S3NA 3BY5A 3OYLA 3IRXA 4DSKA 1JCFA 5AQJA 4DLGA 1NGBA 4LF4K 3M6GA 4BWJA 1HJRA 4AHTA 2BDPA 3LDPA 1WN7A 3KD1E 4Q5VA 1HMVA 1DLOA 4B1WB 2JGUA 2W42A 3ZCMA 3TTCA 1C1AA 1NKCA 4H8KA 2OPQA 2P51A 3AVFA 3NDKA 3SCXA 1S1UA 3H1QA 2QWMA 4Z94A 1I39A 3OS2A 3TR8A 4KHUA 1VQ9N 2NZTA 1G99A 3VEYA 3FFIA 4KH6A 3W0LA 1Z6RA 3V1RA 4JI8K 1NK0A 2E1YA 3LP0A 1S5JA 1JCEA 4U7BA 2KQ2A 1X9SA 4FLWA 3PIPL 1TKUA 1UA0A 3MXIA 1S3XA 4KBOA 4BR4A 1QSLA 3SBTA 3PV8A 1TKSA 4FJXA 2P9NA 1NFJA 1KAZA 1YF5L 1C0UA 4E1BA 3E01A 1BGXT 3TPQA 2OTLN 1FJGK 4JN4A 4IFVA 1VSLA 1NJ6A 3VQ6A 1IKYA 3FLCO 2O8CA 4I2QA 1Y2IA 4LSNA 2XY5A 3IKMA 4AHVA 3V4IA 3FR0A 5KPZA 4BC3A 3OA9A 3TSPA 1W0HA 4B9VA 4KTWA 1S1TA 2JWKA 4BQZA 3OYDA 5BN9A 5C25A 4H4MA 1ASUA 4W5QA 1WAJA 1HYSA 4CGDA 2RF2A 1SUQA 3HT3A 1TK0A 3OHRA 4M3UA 1Q82O 1JDQA 3K5OA 2D5RA 2E6MA 4V19S 2V51B 1TAUA 5HRRA 1G58A 1DTTA 3IAYA 3RMAA 4H0XB 4JS5A 1Z25A 1FKOA 2HNZA 4DU1A 3VQDA 2HBKA 5KQDA 5BREA 3EZ5A 4JI6K 3MAQA 3PIOL 3L2WA 5B8HA 2A1RA 3DM2A 4LC9B 3MEDA 4FWMA 3HZ7A 2RKIA 4BR9A 4B9SA 3F9MA 1IKXA 2MX1A 1JCGA 4Z4HA 1NJZA 2XRIA 1DKGD 1GLCG 3MGZA 1GLBG 3CQXA 3OYKA 4IEEA 4A61A 4WQ4A 4KB1A 4WFAL 1RGIA 3AVBA 3ID8A 5AQSA 5BRFA 4FZZA 3OYHA 1L3SA 1NK4A 5JS1A 3K0SA 1U6ZA 2O8BA 2P9SB 5DMRA 3RTVA 3AVNA 1K4PA 1QS4A 2VWBA 4LH5A 3A5LC 1QHAA 3AVJA 4YOTA 4B9MA 3O4WA 1REVA 4HHTA 5C15A 1XEZA 5KTQA 1TL3A 4A2BA 4CFDA 3SAGA 3OJUA 2UUBK 3E66A 4ELTA 1S8EA 1WSEA 3MCPA 2O8DB 3MXMA 1VQMN 2GTDA 4DWIA 3ENBA 3HO1A 1EKEA 1IH7A 3NF6A 2HHSA 3AVKA 3BF1A 1EETA 2QW9A 4NCAA 4B3OA 5SZTA 3U8XA 3WEEB 1PVYA 2EH1A 4FYDA 3ZSVA 3EY1A 5HLFA 3U9ZA 4BRMA 4B8AB 3AO5A 4JI5K 3M3ZA 3P5JA 2QKKA 3V6DA 1NJWA 3TARA 4H0OA 4DMNA 2KKZA 3OYNA 3V81A 3HM9A 4DQSA 4JYAK 5BRDA 1SQKA 4GNIA 5AZIB 3SNNA 3EKUA 1CZ9A 4YOWA 3RSEB 3CCLN 5JMVA 3O08A 4H0TB 1T6CA 4W5TA 5GAHP 2Q0RA 2VG6A 5KI6A 3MXJA 5EX5A 3CCVN 3VQEA 1GOCA 1S1XA 1HYVA 5GADP 1W9HA 1ZC6A 3EN9A 4A5BA 1W97L 4H5RA 5HL7L 2H9UA 2EHGA 3AA4A 3GDQA 3LALA 1VRUA 3VESA 2Q97A 3AA2A 1KAXA 4C8LA 4CJFA 1YVUA 4G1QA 3G25A 2FF3B 2ASMA 3CJ1A 3VMFB 4B3RK 4QS7A 2HBMA 2F9TA 3MMVA 4CEZA 2A5XA 3LVJC 3BZCA 2Y1BA 4CFAA 1J9AA 3RVCA 2Q3VA 4J2BA 1ZBLA 2V52B 4BRPA 3LVKB 3DMJA 4Z4GA 2D0BA 3CC4N 4B3SK 1FXXA 2I7NA 2HOEA 3NVKA 4KH5A 4ELVA 2WC9A 1XMQK 5CHIA 3CCJN 3VQCA 3KLFA 1NGCA 3L0QA 3LPUA 1IJJA 3WUHA 4OKEA 1QE1A 4LF5K 4FL9A 3OW2M 2ETJA 1SV5A 3VERA 1VSMA 2VGMA 2DFEA 2VWJA 4XH1A 4IJNA 5EXWA 3H45C 2ZGYA 1YTUA 1BA1A 1BQNA 1HC7A 3TANA 1HUXA 1RT7A 3QICA 2F7TA 2ASPA 5M1NA 4W5RA 4O5BA 1BQMA 3LAKA 4DSFA 4Y0WA 3UKUA 4W5NA 4MLEA 4H5VA 1NLVA 2VGNA 3JXUA 4B9QA 3DXMA 4OPJA 3CM5A 1RBTA 1BOTO 1WAFA 5C10A 3V9UA 1TYQA 1Q8IA 4P6PA 2WFBA 4DTNA 3GBTA 3MX2A 3CFPA 2YNGA 4IOCL 4MLHA 2Z7CA 1SKWA 2BH1A 1KSPA 3QERA 1NK8A 3S9HA 3ENHA 4I14A 4FJLA 4DCHA 3D2EB 4NB4A 2IOCA 3RR7A 3WNEA 1RBUA 1VSFA 1HKCA 3VA3A 1HX1A 3AA3A 1FW6A 2FBYA 2QWOA 4B9NA 1K7JA 5AQTA 4DQIA 4NXMK 3ZT0A 2QKBA 1S22A 3VEOA 2E2NA 5LJWA 4X62K 3OBWA 3RRGA 4AHRA 5T7BA 2W6LA 4KHSA 1LCUA 1Q9XA 1BG3A 4OJRA 3B6OA 3K5LA 4E19A 1XI1A 3N4PA 4GV3A 1JLQA 1DGKN 1GLFO 3LM9A 3M8PA 3GE1A 4DLEA 2PZSA 4HVJA 3F9KA 3R9PA 3K9JA 1X9WA 3L7VA 3AO2A 4FJJA 4CW7B 1GOAA 3OBYA 1NJ1A 3C6AA 4CJLA 3AA5X 4JKCA 4B1YB 3ZEUA 4E7KA 3QNOA 1YJNN 5FPEA 4OKJA 4DTSA 4HCCA 4YOXA 4CJTA 3AO4A 1CLQA 1EXQA 3HRGA 3VPZA 3DLBA 4CZJA 5DM6L 1RNHA 2G8FA 1XHZA 1QQNA 4J8FA 3QIPA 1UOCA 3CJAA 1A5WA 1DTQA 1KVCA 1WLJA 1D4XA 3O8MA 5HROA 2KFNA 2YHYA 5GIPA 1YITN 3I0RA 1RILA 4WFNL 1RBSA 3HL8A 5AFUH 3O4QA 5GAGP 2GBZA 4DUZK 4MQ3A 2W41A 3O9RA 4A57A 4CZGA 4DUYK 4PKGA 1B9FA 2YHXA 1IBKK 3O1WA 4WQ4C 3MEGA 1RT4A 1S6PA 4E1JA 1JLCA 4CJRA 4B3MK 3D2FA 3CM6A 1JXBA 3K59A 3BEXA 3SQ4A 4JKGA 3K5MA 2QA4N 2GWKA 4L3QA 4DG1A 4BR7A 1QQMA 3F73A 1NOYA 3EE9A 1E4GT 1RT5A 2P5GA 1T44A 3THXA 3CJCA 4DB3A 1RT1A 1D8YA 3SUPA 2O8EB 3ZETA 1NGJA 3VQBA 3K9KA 5E41A 4Z4EA 4IJAA 1KC8O 3ATUA 4DTOA 1QHTA 1R0AA 4Z9EA 3O80A 4K42A 3LQUA 3HZ6A 1HKGA 1HNXK 4O5FA 5FDLA 2E1ZA 5C2DA 5FPDA 1MWKA 3T1HK 4KRFA 4BRGA 5BN8A 3QIOA 4AHCA 4BRCA 1H0XA 2PBDA 4CJEA 4DS5A 4CJVA 1VM0A 4O55A 2LN3A 2Q2RA 3S3MA 5ADXA 3G0ZA 5AQYA 4BE1A 4OLFA 3FFKB 2V7YA 2IGIA 1YVNA 1BWFO 1JL1A 4ISGA 1F21A 4BRDA 3EEQA 4EAHD 1TKTA 1FKPA 4DFJA 3PSIA 2G8WA 3THWA 2P9KB 2IDOA 1Y9XA 1JXEA 5LMUK 1GLAG 3JSMA 1HNVA 3EL2A 1IO2A 3NF8A 3KTQA 1QVFM 4QS9A 1TV6A 4NZTM 3E9PA 2HF4A 2O8CB 1ZBIA 4FXDA 3PLAA 4BG8A 1SKRA 4A5AA 1KXPA 1TIGA 2ASOA 3R1XA 2VWKA 3GL1A 1WOQA 1XHXA 4R79A 4CHOA 1K73O 5AZJB 4K25A 2FBTA 1RDDA 1KQSM 2WTUA 4HTUA 1E4FT 3D45A 3WNHA 2HMIA 5AQHA 2BANA 4JD2A 4AH9A 4OPAA 1YTAA 1HNZK 1HR0K 1WNSA 2I5JA 2GV9A 3H3NO 4CF9A 5LMNK 3RMBA 1TKXA 3VTIA 3CF5L 4E7JA 2BTFA 4DTPA 3NAEA 5M1KA 3CJ7A 4E7HA 3NMUA 4KHYA 1NGEA 4DU4A 4FSVA 3OYJA 2GELA 3V1QA 1G15A 3D0PA 1YJWN 1U48A 1Y97A 4N41A 3AO1A 3KWGA 4P6DA 1GLLO 4HD0A 4LF9K 3QINA 4BRLA 3AVCA 1O1WA 4BWMA 1HPZA 3TI0A 5AFUA 3PX6A 3WNGA 3NVMA 4JKFA 4FK4A 1ATNA 1WSFA 3ZYYX 3K57A 2BE2A 2P9IB 4DHYA 2UUAK 3DXKB 4BQLA 4C8OA 3SYZA 3M8RA 4M3ZA 2KHOA 3HVRA 4DTXA 3C6UA 4CF8A 5KPRA 3KLEA 3THYB 4BRNA 4E1MA 3ZSZA 4M3TA 3T3FA 3IG1A 3VQAA 1EQYA 3DLKA 5C42A 4AILC 2ZE2A 5AQQA 3DI6A 3HVTA 3QKBA 4BACA 3HPOA 3P39A 5EOYA 1JL2A 3BGRA 3V9XA 1JLAA 2YX6A 4C23A 3C7NA 1K4LA 1H1VA 4K0KK 3J80O 4OX9K 4AHSA 1KD1O 3ZIGA 4WQ5A 4H03B 1KK9A 4DKWA 3NF7A 2F8TA 4IZ9A 4DFPA 5CY4A 1S6QA 3SQ1A 3CFOA 3H6EA 3WXMB 2IVOA 3PUFA 3V9WA 4KKOA 4M3RA 4F3OA 4Q15A 1TK8A 4M45A 2P9UA 4EO0A 1QQOA 1NKBA 1M1KO 1XC3A 1K9MO 4FOEA 2O4IA 3ZSRA 2G8UA 4M7YA 1I3AA 4JKDA 4C8KA 2ZF5O 3VQ8A 5LJVA 1P90A 3LANA 1EX4A 1X9JA 3WT0A 3S3OA 3MWTA 3WXLA 1R59O 1GOBA 2VQEK 4BE2A 3C95A 3VEZA 3IFRA 3BF3A 4QCLA 1X3MA 2NLXA 4Q0BA 1K8KB 4RCHA 1NOZA 4KHWA 3T1YK 4FO0A 3HK2A 2GX9A 2DPNA 5F1XA 4CEEA 5KRSA 4PL8A 3UE5A 4IKFA 4EFHA 1OH6A 5GINA 1NH9A 1C0GA 4IXCA 4KI4A 4JI2K 5FROA 3NH0A 2Z1IA 1EWRA 3DLRA 1VQKN 3SPZA 3U3GA 2BGGA 4LFBK 5BR8K 4FJIA 3CERA 1A5XA 2V7ZA 1HYZA 4JRPA 3SJJA 1QSYA 3WXJA 3R3LA 1C0FA 4BVPA 1LAWA 3AVMA 2YJFA 1W2BM 1TKDA 4CK1A 4G9ZA 4X66K 1U45A 1TKZA 4JAXA 2D0CA 1H4QA 2NRZA 2F96A 4FOIA 4EHTA 4Z4FA 4FW2A 2DFFA 3VGMA 4FLZA 4YY3K 3JYTA 5BPNA 4CJ5A 4DV3K 3VQ7A 1XNRK 4BG9A 4K41A 1BI4A 3PO4A 1NJ2A 4JI4K 1H4TA 2XY8A 4BDYA 1IG9A 3M5RA 4E3SA 4CJQA 3BDPA 2F4VK 4NCXA 4BRFA 3MK5A 4CEAA 1YUWA 5HRPA 4J2AA 3SUQA 3KLGA 1RDAA 4A2AA 3NH1A 3DOKA 2FSKA 2Q0UA 3B8AX 4JI0K 1NMNA 4FJHA 1BHLA 3QMLA 3CYMA 4B8CA 2PFUA 3T19A 5K14A 3EKSA 3CCEN 2HBLA 1KVAA 1YT3A 1BU6O 5EU7A 3U4LA 1VR4A 3T1IA 4YKEA 5AQUA 3ZSXA 3ZX3A 4U67L 2A40A 4GVEA 3IDHA 2WUSA 3AVAA 2DTUA 3WQTA 2RE2A 4M3YA 4F8RA 2Z1GA 2RN2A 3SZ2A 1M90O 5M1PA 4B3TK 2ZQBA 5KGWA 1ITGA 3HTVA 1IEZA 4CJPA 3OYCA 3NE6A 1C1CA 5AQMA 4ISEA 4CHQA 3CI5A 4C8NA 4MO5A 4CEFA 2O8FB 4CF2A 3SUOA 5JVGL 4KHNA 1NWKA 4GKKK 1T7PA 5BPLA 4FJ7A 1XWLA 1VQON 1H0YA 3Q7CA 4B1XB 4I6MA 5FPNA 1QZ6A 1KCFA 4DV5K 2OZMA 1NGIA 3KK7A 2E2PA 4P6CA 2P5OA 2KTQA 5GIOA 2LXRA 1VQNN 3ZSWA 1U49A 3DJCA 4UY8O 2FC0A 2UYTA 3G71N 2KLAA 4KB0A 1RTJA 4DFKA 2E2QA 3HYFA 3FZFA 3PY8A 1J54A 3P1GA 4JV5K 5J2QA 3ZEUB 3SAFA 4JS4A 2QTDA 3CPEA 3FZLA 1NK5A 1NGHA 3ISNC 3QBXA 5AR0A 4B1VA 2ITGA 2QXLA 3TAEA 1HQEA 4MDAA 3A2FA 3UB5A 3JS6A 5M1FA 2HVIA 2A42A 2OPRA 5E26A 4I2PA 5KGXA 3UKRB 2ZM6K 1NJXA 4C8MA 4RWTA 4FVMA 2YJEA 5JLFA 3RMCA 1QVGM 3EO3A 3G10A 3K5NA 4KREA 1S1VA 2QI2A 4CEDA 4PUOA 3LDNA 1ZBSA 4O8UA 5LY3A 4DR2K 4IOXA 5M1QA 4M3WA 3AV9A 4EZ9A 4E0DA 2P9SA 3D2FB 3CETA 1NGAA 4YHHK 1VHXA 2VQFK 1CXUA 4K8ZA 4BRAA 5I42A 4JKGB 1QTMA 1TUUA 1P8ZA 4LD0A 1U2VB 4FLVA 4FLUA 1NGFA 3I33A 2X78A 3TTFA 4FCXA 3Q7BA 1HPMA 3KZBA 4OGEA 4UQGA 4CJWA 5DK5A 1HJOA 2NRHA 4DR5K 3SV3A 1VQLN 2O8DA 4M7XA 1N34K 3ZETB 4E89A 5CE3A 4K88A 2RPIA 4JKAA 3OTOK 3CHWA 2NRTA 4XEIA 1J5OA 1LW2A 2YNHA 3TWHA 4K87A 1T3VA 4GV6A 5ADXH 1ATRA 4KH4A 3WEEA 4F4KA 4Z4CA 3O9SA 2D1KA 1BIZA 3E9LA 1RCHA 3O9TA 3ZLJA 1RQ8A 2QWRA 4Y1CA 1HKBA 3VF6A 3VF2A 5AQLA
chains in the Genus database with same CATH topology
3SLCA 5HOOA 1S3XA 2P9KB 4KBOA 4BR4A 5AZIA 3SBTA 1TKSA 3WQUA 4OPHA 3ZIIA 2P9NA 1KAZA 1YF5L 4E1BA 3DWLA 1O13A 3TPQA 4C1NI 3RSEA 2P9LB 2OTLN 1GLAG 4JN4A 1K8KA 3QB0A 2P9BA 3EL2A 5AQGA 2YI1A 1K8AO 4O8KA 2QWLA 4PKHA 3ULEB 1QVFM 3FLCO 5JICA 2E20A 3IKMA 4QS9A 4NZTM 3E9PA 5F2RA 2P9PB 2HF4A 2HSTA 3IUCA 3TU5A 3MDQA 4WFBL 3PLAA 4NO7A 4CI6A 3FR0A 3VF4A 4BC3A 4BG8A 5KPZA 3OA9A 3TSUA 3TSPA 3CD6N 4A5AA 1K49A 1KXPA 2JWKA 3BUZB 2ASOA 3FZKA 3R1XA 4BQZA 3GL1A 1WOQA 4DQ8A 5BN9A 4R79A 1K73O 3C65A 3VOVA 3IMXA 1SNNA 4BGBA 5AZJB 3EE8A 4K25A 4A62A 3OHRA 1KQSM 1Q82O 1T6DA 2GWJA 1E4FT 1SAZA 1YXQA 2V51B 5AQHA 2A3ZA 2IIRA 4JD2A 4OPAA 4JNEA 5E84A 4H5NA 3CMEN 1G58A 3H3NO 4H0XB 3VTIA 3CF5L 5H1SQ 2BTFA 1X3NA 2HBKA 5TKWA 5M1KA 3CJ7A 1HRUA 5KQDA 4FFJA 5BREA 3NMUA 2HF3A 1NGEA 4FSVA 3PIOL 5B8HA 2GELA 3ATVA 4LC9B 4WYBA 2IVPA 1IG8A 4FWMA 5AQNA 1YJWN 3QFPA 3MWPA 3MIOA 4FWLA 3KWGA 4BR9A 3F9MA 4PHTX 3R8EA 4P6DA 1GLLO 4YDUA 2MX1A 3P4IA 1JCGA 4BRLA 4A59A 5AFUA 1DKGD 3NVMA 2NRWA 1GLCG 1V4TA 2CGKA 2QWNA 3MGZA 1GLBG 4JKFA 3CQXA 3MN6A 1ATNA 1NGDA 4CZEA 4IEEA 4A61A 4WQ4A 3ZYYX 4WFAL 1RGIA 2ZGZA 2P9IB 3ID8A 4DHYA 5JVHL 3DXKB 4BQLA 3P31A 5AQSA 5BRFA 3O5BA 3A0IX 1QZ5A 3D6RA 2KHOA 4MO4A 2NNWA 2RISA 2EWSA 1BUPA 1OKJA 4AM7A 2AP1A 1U6ZA 4CJ7A 5KPRA 3DLLL 2P9SB 4BRNA 2VCPA 4OO1J 3VENA 1K4PA 2VWBA 3LM2A 3A5LC 1EQYA 1QHAA 4YOTA 3LDQA 3O4WA 4H0YB 5AQQA 1XEZA 5C15A 4A2BA 4YOVA 3CCRN 3SAGA 3AAPA 3E66A 3P39A 2VYPA 5EOYA 5KPTA 4GV9A 2YX6A 4FWNA 4C23A 3C7NA 3MCPA 3H46O 1K4LA 1H1VA 1JJ2M 1DT9A 3CPWM 1KD1O 3R6MA 3CCUN 3F5TA 3ZIGA 2F9WA 3C7NB 4WQ5C 3LRJA 1VQMN 4WQ5A 2GTDA 4FWSA 4H03B 4YOUA 2HBJA 3ENBA 3FGUA 1KK9A 4DKWA 2ZJQL 4IZ9A 3BF1A 2FSJA 4CZFA 1NGGA 2QW9A 3F2KA 3H6EA 3WXMB 4PL7A 4P8EA 2WBNA 2IVOA 2QEXN 4GY2B 3O1BA 4ILHA 1K4IA 3U8XA 5AQFA 3WEEB 1PVYA 2HMPA 1VQPN 4B1UB 2AA4A 3AARA 3MCAB 2P9UA 4EO0A 2PAVA 1QQOA 1M1KO 1J6ZA 1XC3A 4BRQA 4FOEA 4CBXA 4IO9L 3C6HA 1K9MO 3U9ZA 4M7YA 4BRMA 3VGKA 2OANA 3LDOA 3MN9A 2ZF5O 3M3ZA 4JKDA 5I9EB 3D2EA 5LJVA 1NMDA 1P90A 5FPMA 1VQ6N 4H5TA 5F0XA 1X9JA 3WT0A 4H0OA 3MWTA 2KKZA 3A8YA 3WXLA 5ELZA 1R59O 4EIAA 4IO8A 5BRDA 1SQKA 3VEZA 4GNIA 5AZIB 3IFRA 3BF3A 4FWRA 3EKUA 2A41A 3H1VX 2P9NB 3I8BA 5EVZA 3WXIA 1X3MA 2NLXA 5C2FA 4YOWA 2OTJN 3RSEB 3CCLN 4CZHA 5JMVA 3O08A 1K8KB 4H0TB 4IFEA 1T6CA 4RCHA 3G6EN 3HI0A 1VQ8N 4JKEA 2QWQA 3HOTA 4FO0A 3N4QA 2Q0RA 2FF6A 4M63C 2GX9A 3LL3A 5GAHP 4CD1A 2GUPA 5C0YA 2DPNA 4H0VB 5EX5A 5F1XA 3CCVN 2H3GX 4PL8A 3UE5A 1RDUA 4EFHA 4H5WA 4PKIA 2ITMA 3MN7A 5GINA 5GADP 4BC5A 1ZC6A 3LDLA 4JK7A 1ESVA 3EN9A 1C0GA 3HSCA 3KWIA 4CZIA 4IXCA 1NM1A 4A5BA 2ZJPL 1W97L 4H5RA 3W3DA 5HL7L 3CC7N 3GDQA 1VQKN 4NLBA 3FZHA 3G4SN 3VESA 2Q97A 3QFUA 1KAXA 3J7ZO 3G25A 3T69A 2FF3B 2ASMA 2NRRA 1RDWX 1YAGA 3CJ1A 5JLHA 3CCQN 3VMFB 2QM1A 3CERA 5AQZA 1TKUA 4JD2B 4QS7A 2HBMA 2V7ZA 3ENOA 4HWIA 2F9TA 3MMVA 2A5XA 3ZIEA 3I56N 5BPMA 1DEJA 3WXJA 3R3LA 1C0FA 3C0BA 3SAHA 5EY4A 1OVYA 4BVPA 3RVCA 4RTFD 2YJFA 1W2BM 4G9ZA 1VQ4N 4IEIA 2V52B 4BRPA 5AQWA 2RIUA 3CC2N 2W40A 4JAXA 3CC4N 1KAYA 2HOEA 2I7NA 2BUPA 2NRZA 4FOIA 4EHTA 3E1YA 1SS6A 3MK6A 4KH5A 4CD3A 3NVKA 3O9UA 2WC9A 3VGMA 3UKRA 5AQLA 5BR9A 5BPNA 3E9OA 5CHIA 3CCJN 1VQ7N 2IVNA 1NGCA 2FSNA 3CIPA 3TSQA 3L0QA 4K41A 4BG9A 2E88A 5C12A 1IJJA 4FWOA 4U67L 3CXCM 3WUHA 4AF1A 4FL9A 3P38A 4BVOA 3OW2M 3M5RA 3VEWA 2ZWHA 4BRFA 5AQIA 3VERA 2VGMA 1GLEG 4XH1A 3MK5A 4BC2A 2CGLA 1YUWA 2FXUA 4IJNA 3VGLA 4FBQA 5EXWA 3H45C 3CJ9A 1YHQN 2ZGYA 5BRHA 3AJEA 1BO5O 1BA1A 1Y64A 3VEXA 4CZLA 3TTDA 1HUXA 4A2AA 4YOYA 3MN5A 1ILYA 2FSKA 3QICA 2Q0UA 5CR4A 2F7TA 2ASPA 4BREA 3B8AX 4YORA 3AGRA 5M1NA 1Q7YO 2CH6A 3ZX2A 4FWPA 3ZX0A 3J8AA 3QDKA 4Y0WA 2D4WA 3UKUA 4MLEA 3H07A 4H5VA 3QMLA 1NLVA 1U2VA 2VGNA 2NRXA 3JXUA 4B9QA 1JCUA 3DXMA 1Q81O 1BOTO 2PFUA 1Q18A 3A5NC 3EKSA 4JKHA 3CCEN 1RFQA 2HBLA 2RHKA 1TYQA 5C10A 3U4LA 1BU6O 1CZAN 1G57A 5AQPA 4ILJA 1ATSA 4JK9A 4BR2A 4WF9L 4JK8A 1Q86O 4P6PA 2D0OA 2WFBA 3T1IA 4YKEA 5AQUA 3P04A 1NBWA 3HM8A 3GBTA 3MX2A 1Z05A 4MDBA 3ZX3A 4QS8A 2A40A 2GEMA 3DAWA 4GVEA 3FE1A 3IDHA 2WUSA 3L4IA 1VAZA 4MLHA 4IOCL 1XUPO 1V4SA 2BH1A 4BRIA 2P9UB 3WQTA 2Q1NA 2ZJRL 2RE2A 4P8JA 3ENHA 4JHDA 5GAEP 1M90O 4I14A 5M1PA 4XH4A 4DCHA 3D2EB 4NB4A 3HTVA 2EQAA 1IEZA 4JHDB 4C1NK 1HKCA 5AQMA 1HX1A 4ISEA 1MDUB 3CI5A 4MO5A 3CJBA 1ZXOA 3D7EO 3ZIHA 4FWQA 2QWOA 1K7JA 5JVGL 2J4RA 3MX5A 1NWKA 5AQTA 1MA9B 3VETA 4FBKA 2P9KA 4IWVA 2I7PA 5BPLA 1NJIO 4BGAA 3U9DA 1VQ5N 3KVGA 1VQON 1S22A 2P9LA 3HOSA 3Q7CA 3VEOA 4B1XB 4BC4A 4I6MA 3SJHA 2E2NA 5FPNA 5LJWA 1QZ6A 4HTLA 3OBWA 4B1ZA 1NGIA 3KK7A 4NZRM 3ULEA 4I6MB 2E2PA 4P6CA 4CZKA 1LCUA 5KQ8A 1TUYA 1S72N 2P9PA 1BG3A 4CZMA 3EZWA 5GIOA 3SK3A 3QBWA 3GG4A 4ILGB 3N4PA 1VQNN 4GV3A 2JWLA 3DJCA 1GLDG 4UY8O 5TKYA 1DGKN 1GLFO 3LM9A 4CBUA 3GE1A 3GOIA 3R9PA 3K9JA 1YI2N 2FLOA 3AY9A 1N8RO 2UYTA 3HBTA 3L7VA 3G71N 2KLAA 4BR5A 5AZJA 3KHYA 3OBYA 4FBWA 4IDHA 3C6AA 4XH5A 2E2QA 3CCSN 3T7ZA 4JKCA 5M1OA 4B1YB 3VEVA 3ZEUA 1YJNN 5FPEA 3O9QA 3FZFA 4JKBA 1EO1A 4WCEL 4YOXA 2Q36A 3SMSA 3O6WA 3ZEUB 4JEPA 3SAFA 3HRGA 3VPZA 1SZ2A 2QTDA 3CPEA 4CZJA 3CMAN 3FZLA 5DM6L 2E8AA 3WXKA 1HLUA 4HVZA 2Q31A 1NGHA 2YCHA 3QBXA 5AR0A 4BRHA 4B1VA 5MLCQ 4F9OA 5AQOA 1QQNA 4J8FA 2QXLA 5AQRA 2QWPA 3CJAA 4MDAA 3JS6A 3UB5A 5M1FA 2A42A 1D4XA 5E26A 3O8MA 2NRVA 3ID6A 3UKRB 2YHYA 5GIPA 3BP8A 2D0PA 1YITN 4RWTA 4WFNL 5GAGP 3AAQA 5AFUH 4IOAL 3M1FA 4YDUC 3S41A 2YJEA 5AQKA 5JLFA 2W41A 3SBGA 4H0PA 3H3OB 3O9RA 4A57A 1QVGM 4CZGA 3EO3A 4PKGA 2P9IA 4P77A 2YHXA 2QI2A 3AGKA 3O1WA 2CGJA 3DXKA 4WQ4C 3CCMN 1XQSC 1YIJN 4E1JA 3LDNA 3D2FA 1ZBSA 2E2OA 4O8UA 5LY3A 3VTHA 1BDGA 4IOXA 5M1QA 3BEXA 1MWMA 4K43A 1JCFA 4JKGA 3L6QA 2QA4N 5AQJA 2GWKA 2P9SA 3CETA 1NGAA 3D2FB 4L3QA 4BR7A 3CQYA 4BRKA 1QQMA 4CBWA 4BRAA 1NGBA 4JKGB 3EE9A 5AQXA 1E4GT 2A6AA 3M6GA 1TUUA 1T44A 1BA0A 2YHWA 1P8ZA 3UKUB 1LOTB 3CJCA 1U2VB 4DB3A 3LDPA 3SMPA 1NGFA 3I33A 3DXMB 3TTFA 4FCXA 3Q7BA 1HPMA 3KZBA 3I55N 4B1WB 1HJOA 2NRHA 3ZETA 1NGJA 1VQLN 3K9KA 3TTCA 1TYQB 5AQVA 4IJAA 4EHUA 4NLCA 1KC8O 3L4QA 3ATUA 4M7XA 3ZETB 5CE3A 5DM7L 1GLJO 4JKAA 3O80A 3CHWA 3H1QA 4K42A 3LQUA 3HZ6A 1HKGA 2QWMA 4O5FA 4Z94A 4BR0A 2E1ZA 2NRTA 4XEIA 5C2DA 5FPDA 1MWKA 4FPAA 1YJ9N 4BRGA 1VQ9N 5BN8A 2NZTA 1G99A 1T3VA 4BRCA 2CH5A 4GV6A 2PBDA 3VEYA 5ADXH 1ATRA 4KH4A 3WEEA 3FZMA 1WUAA 3LS6A 3O9SA 4ISFA 3A5OC 2D1KA 2LN3A 4FPBA 4FVUA 2Q2RA 1PVWA 4KH6A 3A5MC 3W0LA 1Z6RA 5ADXA 3E9LA 5AQYA 3FFKB 2E1YA 2V7YA 3O9TA 1YVNA 1BWFO 4ISGA 1K4OA 1JCEA 4U7BA 4BRDA 2QWRA 4EAHD 4AM6A 4BY9C 3PIPL 4BROA 1HKBA 3VF6A 3VF2A 4FWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VET A;  3VEO A;  3TTF A;  3TTD A;  3VEZ A;  3TSQ A;  3TSP A;  3VES A;  3VEW A;  3VF2 A;  3VTI A;  3VER A;  3VEN A;  3VF4 A;  3VTH A;  3TSU A;  3TTC A;  3VEX A; 
#chains in the Genus database with same CATH topology
 3QEI A;  3SLC A;  4OLA A;  4FZY A;  5AZI A;  4FLX A;  4OPH A;  4KTZ A;  4CEB A;  3DWL A;  1O13 A;  5CZ2 A;  4AHU A;  3THW B;  3RSE A;  2P9L B;  1U47 A;  5FLX O;  3OYM A;  3QB0 A;  4DFM A;  5AQG A;  1XMO K;  2YI1 A;  4O8K A;  2HHQ A;  2F8S A;  3LP2 A;  4CJS A;  1IV0 A;  2HW3 A;  3ULE B;  4ELU A;  3L3V A;  2XHB A;  2UUC K;  2P9P B;  4FJN A;  1WSG A;  2YNF A;  3JAM O;  3IUC A;  1OH7 A;  4WFB L;  4NO7 A;  4CI6 A;  1BCM A;  3CD6 N;  1K49 A;  4K86 A;  3FZK A;  4FK2 A;  4DQ8 A;  3LDS A;  3C65 A;  3VOV A;  3IMX A;  4BGB A;  2X74 A;  4A62 A;  4CFB A;  3H08 A;  3TAP A;  2HHX A;  1CXQ A;  3L2U A;  1T6D A;  1JLE A;  2GWJ A;  4X65 K;  4FJ5 A;  3L3U A;  3ZSO A;  3DLE A;  1RBR A;  3CME N;  4HUE A;  2HHH K;  3M8S A;  3KLH A;  5H1S Q;  4LF8 K;  1X3N A;  4FFJ A;  4CHN A;  4M3X A;  2HF3 A;  4HUG A;  4LSL A;  4TWA A;  3ATV A;  1MU2 A;  1IG8 A;  1KTQ A;  1X9M A;  3MWP A;  4CIF A;  1XNQ K;  3P4I A;  3I8D A;  4CGG A;  2QWN A;  3MN6 A;  4CZE A;  1NGD A;  3PX0 A;  2UXC K;  2KW4 A;  4B9U A;  4IG3 A;  2ZGZ A;  3NHG A;  1BIS A;  5JVH L;  3LZI A;  3P31 A;  3O5B A;  4YFU A;  1WB9 A;  1B92 A;  4NYF A;  3A0I X;  1QZ5 A;  4O44 A;  3CG7 A;  4MO4 A;  2NNW A;  4CF1 A;  1LN4 A;  1BUP A;  1OKJ A;  5CYQ A;  3ZT3 A;  2RIS A;  5HRN A;  3VEN A;  3LM2 A;  3LDQ A;  4DSI A;  4H0Y B;  3HST B;  4NCB A;  3KK1 A;  4FJK A;  3VQ9 A;  5KPT A;  4FWN A;  3DRS A;  3CPW M;  2QK9 A;  3R6M A;  3F5T A;  2F9W A;  3C7N B;  1EWQ A;  4M41 A;  4FWS A;  3QLH A;  3ZSQ A;  2ZJQ L;  4DTM A;  4OPK A;  2FSJ A;  4CZF A;  4CJK A;  1NGG A;  4KHP K;  1VK0 A;  1JO0 A;  2WBN A;  3RWU A;  2VG7 A;  4GY2 B;  4F2S A;  1K4I A;  4CCH A;  5AQF A;  1D9D A;  1U4B A;  1LWE A;  3MCA B;  2PAV A;  1J6Z A;  4IO9 L;  5J2M A;  3RRH A;  3KKS A;  3VGK A;  4DV7 K;  5I9E B;  3MN9 A;  3D2E A;  1NMD A;  5FPM A;  1VQ6 N;  2BKY X;  3LP1 A;  4H5T A;  3QEV A;  3SUN A;  3A8Y A;  1NNE A;  4DTR A;  2D0A A;  4EIA A;  3V9S A;  4IO8 A;  5CZ1 A;  1VSD A;  4O0I A;  5EVZ A;  2A41 A;  3IAL A;  2P9N B;  3H1V X;  4KO0 A;  3WXI A;  5C2F A;  1LV5 A;  3U6Y A;  4N5S A;  3KK3 A;  3HP6 A;  1S9G A;  4IFE A;  4KV8 A;  3G6E N;  2QWQ A;  2FF6 A;  1JLF A;  4CE9 A;  4H0V B;  5FRN A;  3DRR A;  2VG5 A;  5I3U A;  4H5W A;  4PKI A;  2LSN A;  4Y1D A;  4DTJ A;  4GKJ K;  4BC5 A;  3LDL A;  4JK7 A;  1ESV A;  4CHY A;  4DSL A;  2XY6 A;  3W3D A;  3RMD A;  3FZH A;  4B9T A;  3J7Z O;  3T69 A;  1WSI A;  5FRM A;  3LPT A;  2NRR A;  2OCE A;  4B08 A;  5JLH A;  1W7A A;  4DR7 K;  4CES A;  1NG9 A;  3V9Z A;  1DCJ A;  3J7A P;  3ZIE A;  1C6V A;  4HVC A;  3NGZ A;  3I56 N;  5BPM A;  1WBB A;  1DEJ A;  1CZB A;  3C0B A;  3ZT2 A;  5EY4 A;  3VQP A;  2Q3S A;  1QQC A;  1LWC A;  1N33 K;  1VQ4 N;  3OYA A;  3PSF A;  5AQW A;  3QEP A;  1N36 K;  3CC2 N;  1C0M A;  1KAY A;  1T05 A;  2BUP A;  3LAM A;  3E1Y A;  3MK6 A;  4CD3 A;  3O9U A;  1ASV A;  5BR9 A;  4CHP A;  1VQ7 N;  2IVN A;  3CIP A;  2FSN A;  3TSQ A;  4M42 A;  5D3G A;  4AF1 A;  5J2P A;  4BVO A;  1U04 A;  3VQQ A;  2ZWH A;  1RDB A;  1NK9 A;  4BC2 A;  2CGL A;  3ITH A;  2O8B B;  2OZS A;  2FXU A;  4DR6 K;  4I9L A;  4F2R A;  1KLM A;  1BO5 O;  3VEX A;  4DV4 K;  1S1W A;  4CZL A;  4YOY A;  4QOZ B;  3MN5 A;  1SL1 A;  5CR4 A;  4YOR A;  3AGR A;  2UU9 K;  3IAB A;  2CH6 A;  3ZX2 A;  4FWP A;  3ZX0 A;  3J8A A;  3QDK A;  3H07 A;  2D4W A;  4IDK A;  2NRX A;  1JCU A;  1LAV A;  1Q81 O;  2O8E A;  3QEW A;  4JKH A;  1QSS A;  1OH5 A;  3AVG A;  1CZA N;  1G57 A;  1ATS A;  1Q86 O;  4JK8 A;  3P04 A;  1NBW A;  3HM8 A;  1Z05 A;  5HBM A;  1TGO A;  4QS8 A;  3FE1 A;  3L4I A;  1VAZ A;  4IBN A;  4BRI A;  1NK7 A;  2ZJR L;  4P8J A;  4JHD A;  4MFB A;  1BL3 A;  2IFE A;  4XH4 A;  4OGC A;  3QO9 A;  4K8X A;  1RT3 A;  4ICL A;  1MDU B;  3D7E O;  1SKS A;  4FWQ A;  3J7Y P;  2J4R A;  3L2V A;  2HND A;  1MA9 B;  4FBK A;  2P9K A;  2M71 A;  4IWV A;  2PYL A;  1N32 K;  3U9D A;  1VQ5 N;  3KVG A;  1LW0 A;  4BDZ A;  1UWB A;  2E6L A;  4DU3 A;  3U3Y A;  2E5L K;  4JI3 K;  4HTL A;  4R5P A;  3NF9 A;  4DQR A;  4NZR M;  4I6M B;  4CZK A;  4FJ9 A;  1TUY A;  1S72 N;  3SQ2 A;  2R7Y A;  3LP3 A;  3SK3 A;  4DSE A;  3GG4 A;  2JWL A;  1B9D A;  3ZT1 A;  1E3M A;  2IC3 A;  3ULD A;  2IAJ A;  4IFY A;  4WI1 A;  3GOI A;  2OA8 A;  2A1S A;  4FJM A;  4BR5 A;  5AZJ A;  3PO5 A;  4IDH A;  4XH5 A;  3CCS N;  5HP1 A;  1BIU A;  4JI1 K;  3TAQ A;  4O0J A;  3O9Q A;  4CGI A;  4WCE L;  3SMS A;  4JEP A;  3C6T A;  1SZ2 A;  4CHZ A;  3CMA N;  4CGH A;  3WXK A;  4HVZ A;  2Q31 A;  4DS4 A;  1L3T A;  3TAG A;  2FBV A;  2YCH A;  5MLC Q;  5AQO A;  2WOM A;  5AQR A;  4CVN E;  4FLT A;  1JE3 A;  4DV0 K;  4RW4 A;  3BP8 A;  4ZTF A;  4KAZ A;  4OVL A;  2IS3 A;  3OS0 A;  1NJ8 A;  1NJ5 A;  3M1F A;  1C0T A;  5AQK A;  3V1O A;  1VSH A;  4H0P A;  1EP4 A;  2Z1H A;  3J81 O;  4QAG A;  1VSI A;  2P9I A;  2KFZ A;  3AGK A;  2CGJ A;  3DXK A;  1XQS C;  1YIJ N;  4CIE A;  2B5J A;  1J5E K;  4CJU A;  4N76 A;  2E2O A;  1VRT A;  4LH4 A;  1TAQ A;  4FWK A;  3VTH A;  1BDG A;  3O3H A;  4W5O A;  1MWM A;  4K43 A;  3OYB A;  3L6Q A;  3THY A;  2NUB A;  2HHT A;  1UAX A;  3CQY A;  3NH2 A;  4BRK A;  3VQ4 A;  3NCI A;  4CBW A;  3QET A;  5AQX A;  2A6A A;  5J1E A;  4DV2 K;  4AQY K;  1BA0 A;  2YHW A;  3UKU B;  1LOT B;  1IKW A;  5KRT A;  3SMP A;  3DXM B;  3I55 N;  4J2D A;  3DRP A;  4CER A;  3M8Q A;  4FLY A;  3SV4 A;  4FJG A;  1TYQ B;  5AQV A;  4EHU A;  4NLC A;  3QEX A;  4LFA K;  3L4Q A;  5DM7 L;  1GLJ O;  1VSK A;  4FJ8 A;  4BR0 A;  2XO7 A;  3LWL A;  4FPA A;  1YJ9 N;  2Y1J A;  4N56 A;  2CH5 A;  3OYE A;  3B6P A;  1IBM K;  3FZM A;  1WUA A;  3LS6 A;  4F3T A;  4ISF A;  3A5O C;  3OYF A;  4ZTJ A;  4FPB A;  4FVU A;  1PVW A;  1NK6 A;  3A5M C;  1NFH A;  3SPY A;  1SL0 A;  1RTD A;  3O4N A;  1K4O A;  4AM6 A;  1X1P A;  1K6Y A;  4BY9 C;  4BRO A;  1JKH A;  2P1J A;  2B4J A;  5HOO A;  2E4L A;  1HNI A;  3WQU A;  3ZII A;  4C1N I;  2PYJ A;  4FCY A;  1Z26 A;  1K8K A;  2P9B A;  2YV0 X;  1K8A O;  1KLN A;  4LF7 K;  1J53 A;  2QWL A;  4PKH A;  1KRP A;  5JIC A;  2E20 A;  2B6A A;  4CFC A;  5F2R A;  2HST A;  4KI6 A;  3TU5 A;  2CRQ A;  4LF6 K;  4PY5 A;  3MDQ A;  3VF4 A;  3TSU A;  1D9F A;  1ASW A;  4KHQ A;  3BUZ B;  3I0S A;  4CJ3 A;  4EP5 A;  2KZZ A;  4CEO A;  4OLB A;  1SNN A;  3EE8 A;  2GUI A;  4CF0 A;  1SAZ A;  1YXQ A;  3L2R A;  1N6Q A;  5IT9 O;  2A3Z A;  2IIR A;  3WNF A;  3K2P A;  4JNE A;  3HP9 A;  4H5N A;  4NCG A;  3AVH A;  5E84 A;  3T1A A;  3OS1 A;  5J2N A;  3AVL A;  4KPY A;  1UA1 A;  1HRU A;  5TKW A;  2XY7 A;  4HCB A;  4WYB A;  1OVQ A;  2IVP A;  5AQN A;  3QFP A;  3MIO A;  4FWL A;  4FM0 A;  4PHT X;  3R8E A;  4YDU A;  3KJV A;  3CQ8 A;  1TL1 A;  4A59 A;  3RR8 A;  4OKK A;  2NRW A;  2ZD1 A;  1V4T A;  2CGK A;  3MEC A;  4CEQ A;  3TAM A;  1H4S A;  1IBL K;  4O4G A;  3D6R A;  3BZK A;  2EWS A;  4AM7 A;  4CJ7 A;  2AP1 A;  3DLL L;  2HHU A;  1ZBF A;  2VCP A;  4RW6 A;  4N47 A;  4OO1 J;  1ZBH A;  3THV A;  4KFB A;  1S9E A;  1BCO A;  1NJY A;  3THX B;  3CCR N;  4YOV A;  1L5U A;  3AAP A;  3SI6 A;  2VYP A;  4GV9 A;  1TVR A;  4PQU A;  4JRQ A;  3H46 O;  1JJ2 M;  1DT9 A;  4H4O A;  3VN5 A;  3CCU N;  4I9Q A;  4WQ5 C;  4TSX A;  2AJQ A;  1Q9Y A;  3LRJ A;  4YOU A;  5HRS A;  2HBJ A;  3FGU A;  4GVM A;  3TOE A;  2W6K A;  4GW6 A;  3LWM A;  3F2K A;  4PL7 A;  4P8E A;  1PAV A;  2OPP A;  2QEX N;  3U6F A;  3O1B A;  3K58 A;  1I94 K;  4ILH A;  2G8I A;  2HMP A;  1IKV A;  1VQP N;  4B1U B;  2AA4 A;  3AAR A;  4BRQ A;  4CBX A;  4CGF A;  3C6H A;  2OAN A;  3LDO A;  1WSH A;  2UXB K;  4CGJ A;  5F0X A;  2OYQ A;  1L3U A;  4RW9 A;  1HRH A;  5ELZ A;  2O8F A;  3ZSY A;  1LWF A;  2HHV A;  4FWR A;  4EZ6 A;  3I8B A;  2QXF A;  4IG0 A;  2Y1I A;  2OTJ N;  3DLG A;  4CZH A;  4JLH A;  3HI0 A;  1VQ8 N;  4Z4I A;  4JKE A;  3HOT A;  3C94 A;  4M63 C;  3KLI A;  3N4Q A;  1C1B A;  3LL3 A;  3CFR A;  4WE1 A;  3O3F A;  4CD1 A;  2GUP A;  2KZM A;  5C0Y A;  2H3G X;  1RDU A;  2ITM A;  2HB5 A;  3MN7 A;  3AVI A;  4I7F A;  1ZYQ A;  3OYG A;  4FW1 A;  3HSC A;  3OYI A;  3KWI A;  1NKE A;  4CZI A;  1OH8 A;  1NM1 A;  3WBM A;  3DLH A;  2ZJP L;  4DR1 K;  3CC7 N;  4DTU A;  4NLB A;  3G4S N;  5SWM A;  3QFU A;  1JLB A;  4RW8 A;  4ID5 A;  1RDW X;  1YAG A;  3CCQ N;  3VQ5 A;  2X6S A;  2QM1 A;  4L8R B;  2YKN A;  5AQZ A;  2GTC A;  4JD2 B;  3ENO A;  4HWI A;  2G8H A;  3IS9 A;  3SAH A;  1OVY A;  2YHA A;  4RTF D;  3ALY A;  1L3V A;  4IEI A;  1RDC A;  3NFA A;  3LZJ A;  1RTH A;  2RIU A;  4ID1 A;  2W40 A;  1SS6 A;  4BDP A;  1JLG A;  1VSE A;  3UKR A;  3E9O A;  1RBV A;  4DR4 K;  5IWA K;  2E88 A;  1KFS A;  5C12 A;  2EK0 A;  4FWO A;  4RG8 A;  1FK9 A;  3CXC M;  1UDV A;  4DSJ A;  3P38 A;  3UIQ A;  1RTI A;  3VEW A;  3VA0 A;  5AQI A;  1GLE G;  3ASM A;  3L8B A;  3VGL A;  4FBQ A;  3CJ9 A;  1YHQ N;  3NGY A;  5BRH A;  3AJE A;  3HXM A;  1T03 A;  1Y64 A;  3TTD A;  4CEC A;  1ILY A;  4YDQ A;  2YHB A;  3PX4 A;  1Q7Y O;  4E7L A;  4BRE A;  2HNY A;  1HQU A;  4CIG A;  3TAF A;  1U2V A;  1WSJ A;  3IAB B;  1Q18 A;  3A5N C;  1RFQ A;  1RT2 A;  2RHK A;  1VSJ A;  5AQP A;  4PWD A;  4ILJ A;  4JK9 A;  4BR2 A;  4WF9 L;  2D0O A;  5JS2 A;  2YKM A;  3NGI A;  4MDB A;  1NU0 A;  3EYZ A;  4Z0U A;  2GEM A;  3DAW A;  5AJ3 K;  3HPH A;  1XUP O;  1V4S A;  3DOL A;  4NXN K;  2P9U B;  2Q1N A;  2HHW A;  3OVN A;  4E1N A;  5GAE P;  1N5Y A;  4J2E A;  1SL2 A;  1HNW K;  2G8V A;  3MEE A;  4KTQ A;  4JHD B;  2EQA A;  5CYM A;  3KIO A;  4C1N K;  2UXD K;  1II7 A;  2PY5 A;  3CJB A;  1ZXO A;  3ZIH A;  3HPG A;  4E7I A;  3AO3 A;  4GMJ B;  5A2Q O;  4PA1 A;  3MX5 A;  2G8K A;  4LFC K;  3SQ0 A;  3VET A;  3P83 D;  4HUF A;  2I7P A;  4DV1 K;  1NJI O;  3DYA A;  4BGA A;  1KFD A;  4B9L A;  1D5A A;  4CJ4 A;  2YNI A;  2P9L A;  3HOS A;  4BC4 A;  3SJH A;  2A2Y A;  3DSC A;  3QNN A;  3KKR A;  4B1Z A;  3ULE A;  4XIU A;  4DQQ A;  2FBX A;  5KQ8 A;  4BE0 A;  2P9P A;  4CZM A;  3L2Q A;  3EZW A;  4DV6 K;  2O4G A;  3QBW A;  4ILG B;  3HJF A;  3OJS A;  2L8Y A;  3O3G A;  1T8E A;  1GLD G;  5TKY A;  4CBU A;  4DF4 A;  4DQP A;  1YI2 N;  1A5V A;  2FLO A;  3AY9 A;  3NBP A;  1N8R O;  3HBT A;  4CK2 A;  4DF8 A;  3KHY A;  2HVH A;  2X6N A;  4FBW A;  1KVB A;  2WON A;  3T7Z A;  4RW7 A;  5M1O A;  3VEV A;  1WBD A;  4DR3 K;  4FM1 A;  2DFH A;  4JKB A;  3OY9 A;  1EO1 A;  3TAB A;  2Q36 A;  2DY4 A;  3O6W A;  4X64 K;  2OPS A;  1RT6 A;  4FM2 A;  2EX3 A;  3QES A;  1TK5 A;  3KD5 E;  2E8A A;  1HLU A;  4CK3 A;  5C24 A;  4JI7 K;  4BRH A;  4F9O A;  3KK2 A;  5LL6 Z;  4YNQ A;  2QWP A;  4LY7 A;  1ZBU A;  4ZHR A;  2NRV A;  3ID6 A;  4FZX C;  2D0P A;  4NYN A;  2Z1J A;  4EP4 A;  3AAQ A;  3DSD A;  4IOA L;  1XC9 A;  4YDU C;  2JLE A;  3S41 A;  4FK0 A;  1BI4 B;  3SBG A;  3H3O B;  3ZT4 A;  2ATQ A;  4P77 A;  3CCM N;  3S3N A;  3BY5 A;  3OYL A;  3IRX A;  4DSK A;  1JCF A;  5AQJ A;  4DLG A;  1NGB A;  4LF4 K;  3M6G A;  4BWJ A;  1HJR A;  4AHT A;  2BDP A;  3LDP A;  1WN7 A;  3KD1 E;  4Q5V A;  1HMV A;  1DLO A;  4B1W B;  2JGU A;  2W42 A;  3ZCM A;  3TTC A;  1C1A A;  1NKC A;  4H8K A;  2OPQ A;  2P51 A;  3AVF A;  3NDK A;  3SCX A;  1S1U A;  3H1Q A;  2QWM A;  4Z94 A;  1I39 A;  3OS2 A;  3TR8 A;  4KHU A;  1VQ9 N;  2NZT A;  1G99 A;  3VEY A;  3FFI A;  4KH6 A;  3W0L A;  1Z6R A;  3V1R A;  4JI8 K;  1NK0 A;  2E1Y A;  3LP0 A;  1S5J A;  1JCE A;  4U7B A;  2KQ2 A;  1X9S A;  4FLW A;  3PIP L;  1TKU A;  1UA0 A;  3MXI A;  1S3X A;  4KBO A;  4BR4 A;  1QSL A;  3SBT A;  3PV8 A;  1TKS A;  4FJX A;  2P9N A;  1NFJ A;  1KAZ A;  1YF5 L;  1C0U A;  4E1B A;  3E01 A;  1BGX T;  3TPQ A;  2OTL N;  1FJG K;  4JN4 A;  4IFV A;  1VSL A;  1NJ6 A;  3VQ6 A;  1IKY A;  3FLC O;  2O8C A;  4I2Q A;  1Y2I A;  4LSN A;  2XY5 A;  3IKM A;  4AHV A;  3V4I A;  3FR0 A;  5KPZ A;  4BC3 A;  3OA9 A;  3TSP A;  1W0H A;  4B9V A;  4KTW A;  1S1T A;  2JWK A;  4BQZ A;  3OYD A;  5BN9 A;  5C25 A;  4H4M A;  1ASU A;  4W5Q A;  1WAJ A;  1HYS A;  4CGD A;  2RF2 A;  1SUQ A;  3HT3 A;  1TK0 A;  3OHR A;  4M3U A;  1Q82 O;  1JDQ A;  3K5O A;  2D5R A;  2E6M A;  4V19 S;  2V51 B;  1TAU A;  5HRR A;  1G58 A;  1DTT A;  3IAY A;  3RMA A;  4H0X B;  4JS5 A;  1Z25 A;  1FKO A;  2HNZ A;  4DU1 A;  3VQD A;  2HBK A;  5KQD A;  5BRE A;  3EZ5 A;  4JI6 K;  3MAQ A;  3PIO L;  3L2W A;  5B8H A;  2A1R A;  3DM2 A;  4LC9 B;  3MED A;  4FWM A;  3HZ7 A;  2RKI A;  4BR9 A;  4B9S A;  3F9M A;  1IKX A;  2MX1 A;  1JCG A;  4Z4H A;  1NJZ A;  2XRI A;  1DKG D;  1GLC G;  3MGZ A;  1GLB G;  3CQX A;  3OYK A;  4IEE A;  4A61 A;  4WQ4 A;  4KB1 A;  4WFA L;  1RGI A;  3AVB A;  3ID8 A;  5AQS A;  5BRF A;  4FZZ A;  3OYH A;  1L3S A;  1NK4 A;  5JS1 A;  3K0S A;  1U6Z A;  2O8B A;  2P9S B;  5DMR A;  3RTV A;  3AVN A;  1K4P A;  1QS4 A;  2VWB A;  4LH5 A;  3A5L C;  1QHA A;  3AVJ A;  4YOT A;  4B9M A;  3O4W A;  1REV A;  4HHT A;  5C15 A;  1XEZ A;  5KTQ A;  1TL3 A;  4A2B A;  4CFD A;  3SAG A;  3OJU A;  2UUB K;  3E66 A;  4ELT A;  1S8E A;  1WSE A;  3MCP A;  2O8D B;  3MXM A;  1VQM N;  2GTD A;  4DWI A;  3ENB A;  3HO1 A;  1EKE A;  1IH7 A;  3NF6 A;  2HHS A;  3AVK A;  3BF1 A;  1EET A;  2QW9 A;  4NCA A;  4B3O A;  5SZT A;  3U8X A;  3WEE B;  1PVY A;  2EH1 A;  4FYD A;  3ZSV A;  3EY1 A;  5HLF A;  3U9Z A;  4BRM A;  4B8A B;  3AO5 A;  4JI5 K;  3M3Z A;  3P5J A;  2QKK A;  3V6D A;  1NJW A;  3TAR A;  4H0O A;  4DMN A;  2KKZ A;  3OYN A;  3V81 A;  3HM9 A;  4DQS A;  4JYA K;  5BRD A;  1SQK A;  4GNI A;  5AZI B;  3SNN A;  3EKU A;  1CZ9 A;  4YOW A;  3RSE B;  3CCL N;  5JMV A;  3O08 A;  4H0T B;  1T6C A;  4W5T A;  5GAH P;  2Q0R A;  2VG6 A;  5KI6 A;  3MXJ A;  5EX5 A;  3CCV N;  3VQE A;  1GOC A;  1S1X A;  1HYV A;  5GAD P;  1W9H A;  1ZC6 A;  3EN9 A;  4A5B A;  1W97 L;  4H5R A;  5HL7 L;  2H9U A;  2EHG A;  3AA4 A;  3GDQ A;  3LAL A;  1VRU A;  3VES A;  2Q97 A;  3AA2 A;  1KAX A;  4C8L A;  4CJF A;  1YVU A;  4G1Q A;  3G25 A;  2FF3 B;  2ASM A;  3CJ1 A;  3VMF B;  4B3R K;  4QS7 A;  2HBM A;  2F9T A;  3MMV A;  4CEZ A;  2A5X A;  3LVJ C;  3BZC A;  2Y1B A;  4CFA A;  1J9A A;  3RVC A;  2Q3V A;  4J2B A;  1ZBL A;  2V52 B;  4BRP A;  3LVK B;  3DMJ A;  4Z4G A;  2D0B A;  3CC4 N;  4B3S K;  1FXX A;  2I7N A;  2HOE A;  3NVK A;  4KH5 A;  4ELV A;  2WC9 A;  1XMQ K;  5CHI A;  3CCJ N;  3VQC A;  3KLF A;  1NGC A;  3L0Q A;  3LPU A;  1IJJ A;  3WUH A;  4OKE A;  1QE1 A;  4LF5 K;  4FL9 A;  3OW2 M;  2ETJ A;  1SV5 A;  3VER A;  1VSM A;  2VGM A;  2DFE A;  2VWJ A;  4XH1 A;  4IJN A;  5EXW A;  3H45 C;  2ZGY A;  1YTU A;  1BA1 A;  1BQN A;  1HC7 A;  3TAN A;  1HUX A;  1RT7 A;  3QIC A;  2F7T A;  2ASP A;  5M1N A;  4W5R A;  4O5B A;  1BQM A;  3LAK A;  4DSF A;  4Y0W A;  3UKU A;  4W5N A;  4MLE A;  4H5V A;  1NLV A;  2VGN A;  3JXU A;  4B9Q A;  3DXM A;  4OPJ A;  3CM5 A;  1RBT A;  1BOT O;  1WAF A;  5C10 A;  3V9U A;  1TYQ A;  1Q8I A;  4P6P A;  2WFB A;  4DTN A;  3GBT A;  3MX2 A;  3CFP A;  2YNG A;  4IOC L;  4MLH A;  2Z7C A;  1SKW A;  2BH1 A;  1KSP A;  3QER A;  1NK8 A;  3S9H A;  3ENH A;  4I14 A;  4FJL A;  4DCH A;  3D2E B;  4NB4 A;  2IOC A;  3RR7 A;  3WNE A;  1RBU A;  1VSF A;  1HKC A;  3VA3 A;  1HX1 A;  3AA3 A;  1FW6 A;  2FBY A;  2QWO A;  4B9N A;  1K7J A;  5AQT A;  4DQI A;  4NXM K;  3ZT0 A;  2QKB A;  1S22 A;  3VEO A;  2E2N A;  5LJW A;  4X62 K;  3OBW A;  3RRG A;  4AHR A;  5T7B A;  2W6L A;  4KHS A;  1LCU A;  1Q9X A;  1BG3 A;  4OJR A;  3B6O A;  3K5L A;  4E19 A;  1XI1 A;  3N4P A;  4GV3 A;  1JLQ A;  1DGK N;  1GLF O;  3LM9 A;  3M8P A;  3GE1 A;  4DLE A;  2PZS A;  4HVJ A;  3F9K A;  3R9P A;  3K9J A;  1X9W A;  3L7V A;  3AO2 A;  4FJJ A;  4CW7 B;  1GOA A;  3OBY A;  1NJ1 A;  3C6A A;  4CJL A;  3AA5 X;  4JKC A;  4B1Y B;  3ZEU A;  4E7K A;  3QNO A;  1YJN N;  5FPE A;  4OKJ A;  4DTS A;  4HCC A;  4YOX A;  4CJT A;  3AO4 A;  1CLQ A;  1EXQ A;  3HRG A;  3VPZ A;  3DLB A;  4CZJ A;  5DM6 L;  1RNH A;  2G8F A;  1XHZ A;  1QQN A;  4J8F A;  3QIP A;  1UOC A;  3CJA A;  1A5W A;  1DTQ A;  1KVC A;  1WLJ A;  1D4X A;  3O8M A;  5HRO A;  2KFN A;  2YHY A;  5GIP A;  1YIT N;  3I0R A;  1RIL A;  4WFN L;  1RBS A;  3HL8 A;  5AFU H;  3O4Q A;  5GAG P;  2GBZ A;  4DUZ K;  4MQ3 A;  2W41 A;  3O9R A;  4A57 A;  4CZG A;  4DUY K;  4PKG A;  1B9F A;  2YHX A;  1IBK K;  3O1W A;  4WQ4 C;  3MEG A;  1RT4 A;  1S6P A;  4E1J A;  1JLC A;  4CJR A;  4B3M K;  3D2F A;  3CM6 A;  1JXB A;  3K59 A;  3BEX A;  3SQ4 A;  4JKG A;  3K5M A;  2QA4 N;  2GWK A;  4L3Q A;  4DG1 A;  4BR7 A;  1QQM A;  3F73 A;  1NOY A;  3EE9 A;  1E4G T;  1RT5 A;  2P5G A;  1T44 A;  3THX A;  3CJC A;  4DB3 A;  1RT1 A;  1D8Y A;  3SUP A;  2O8E B;  3ZET A;  1NGJ A;  3VQB A;  3K9K A;  5E41 A;  4Z4E A;  4IJA A;  1KC8 O;  3ATU A;  4DTO A;  1QHT A;  1R0A A;  4Z9E A;  3O80 A;  4K42 A;  3LQU A;  3HZ6 A;  1HKG A;  1HNX K;  4O5F A;  5FDL A;  2E1Z A;  5C2D A;  5FPD A;  1MWK A;  3T1H K;  4KRF A;  4BRG A;  5BN8 A;  3QIO A;  4AHC A;  4BRC A;  1H0X A;  2PBD A;  4CJE A;  4DS5 A;  4CJV A;  1VM0 A;  4O55 A;  2LN3 A;  2Q2R A;  3S3M A;  5ADX A;  3G0Z A;  5AQY A;  4BE1 A;  4OLF A;  3FFK B;  2V7Y A;  2IGI A;  1YVN A;  1BWF O;  1JL1 A;  4ISG A;  1F21 A;  4BRD A;  3EEQ A;  4EAH D;  1TKT A;  1FKP A;  4DFJ A;  3PSI A;  2G8W A;  3THW A;  2P9K B;  2IDO A;  1Y9X A;  1JXE A;  5LMU K;  1GLA G;  3JSM A;  1HNV A;  3EL2 A;  1IO2 A;  3NF8 A;  3KTQ A;  1QVF M;  4QS9 A;  1TV6 A;  4NZT M;  3E9P A;  2HF4 A;  2O8C B;  1ZBI A;  4FXD A;  3PLA A;  4BG8 A;  1SKR A;  4A5A A;  1KXP A;  1TIG A;  2ASO A;  3R1X A;  2VWK A;  3GL1 A;  1WOQ A;  1XHX A;  4R79 A;  4CHO A;  1K73 O;  5AZJ B;  4K25 A;  2FBT A;  1RDD A;  1KQS M;  2WTU A;  4HTU A;  1E4F T;  3D45 A;  3WNH A;  2HMI A;  5AQH A;  2BAN A;  4JD2 A;  4AH9 A;  4OPA A;  1YTA A;  1HNZ K;  1HR0 K;  1WNS A;  2I5J A;  2GV9 A;  3H3N O;  4CF9 A;  5LMN K;  3RMB A;  1TKX A;  3VTI A;  3CF5 L;  4E7J A;  2BTF A;  4DTP A;  3NAE A;  5M1K A;  3CJ7 A;  4E7H A;  3NMU A;  4KHY A;  1NGE A;  4DU4 A;  4FSV A;  3OYJ A;  2GEL A;  3V1Q A;  1G15 A;  3D0P A;  1YJW N;  1U48 A;  1Y97 A;  4N41 A;  3AO1 A;  3KWG A;  4P6D A;  1GLL O;  4HD0 A;  4LF9 K;  3QIN A;  4BRL A;  3AVC A;  1O1W A;  4BWM A;  1HPZ A;  3TI0 A;  5AFU A;  3PX6 A;  3WNG A;  3NVM A;  4JKF A;  4FK4 A;  1ATN A;  1WSF A;  3ZYY X;  3K57 A;  2BE2 A;  2P9I B;  4DHY A;  2UUA K;  3DXK B;  4BQL A;  4C8O A;  3SYZ A;  3M8R A;  4M3Z A;  2KHO A;  3HVR A;  4DTX A;  3C6U A;  4CF8 A;  5KPR A;  3KLE A;  3THY B;  4BRN A;  4E1M A;  3ZSZ A;  4M3T A;  3T3F A;  3IG1 A;  3VQA A;  1EQY A;  3DLK A;  5C42 A;  4AIL C;  2ZE2 A;  5AQQ A;  3DI6 A;  3HVT A;  3QKB A;  4BAC A;  3HPO A;  3P39 A;  5EOY A;  1JL2 A;  3BGR A;  3V9X A;  1JLA A;  2YX6 A;  4C23 A;  3C7N A;  1K4L A;  1H1V A;  4K0K K;  3J80 O;  4OX9 K;  4AHS A;  1KD1 O;  3ZIG A;  4WQ5 A;  4H03 B;  1KK9 A;  4DKW A;  3NF7 A;  2F8T A;  4IZ9 A;  4DFP A;  5CY4 A;  1S6Q A;  3SQ1 A;  3CFO A;  3H6E A;  3WXM B;  2IVO A;  3PUF A;  3V9W A;  4KKO A;  4M3R A;  4F3O A;  4Q15 A;  1TK8 A;  4M45 A;  2P9U A;  4EO0 A;  1QQO A;  1NKB A;  1M1K O;  1XC3 A;  1K9M O;  4FOE A;  2O4I A;  3ZSR A;  2G8U A;  4M7Y A;  1I3A A;  4JKD A;  4C8K A;  2ZF5 O;  3VQ8 A;  5LJV A;  1P90 A;  3LAN A;  1EX4 A;  1X9J A;  3WT0 A;  3S3O A;  3MWT A;  3WXL A;  1R59 O;  1GOB A;  2VQE K;  4BE2 A;  3C95 A;  3VEZ A;  3IFR A;  3BF3 A;  4QCL A;  1X3M A;  2NLX A;  4Q0B A;  1K8K B;  4RCH A;  1NOZ A;  4KHW A;  3T1Y K;  4FO0 A;  3HK2 A;  2GX9 A;  2DPN A;  5F1X A;  4CEE A;  5KRS A;  4PL8 A;  3UE5 A;  4IKF A;  4EFH A;  1OH6 A;  5GIN A;  1NH9 A;  1C0G A;  4IXC A;  4KI4 A;  4JI2 K;  5FRO A;  3NH0 A;  2Z1I A;  1EWR A;  3DLR A;  1VQK N;  3SPZ A;  3U3G A;  2BGG A;  4LFB K;  5BR8 K;  4FJI A;  3CER A;  1A5X A;  2V7Z A;  1HYZ A;  4JRP A;  3SJJ A;  1QSY A;  3WXJ A;  3R3L A;  1C0F A;  4BVP A;  1LAW A;  3AVM A;  2YJF A;  1W2B M;  1TKD A;  4CK1 A;  4G9Z A;  4X66 K;  1U45 A;  1TKZ A;  4JAX A;  2D0C A;  1H4Q A;  2NRZ A;  2F96 A;  4FOI A;  4EHT A;  4Z4F A;  4FW2 A;  2DFF A;  3VGM A;  4FLZ A;  4YY3 K;  3JYT A;  5BPN A;  4CJ5 A;  4DV3 K;  3VQ7 A;  1XNR K;  4BG9 A;  4K41 A;  1BI4 A;  3PO4 A;  1NJ2 A;  4JI4 K;  1H4T A;  2XY8 A;  4BDY A;  1IG9 A;  3M5R A;  4E3S A;  4CJQ A;  3BDP A;  2F4V K;  4NCX A;  4BRF A;  3MK5 A;  4CEA A;  1YUW A;  5HRP A;  4J2A A;  3SUQ A;  3KLG A;  1RDA A;  4A2A A;  3NH1 A;  3DOK A;  2FSK A;  2Q0U A;  3B8A X;  4JI0 K;  1NMN A;  4FJH A;  1BHL A;  3QML A;  3CYM A;  4B8C A;  2PFU A;  3T19 A;  5K14 A;  3EKS A;  3CCE N;  2HBL A;  1KVA A;  1YT3 A;  1BU6 O;  5EU7 A;  3U4L A;  1VR4 A;  3T1I A;  4YKE A;  5AQU A;  3ZSX A;  3ZX3 A;  4U67 L;  2A40 A;  4GVE A;  3IDH A;  2WUS A;  3AVA A;  2DTU A;  3WQT A;  2RE2 A;  4M3Y A;  4F8R A;  2Z1G A;  2RN2 A;  3SZ2 A;  1M90 O;  5M1P A;  4B3T K;  2ZQB A;  5KGW A;  1ITG A;  3HTV A;  1IEZ A;  4CJP A;  3OYC A;  3NE6 A;  1C1C A;  5AQM A;  4ISE A;  4CHQ A;  3CI5 A;  4C8N A;  4MO5 A;  4CEF A;  2O8F B;  4CF2 A;  3SUO A;  5JVG L;  4KHN A;  1NWK A;  4GKK K;  1T7P A;  5BPL A;  4FJ7 A;  1XWL A;  1VQO N;  1H0Y A;  3Q7C A;  4B1X B;  4I6M A;  5FPN A;  1QZ6 A;  1KCF A;  4DV5 K;  2OZM A;  1NGI A;  3KK7 A;  2E2P A;  4P6C A;  2P5O A;  2KTQ A;  5GIO A;  2LXR A;  1VQN N;  3ZSW A;  1U49 A;  3DJC A;  4UY8 O;  2FC0 A;  2UYT A;  3G71 N;  2KLA A;  4KB0 A;  1RTJ A;  4DFK A;  2E2Q A;  3HYF A;  3FZF A;  3PY8 A;  1J54 A;  3P1G A;  4JV5 K;  5J2Q A;  3ZEU B;  3SAF A;  4JS4 A;  2QTD A;  3CPE A;  3FZL A;  1NK5 A;  1NGH A;  3ISN C;  3QBX A;  5AR0 A;  4B1V A;  2ITG A;  2QXL A;  3TAE A;  1HQE A;  4MDA A;  3A2F A;  3UB5 A;  3JS6 A;  5M1F A;  2HVI A;  2A42 A;  2OPR A;  5E26 A;  4I2P A;  5KGX A;  3UKR B;  2ZM6 K;  1NJX A;  4C8M A;  4RWT A;  4FVM A;  2YJE A;  5JLF A;  3RMC A;  1QVG M;  3EO3 A;  3G10 A;  3K5N A;  4KRE A;  1S1V A;  2QI2 A;  4CED A;  4PUO A;  3LDN A;  1ZBS A;  4O8U A;  5LY3 A;  4DR2 K;  4IOX A;  5M1Q A;  4M3W A;  3AV9 A;  4EZ9 A;  4E0D A;  2P9S A;  3D2F B;  3CET A;  1NGA A;  4YHH K;  1VHX A;  2VQF K;  1CXU A;  4K8Z A;  4BRA A;  5I42 A;  4JKG B;  1QTM A;  1TUU A;  1P8Z A;  4LD0 A;  1U2V B;  4FLV A;  4FLU A;  1NGF A;  3I33 A;  2X78 A;  3TTF A;  4FCX A;  3Q7B A;  1HPM A;  3KZB A;  4OGE A;  4UQG A;  4CJW A;  5DK5 A;  1HJO A;  2NRH A;  4DR5 K;  3SV3 A;  1VQL N;  2O8D A;  4M7X A;  1N34 K;  3ZET B;  4E89 A;  5CE3 A;  4K88 A;  2RPI A;  4JKA A;  3OTO K;  3CHW A;  2NRT A;  4XEI A;  1J5O A;  1LW2 A;  2YNH A;  3TWH A;  4K87 A;  1T3V A;  4GV6 A;  5ADX H;  1ATR A;  4KH4 A;  3WEE A;  4F4K A;  4Z4C A;  3O9S A;  2D1K A;  1BIZ A;  3E9L A;  1RCH A;  3O9T A;  3ZLJ A;  1RQ8 A;  2QWR A;  4Y1C A;  1HKB A;  3VF6 A;  3VF2 A;  5AQL A; 
#chains in the Genus database with same CATH homology
 3SLC A;  5HOO A;  1S3X A;  2P9K B;  4KBO A;  4BR4 A;  5AZI A;  3SBT A;  1TKS A;  3WQU A;  4OPH A;  3ZII A;  2P9N A;  1KAZ A;  1YF5 L;  4E1B A;  3DWL A;  1O13 A;  3TPQ A;  4C1N I;  3RSE A;  2P9L B;  2OTL N;  1GLA G;  4JN4 A;  1K8K A;  3QB0 A;  2P9B A;  3EL2 A;  5AQG A;  2YI1 A;  1K8A O;  4O8K A;  2QWL A;  4PKH A;  3ULE B;  1QVF M;  3FLC O;  5JIC A;  2E20 A;  3IKM A;  4QS9 A;  4NZT M;  3E9P A;  5F2R A;  2P9P B;  2HF4 A;  2HST A;  3IUC A;  3TU5 A;  3MDQ A;  4WFB L;  3PLA A;  4NO7 A;  4CI6 A;  3FR0 A;  3VF4 A;  4BC3 A;  4BG8 A;  5KPZ A;  3OA9 A;  3TSU A;  3TSP A;  3CD6 N;  4A5A A;  1K49 A;  1KXP A;  2JWK A;  3BUZ B;  2ASO A;  3FZK A;  3R1X A;  4BQZ A;  3GL1 A;  1WOQ A;  4DQ8 A;  5BN9 A;  4R79 A;  1K73 O;  3C65 A;  3VOV A;  3IMX A;  1SNN A;  4BGB A;  5AZJ B;  3EE8 A;  4K25 A;  4A62 A;  3OHR A;  1KQS M;  1Q82 O;  1T6D A;  2GWJ A;  1E4F T;  1SAZ A;  1YXQ A;  2V51 B;  5AQH A;  2A3Z A;  2IIR A;  4JD2 A;  4OPA A;  4JNE A;  5E84 A;  4H5N A;  3CME N;  1G58 A;  3H3N O;  4H0X B;  3VTI A;  3CF5 L;  5H1S Q;  2BTF A;  1X3N A;  2HBK A;  5TKW A;  5M1K A;  3CJ7 A;  1HRU A;  5KQD A;  4FFJ A;  5BRE A;  3NMU A;  2HF3 A;  1NGE A;  4FSV A;  3PIO L;  5B8H A;  2GEL A;  3ATV A;  4LC9 B;  4WYB A;  2IVP A;  1IG8 A;  4FWM A;  5AQN A;  1YJW N;  3QFP A;  3MWP A;  3MIO A;  4FWL A;  3KWG A;  4BR9 A;  3F9M A;  4PHT X;  3R8E A;  4P6D A;  1GLL O;  4YDU A;  2MX1 A;  3P4I A;  1JCG A;  4BRL A;  4A59 A;  5AFU A;  1DKG D;  3NVM A;  2NRW A;  1GLC G;  1V4T A;  2CGK A;  2QWN A;  3MGZ A;  1GLB G;  4JKF A;  3CQX A;  3MN6 A;  1ATN A;  1NGD A;  4CZE A;  4IEE A;  4A61 A;  4WQ4 A;  3ZYY X;  4WFA L;  1RGI A;  2ZGZ A;  2P9I B;  3ID8 A;  4DHY A;  5JVH L;  3DXK B;  4BQL A;  3P31 A;  5AQS A;  5BRF A;  3O5B A;  3A0I X;  1QZ5 A;  3D6R A;  2KHO A;  4MO4 A;  2NNW A;  2RIS A;  2EWS A;  1BUP A;  1OKJ A;  4AM7 A;  2AP1 A;  1U6Z A;  4CJ7 A;  5KPR A;  3DLL L;  2P9S B;  4BRN A;  2VCP A;  4OO1 J;  3VEN A;  1K4P A;  2VWB A;  3LM2 A;  3A5L C;  1EQY A;  1QHA A;  4YOT A;  3LDQ A;  3O4W A;  4H0Y B;  5AQQ A;  1XEZ A;  5C15 A;  4A2B A;  4YOV A;  3CCR N;  3SAG A;  3AAP A;  3E66 A;  3P39 A;  2VYP A;  5EOY A;  5KPT A;  4GV9 A;  2YX6 A;  4FWN A;  4C23 A;  3C7N A;  3MCP A;  3H46 O;  1K4L A;  1H1V A;  1JJ2 M;  1DT9 A;  3CPW M;  1KD1 O;  3R6M A;  3CCU N;  3F5T A;  3ZIG A;  2F9W A;  3C7N B;  4WQ5 C;  3LRJ A;  1VQM N;  4WQ5 A;  2GTD A;  4FWS A;  4H03 B;  4YOU A;  2HBJ A;  3ENB A;  3FGU A;  1KK9 A;  4DKW A;  2ZJQ L;  4IZ9 A;  3BF1 A;  2FSJ A;  4CZF A;  1NGG A;  2QW9 A;  3F2K A;  3H6E A;  3WXM B;  4PL7 A;  4P8E A;  2WBN A;  2IVO A;  2QEX N;  4GY2 B;  3O1B A;  4ILH A;  1K4I A;  3U8X A;  5AQF A;  3WEE B;  1PVY A;  2HMP A;  1VQP N;  4B1U B;  2AA4 A;  3AAR A;  3MCA B;  2P9U A;  4EO0 A;  2PAV A;  1QQO A;  1M1K O;  1J6Z A;  1XC3 A;  4BRQ A;  4FOE A;  4CBX A;  4IO9 L;  3C6H A;  1K9M O;  3U9Z A;  4M7Y A;  4BRM A;  3VGK A;  2OAN A;  3LDO A;  3MN9 A;  2ZF5 O;  3M3Z A;  4JKD A;  5I9E B;  3D2E A;  5LJV A;  1NMD A;  1P90 A;  5FPM A;  1VQ6 N;  4H5T A;  5F0X A;  1X9J A;  3WT0 A;  4H0O A;  3MWT A;  2KKZ A;  3A8Y A;  3WXL A;  5ELZ A;  1R59 O;  4EIA A;  4IO8 A;  5BRD A;  1SQK A;  3VEZ A;  4GNI A;  5AZI B;  3IFR A;  3BF3 A;  4FWR A;  3EKU A;  2A41 A;  3H1V X;  2P9N B;  3I8B A;  5EVZ A;  3WXI A;  1X3M A;  2NLX A;  5C2F A;  4YOW A;  2OTJ N;  3RSE B;  3CCL N;  4CZH A;  5JMV A;  3O08 A;  1K8K B;  4H0T B;  4IFE A;  1T6C A;  4RCH A;  3G6E N;  3HI0 A;  1VQ8 N;  4JKE A;  2QWQ A;  3HOT A;  4FO0 A;  3N4Q A;  2Q0R A;  2FF6 A;  4M63 C;  2GX9 A;  3LL3 A;  5GAH P;  4CD1 A;  2GUP A;  5C0Y A;  2DPN A;  4H0V B;  5EX5 A;  5F1X A;  3CCV N;  2H3G X;  4PL8 A;  3UE5 A;  1RDU A;  4EFH A;  4H5W A;  4PKI A;  2ITM A;  3MN7 A;  5GIN A;  5GAD P;  4BC5 A;  1ZC6 A;  3LDL A;  4JK7 A;  1ESV A;  3EN9 A;  1C0G A;  3HSC A;  3KWI A;  4CZI A;  4IXC A;  1NM1 A;  4A5B A;  2ZJP L;  1W97 L;  4H5R A;  3W3D A;  5HL7 L;  3CC7 N;  3GDQ A;  1VQK N;  4NLB A;  3FZH A;  3G4S N;  3VES A;  2Q97 A;  3QFU A;  1KAX A;  3J7Z O;  3G25 A;  3T69 A;  2FF3 B;  2ASM A;  2NRR A;  1RDW X;  1YAG A;  3CJ1 A;  5JLH A;  3CCQ N;  3VMF B;  2QM1 A;  3CER A;  5AQZ A;  1TKU A;  4JD2 B;  4QS7 A;  2HBM A;  2V7Z A;  3ENO A;  4HWI A;  2F9T A;  3MMV A;  2A5X A;  3ZIE A;  3I56 N;  5BPM A;  1DEJ A;  3WXJ A;  3R3L A;  1C0F A;  3C0B A;  3SAH A;  5EY4 A;  1OVY A;  4BVP A;  3RVC A;  4RTF D;  2YJF A;  1W2B M;  4G9Z A;  1VQ4 N;  4IEI A;  2V52 B;  4BRP A;  5AQW A;  2RIU A;  3CC2 N;  2W40 A;  4JAX A;  3CC4 N;  1KAY A;  2HOE A;  2I7N A;  2BUP A;  2NRZ A;  4FOI A;  4EHT A;  3E1Y A;  1SS6 A;  3MK6 A;  4KH5 A;  4CD3 A;  3NVK A;  3O9U A;  2WC9 A;  3VGM A;  3UKR A;  5AQL A;  5BR9 A;  5BPN A;  3E9O A;  5CHI A;  3CCJ N;  1VQ7 N;  2IVN A;  1NGC A;  2FSN A;  3CIP A;  3TSQ A;  3L0Q A;  4K41 A;  4BG9 A;  2E88 A;  5C12 A;  1IJJ A;  4FWO A;  4U67 L;  3CXC M;  3WUH A;  4AF1 A;  4FL9 A;  3P38 A;  4BVO A;  3OW2 M;  3M5R A;  3VEW A;  2ZWH A;  4BRF A;  5AQI A;  3VER A;  2VGM A;  1GLE G;  4XH1 A;  3MK5 A;  4BC2 A;  2CGL A;  1YUW A;  2FXU A;  4IJN A;  3VGL A;  4FBQ A;  5EXW A;  3H45 C;  3CJ9 A;  1YHQ N;  2ZGY A;  5BRH A;  3AJE A;  1BO5 O;  1BA1 A;  1Y64 A;  3VEX A;  4CZL A;  3TTD A;  1HUX A;  4A2A A;  4YOY A;  3MN5 A;  1ILY A;  2FSK A;  3QIC A;  2Q0U A;  5CR4 A;  2F7T A;  2ASP A;  4BRE A;  3B8A X;  4YOR A;  3AGR A;  5M1N A;  1Q7Y O;  2CH6 A;  3ZX2 A;  4FWP A;  3ZX0 A;  3J8A A;  3QDK A;  4Y0W A;  2D4W A;  3UKU A;  4MLE A;  3H07 A;  4H5V A;  3QML A;  1NLV A;  1U2V A;  2VGN A;  2NRX A;  3JXU A;  4B9Q A;  1JCU A;  3DXM A;  1Q81 O;  1BOT O;  2PFU A;  1Q18 A;  3A5N C;  3EKS A;  4JKH A;  3CCE N;  1RFQ A;  2HBL A;  2RHK A;  1TYQ A;  5C10 A;  3U4L A;  1BU6 O;  1CZA N;  1G57 A;  5AQP A;  4ILJ A;  1ATS A;  4JK9 A;  4BR2 A;  4WF9 L;  4JK8 A;  1Q86 O;  4P6P A;  2D0O A;  2WFB A;  3T1I A;  4YKE A;  5AQU A;  3P04 A;  1NBW A;  3HM8 A;  3GBT A;  3MX2 A;  1Z05 A;  4MDB A;  3ZX3 A;  4QS8 A;  2A40 A;  2GEM A;  3DAW A;  4GVE A;  3FE1 A;  3IDH A;  2WUS A;  3L4I A;  1VAZ A;  4MLH A;  4IOC L;  1XUP O;  1V4S A;  2BH1 A;  4BRI A;  2P9U B;  3WQT A;  2Q1N A;  2ZJR L;  2RE2 A;  4P8J A;  3ENH A;  4JHD A;  5GAE P;  1M90 O;  4I14 A;  5M1P A;  4XH4 A;  4DCH A;  3D2E B;  4NB4 A;  3HTV A;  2EQA A;  1IEZ A;  4JHD B;  4C1N K;  1HKC A;  5AQM A;  1HX1 A;  4ISE A;  1MDU B;  3CI5 A;  4MO5 A;  3CJB A;  1ZXO A;  3D7E O;  3ZIH A;  4FWQ A;  2QWO A;  1K7J A;  5JVG L;  2J4R A;  3MX5 A;  1NWK A;  5AQT A;  1MA9 B;  3VET A;  4FBK A;  2P9K A;  4IWV A;  2I7P A;  5BPL A;  1NJI O;  4BGA A;  3U9D A;  1VQ5 N;  3KVG A;  1VQO N;  1S22 A;  2P9L A;  3HOS A;  3Q7C A;  3VEO A;  4B1X B;  4BC4 A;  4I6M A;  3SJH A;  2E2N A;  5FPN A;  5LJW A;  1QZ6 A;  4HTL A;  3OBW A;  4B1Z A;  1NGI A;  3KK7 A;  4NZR M;  3ULE A;  4I6M B;  2E2P A;  4P6C A;  4CZK A;  1LCU A;  5KQ8 A;  1TUY A;  1S72 N;  2P9P A;  1BG3 A;  4CZM A;  3EZW A;  5GIO A;  3SK3 A;  3QBW A;  3GG4 A;  4ILG B;  3N4P A;  1VQN N;  4GV3 A;  2JWL A;  3DJC A;  1GLD G;  4UY8 O;  5TKY A;  1DGK N;  1GLF O;  3LM9 A;  4CBU A;  3GE1 A;  3GOI A;  3R9P A;  3K9J A;  1YI2 N;  2FLO A;  3AY9 A;  1N8R O;  2UYT A;  3HBT A;  3L7V A;  3G71 N;  2KLA A;  4BR5 A;  5AZJ A;  3KHY A;  3OBY A;  4FBW A;  4IDH A;  3C6A A;  4XH5 A;  2E2Q A;  3CCS N;  3T7Z A;  4JKC A;  5M1O A;  4B1Y B;  3VEV A;  3ZEU A;  1YJN N;  5FPE A;  3O9Q A;  3FZF A;  4JKB A;  1EO1 A;  4WCE L;  4YOX A;  2Q36 A;  3SMS A;  3O6W A;  3ZEU B;  4JEP A;  3SAF A;  3HRG A;  3VPZ A;  1SZ2 A;  2QTD A;  3CPE A;  4CZJ A;  3CMA N;  3FZL A;  5DM6 L;  2E8A A;  3WXK A;  1HLU A;  4HVZ A;  2Q31 A;  1NGH A;  2YCH A;  3QBX A;  5AR0 A;  4BRH A;  4B1V A;  5MLC Q;  4F9O A;  5AQO A;  1QQN A;  4J8F A;  2QXL A;  5AQR A;  2QWP A;  3CJA A;  4MDA A;  3JS6 A;  3UB5 A;  5M1F A;  2A42 A;  1D4X A;  5E26 A;  3O8M A;  2NRV A;  3ID6 A;  3UKR B;  2YHY A;  5GIP A;  3BP8 A;  2D0P A;  1YIT N;  4RWT A;  4WFN L;  5GAG P;  3AAQ A;  5AFU H;  4IOA L;  3M1F A;  4YDU C;  3S41 A;  2YJE A;  5AQK A;  5JLF A;  2W41 A;  3SBG A;  4H0P A;  3H3O B;  3O9R A;  4A57 A;  1QVG M;  4CZG A;  3EO3 A;  4PKG A;  2P9I A;  4P77 A;  2YHX A;  2QI2 A;  3AGK A;  3O1W A;  2CGJ A;  3DXK A;  4WQ4 C;  3CCM N;  1XQS C;  1YIJ N;  4E1J A;  3LDN A;  3D2F A;  1ZBS A;  2E2O A;  4O8U A;  5LY3 A;  3VTH A;  1BDG A;  4IOX A;  5M1Q A;  3BEX A;  1MWM A;  4K43 A;  1JCF A;  4JKG A;  3L6Q A;  2QA4 N;  5AQJ A;  2GWK A;  2P9S A;  3CET A;  1NGA A;  3D2F B;  4L3Q A;  4BR7 A;  3CQY A;  4BRK A;  1QQM A;  4CBW A;  4BRA A;  1NGB A;  4JKG B;  3EE9 A;  5AQX A;  1E4G T;  2A6A A;  3M6G A;  1TUU A;  1T44 A;  1BA0 A;  2YHW A;  1P8Z A;  3UKU B;  1LOT B;  3CJC A;  1U2V B;  4DB3 A;  3LDP A;  3SMP A;  1NGF A;  3I33 A;  3DXM B;  3TTF A;  4FCX A;  3Q7B A;  1HPM A;  3KZB A;  3I55 N;  4B1W B;  1HJO A;  2NRH A;  3ZET A;  1NGJ A;  1VQL N;  3K9K A;  3TTC A;  1TYQ B;  5AQV A;  4IJA A;  4EHU A;  4NLC A;  1KC8 O;  3L4Q A;  3ATU A;  4M7X A;  3ZET B;  5CE3 A;  5DM7 L;  1GLJ O;  4JKA A;  3O80 A;  3CHW A;  3H1Q A;  4K42 A;  3LQU A;  3HZ6 A;  1HKG A;  2QWM A;  4O5F A;  4Z94 A;  4BR0 A;  2E1Z A;  2NRT A;  4XEI A;  5C2D A;  5FPD A;  1MWK A;  4FPA A;  1YJ9 N;  4BRG A;  1VQ9 N;  5BN8 A;  2NZT A;  1G99 A;  1T3V A;  4BRC A;  2CH5 A;  4GV6 A;  2PBD A;  3VEY A;  5ADX H;  1ATR A;  4KH4 A;  3WEE A;  3FZM A;  1WUA A;  3LS6 A;  3O9S A;  4ISF A;  3A5O C;  2D1K A;  2LN3 A;  4FPB A;  4FVU A;  2Q2R A;  1PVW A;  4KH6 A;  3A5M C;  3W0L A;  1Z6R A;  5ADX A;  3E9L A;  5AQY A;  3FFK B;  2E1Y A;  2V7Y A;  3O9T A;  1YVN A;  1BWF O;  4ISG A;  1K4O A;  1JCE A;  4U7B A;  4BRD A;  2QWR A;  4EAH D;  4AM6 A;  4BY9 C;  3PIP L;  4BRO A;  1HKB A;  3VF6 A;  3VF2 A;  4FWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...