3TTCA

Crystal structure of e. coli hypf with adp and carbamoyl phosphate
Total Genus 215
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
215
sequence length
646
structure length
646
Chain Sequence
QIVPDAATCPACLAEMNTPGERRYRYPFINCTHCGPRFTIIRAMPYDRPFTVMAAFPLCPACDKEYRDPLDRRFHAQPVACPECGPYLEWVSHGEHAEQEAALQAAIAQLKMGNIVAIKGIGGFHLACDARNSNAVATLRARKHRPAKPLAVMLPVADGLPDAARQLLTTPAAPIVLVDKKYVPELCDDIAPGLNEVGVMLPANPLQHLLLQELQCPLVMTSGNLSGKPPAISNEQALEDLQGIADGFLIHNRDIVQRMDDSVVRESGEMLRRSRGYVPDALALPPGFKNVPPVLCLGADLKNTFCLVRGEQVVLSQHLGDLSDDGIQTQWREALRLMQNIYNFTPQYVVHDAHPGYVSCQWASEMNLPTQTVLHHHAHAAACLAEHQWPLDGGDVIALTLDGIGMGENGALWGGECLRVNYRECEHLGGLPAVALPGGDLAAKQPWRNLLAQCLRFVPEWQNYPETASVAAANWSVLARAIERGINAPLASSCGRLFDAVAAALGCAPATLSYEGEAACALEALAASCDGVTHPVTMPRVDNQLDLATFWQQWLNWQAPVNQRAWAFHDALAQGFAALMREQATMRGITTLVFSGGVIHNRLLRARLAHYLADFTLLFPQSLPAGDGGLSLGQGVIAAARWLAGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulatory protein
publication title Structure of Hydrogenase Maturation Protein HypF with Reaction Intermediates Shows Two Active Sites.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 215
structure length 646
sequence length 646
ec nomenclature ec 2.1.3.-:
pdb deposition date 2011-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01300 Sua5_yciO_yrdC Telomere recombination
A PF07503 zf-HYPF HypF finger
A PF17788 HypF_C HypF Kae1-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.110.120 Alpha Beta 2-Layer Sandwich Translation Initiation Factor IF3 Translation Initiation Factor IF3 3ttcA02
3.30.420.350 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA04
3.30.420.360 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Nucleotidyltransferase; domain 5 3ttcA03
3.90.870.30 Alpha Beta Alpha-Beta Complex DHBP synthase DHBP synthase 3ttcA01
3VESA 3VTIA 3TSUA 3TTDA 3VTHA 3VERA 3VF2A 3TTCA 3VEWA 3VEZA 3TSPA 3TSQA 3TTFA 3VEOA 3VETA 3VEXA 3VF4A 3VENA
chains in the Genus database with same CATH superfamily
1SKWA 5JS2A 3IABB 4F2RA 4YDUC 4DCHA 1FW6A 3C6UA 1SL2A 3UE5A 3HTVA 3ALYA 1KFSA 1A5VA 1KLNA 5J2MA 1Q9XA 4DQPA 2YHWA 5AQRA 1ZBUA 1GLDG 1Z26A 4JD2B 1SNNA 4WI1A 3K0SA 3SUNA 1VQ8N 4HHTA 3S3NA 4AHVA 4Y1CA 3ULEB 4Z94A 1RBRA 4LSLA 2OPPA 4KAZA 2ZE2A 5GIOA 4DR4K 3DXKA 3K57A 3LVKB 1LAWA 3TAFA 3KWIA 3KD5E 4JK8A 4CJ4A 1XC3A 1YVNA 4DR6K 4FZYA 1O1WA 3M8RA 1TL3A 4H5NA 5BN9A 3PIOL 3OW2M 2O8CB 4KHPK 3D2EA 3R3LA 4FWRA 5AQHA 1YHQN 4FCYA 2UUBK 2O8EA 5AQLA 3L3UA 1RGIA 1RDWX 1N36K 4C8OA 1E3MA 5TKYA 4IBNA 4CERA 4NZRM 4JNEA 3O9UA 1WBDA 2Q2RA 3LL3A 5M1KA 1M1KO 3L4IA 5JVGL 4FBKA 1FKPA 1HUXA 3C65A 4BR9A 4CHZA 3O4QA 4JKEA 5CYQA 1VSDA 3VQAA 4CGDA 4OLAA 1DCJA 3QFUA 2OZSA 1BCOA 3NBPA 1VQLN 4R5PA 4OLBA 3MWPA 4BRPA 4WCEL 4PL7A 4KB1A 5DM7L 2HSTA 5AQIA 3P1GA 1JCGA 2UYTA 5KPRA 4CZEA 4DQ8A 5CZ1A 4NCBA 4O5BA 2PBDA 3CHWA 1HX1A 3MIOA 1WBBA 3U9DA 4YOYA 4DHYA 3RSEB 3HZ6A 4CF0A 1BQNA 3AVMA 4CFDA 4CW7B 5ADXH 3C7NA 2ZGYA 1NGDA 4EP5A 4DR3K 3RMAA 3CERA 4DR1K 4FJ9A 4K0KK 2HW3A 1EO1A 3G6EN 3HVRA 3KTQA 5EXWA 1IKWA 4RW4A 4IEEA 3NAEA 1NJ8A 1ZBFA 4DFJA 2EQAA 3KK7A 1H4QA 1BISA 4RTFD 3HBTA 1S22A 2W40A 3LPUA 1H1VA 4FJXA 2QKKA 2P5OA 4C8LA 3V9UA 2FF6A 4GKKK 4B3TK 1GOBA 3CC7N 3DI6A 2P9BA 4LF9K 3UKRA 4GKJK 3ENBA 4E0DA 1WN7A 1EKEA 3LRJA 4WE1A 1QQOA 3VQ8A 5J2QA 1YF5L 2FSKA 1HPZA 2A40A 3KIOA 1HNXK 4NZTM 3LWMA 1JLBA 3L0QA 2F9TA 4OGEA 1D4XA 1HQEA 3D0PA 3G0ZA 4PKIA 1KSPA 2B4JA 4F3TA 1NKCA 3M5RA 5J1EA 5DM6L 1LCUA 1VM0A 4CZIA 3DM2A 4FJIA 3VQQA 2Q97A 5I42A 2JWLA 4YORA 3U3GA 3WNHA 4DV3K 4FLZA 3DSDA 3O3HA 4E89A 1U48A 4F4KA 1Q18A 2O8FA 5AQOA 1VQ9N 5SZTA 3HSTB 2X6SA 3WT0A 3HL8A 1YXQA 4W5TA 2VWKA 1DKGD 3THWB 2HNYA 4JKCA 3PX6A 2I7PA 2ASPA 3NCIA 4A5AA 3LDNA 4FVUA 1NGFA 5EVZA 1JCEA 1ATNA 4BGAA 5AQXA 4BDYA 1VQ7N 2V7YA 3O08A 4H0OA 4ID5A 4JS4A 1NJ5A 1VQNN 3CC2N 3E9OA 3P04A 3I8BA 5HRRA 4BRNA 3ZIIA 4PKHA 1NH9A 2A3ZA 4WFNL 5HRSA 1CZ9A 3TSUA 3D2FB 4CJ3A 1RBUA 3QIPA 4K25A 3BF1A 1JDQA 4RWTA 4H0YB 1BI4B 5AQWA 3O9SA 4CI6A 1JL1A 1W9HA 3SJJA 4CBXA 3CG7A 3QETA 1W7AA 5AZJA 4DTNA 4CESA 2P51A 3RTVA 2Z1IA 3U4LA 1BWFO 4DR2K 2BUPA 3VMFB 1DLOA 4BR7A 1WNSA 4BG9A 5I9EB 1TK5A 4IEIA 4BREA 4DV5K 2YNGA 3M1FA 4JHDA 3E01A 1S1WA 5JLHA 2BE2A 3CM5A 5C42A 1WUAA 3IUCA 1HMVA 1I94K 3OS0A 4ELVA 1JE3A 4DLEA 3LAKA 5DMRA 2E20A 3HK2A 1IV0A 1G99A 4BQZA 4B9SA 2FLOA 4O0IA 3DXMA 2P9NB 4BR5A 2IFEA 2RN2A 2YJEA 4ISGA 1U04A 3MX2A 2Q36A 4M7XA 1NJYA 4CEQA 3L2QA 3ZX0A 3AVFA 2H9UA 3EE8A 4IWVA 2F7TA 3LDOA 2OPRA 1TUYA 4KRFA 2IIRA 4CEEA 3F2KA 4KH4A 4ILJA 4JRPA 3KK3A 3L4QA 2XY5A 4JKFA 4JI0K 5JVHL 3WEEB 3SAFA 1EWQA 1A5WA 4BRIA 1NGIA 3UKUA 4JI1K 4AHCA 1L3VA 3LM2A 4MFBA 1H4TA 3HOTA 3U9ZA 4CEOA 3LDQA 1QQCA 3SBGA 3VQBA 4K42A 2UUCK 1ATRA 3PLAA 4MLEA 4DV4K 1NLVA 2NRHA 4CJ7A 1TYQB 2QXLA 5EX5A 4JI5K 1CZBA 2D5RA 3I55N 4E7KA 4ELTA 2XHBA 4O44A 4XIUA 4FJNA 2HOEA 3NVKA 2W41A 1HKBA 3OYFA 3S41A 3NDKA 2RIUA 3DLGA 1BO5O 5AQUA 4LY7A 4DV2K 4E1NA 1IKYA 5M1PA 1TAUA 2W42A 3QESA 2D0OA 5KQ8A 1I3AA 4O55A 5FPMA 2KLAA 1BHLA 4DSKA 4FVMA 5BPNA 1U49A 1RCHA 1YT3A 2VQFK 2I5JA 4BRQA 1KD1O 3SBTA 3TU5A 2A41A 2F8SA 3MN9A 1UWBA 4YDQA 1TUUA 4KKOA 1WSFA 4CZMA 4CEDA 5AQGA 2E2OA 4KTQA 4H4MA 1J5OA 3HO1A 2UXDK 2GEMA 2XO7A 3OYHA 3GDQA 5ADXA 4FW1A 1YTUA 1T3VA 3SNNA 4FWQA 3BGRA 5FLXO 1XNRK 2HHWA 5BREA 2OTJN 1SKSA 1TVRA 4WQ4C 1FKOA 2FSJA 2FSNA 2Z1GA 4IO9L 5M1FA 1K4LA 3VQ5A 4CBUA 4JAXA 1D9DA 1VR4A 4W5NA 3A2FA 4X65K 2P5GA 3ZSZA 3JXUA 3ZLJA 3BZKA 2HHXA 3V9WA 3A8YA 3D6RA 3OYNA 1S9EA 4FM0A 4H0PA 1KVBA 1VQON 3DLLL 2E5LK 2DFFA 4BG8A 1C6VA 1C0TA 4FJ5A 4CF1A 4K88A 1KRPA 3OYAA 5C10A 3F9KA 3O3GA 3THVA 2KKZA 2PFUA 3MN7A 3ZSQA 4B3MK 2A1SA 3HVTA 4Z4HA 3HT3A 3T19A 4OPJA 5C24A 2YHBA 1HKCA 4IO8A 2YX6A 3IRXA 3IALA 1NFJA 1KXPA 2G8UA 3H1QA 1J5EK 1EQYA 1VAZA 2GTDA 4X62K 4FSVA 3SAHA 4X66K 4C8NA 1NOYA 1OVYA 2L8YA 3LPTA 2AA4A 2QEXN 1C0MA 3ENHA 2YKNA 1YUWA 4IFVA 2QK9A 1QHTA 3THXA 2Q3VA 3IS9A 1GLEG 4P6PA 4WQ5C 3JSMA 4WQ5A 3MEEA 1Q7YO 3QLHA 3ZIGA 2FXUA 1UA1A 2CGKA 2EWSA 2R7YA 3NE6A 3EZ5A 5A2QO 3V4IA 3ZIEA 1HJOA 1TL1A 4M45A 2GUIA 4BR4A 4OKKA 4PUOA 3N4PA 3RWUA 1HYSA 5BPMA 3QNNA 1NKBA 3HRGA 3PO5A 1KTQA 3MN5A 3CQYA 4M41A 1C1AA 3SK3A 4I2PA 1QTMA 2ITGA 3NFAA 1NGHA 3DLRA 4DSFA 3K5LA 4MO4A 3SLCA 3VQ9A 1GLCG 2Q31A 4AM6A 1NJ2A 1Y2IA 1QHAA 3THYA 2HNZA 2FBYA 4NCXA 2H3GX 1MA9B 2ZJPL 3OYMA 1VRUA 1YI2N 4RW8A 2CRQA 4BQLA 3N4QA 5F2RA 4AHRA 4KHNA 4PWDA 1NGBA 3QERA 1B9DA 1NKEA 3K9KA 3CCLN 3DYAA 4GV6A 3FE1A 4FWOA 1S3XA 1K4OA 4DQIA 3OYGA 3GBTA 3NGYA 4M63C 5KGWA 3TSQA 4RCHA 3OYEA 4BC3A 5AZIA 1RT3A 1T8EA 3OS1A 2IAJA 3VGKA 1K8KA 1SUQA 3OYJA 1RDAA 2GX9A 2D0PA 1Q8IA 3TTDA 1OH7A 4KHQA 3AVNA 1BCMA 3LALA 2P9SB 1OKJA 2RF2A 3NVMA 3W0LA 4JI4K 4FK0A 1SKRA 3DRSA 5D3GA 3HPHA 4M3YA 1VQ4N 5JMVA 4DSIA 4B1UB 2V52B 1S9GA 3MCPA 3TAMA 4DV0K 1IKVA 2P9LA 1Z05A 4ILGB 5TKWA 4EP4A 4XH5A 1REVA 4W5RA 1S1TA 1SL0A 1TKTA 4CCHA 2F96A 1WSGA 3H45C 1QSSA 1GLAG 2OPQA 3AA3A 4H0VB 3LDLA 1VQMN 4AF1A 5DK5A 4H0TB 1H0XA 2QKBA 3O5BA 3KLEA 2M71A 2NRXA 1PVYA 1YJ9N 1DGKN 3OYLA 2GUPA 3CQXA 4CJEA 4CJPA 4BE1A 2PYLA 1RDBA 4K86A 3ZSOA 3MXIA 4F8RA 4C1NK 5FPEA 3C0BA 1BA0A 4DR7K 1H4SA 4FJLA 4KPYA 4W5OA 2NRVA 4FM1A 3KKSA 2HBJA 4BE2A 1TKSA 4YOUA 4CFAA 1SV5A 3WEEA 4DMNA 2ZWHA 5HOOA 2FF3B 3L6QA 1RTIA 4CJSA 4O8KA 1RT5A 3OJSA 4CBWA 3HP6A 1EWRA 3CFPA 1B9FA 4Y1DA 3QDKA 2ETJA 3AAPA 3RVCA 2ZM6K 1KVCA 4CIEA 4EAHD 3JAMO 3M3ZA 4CVNE 1T05A 2FBVA 1ZBIA 1U2VA 4E1BA 4DKWA 1T44A 4GVEA 4DU3A 1XMOK 1C0GA 4XH4A 1DEJA 4CHQA 2ZF5O 3ZEUA 2G8IA 2G8WA 3WXJA 3P39A 4KH5A 4DR5K 1R59O 1K7JA 1JCUA 1HKGA 3AJEA 3HI0A 3UIQA 3DMJA 4WF9L 2YHAA 1YJNN 1HQUA 1NFHA 1HNVA 3AY9A 2QTDA 1RTHA 4A2BA 2DFHA 1NK0A 4FLVA 2KFNA 3CD6N 4M3TA 1PAVA 1X9SA 2OPSA 3ZSWA 4RW9A 4PY5A 1DTQA 2VWBA 3L2VA 4ELUA 3OYIA 5HROA 2P9UB 4A5BA 4FLWA 2QWNA 2O8BB 1TK8A 3LANA 4FWNA 2RHKA 4LF8K 3H08A 4JKGA 3O3FA 1U47A 4J2EA 3VEVA 3CFOA 5BR8K 3E9LA 4I6MA 4BC4A 3O8MA 5IT9O 2E8AA 3MK5A 5FRNA 4CFCA 4AHSA 4LFAK 5CYMA 3MCAB 4NO7A 1Q81O 3NMUA 3WQUA 4WFBL 4J2DA 1W0HA 3J7AP 3OA9A 3ZT2A 3VF4A 3P83D 1NGCA 4CF9A 1NK9A 1HYZA 4DFKA 2JLEA 3SUPA 5CY4A 4C8MA 3LP0A 3KZBA 1VSFA 4OO1J 1GLJO 3MXMA 4DS4A 5HP1A 1XMQK 1K4PA 2EX3A 3TANA 1JL2A 2WUSA 4DTRA 4V19S 2QWRA 2NNWA 1QQNA 3GE1A 1UOCA 3EYZA 3P38A 5AQYA 3I0RA 2A1RA 4JI2K 3CCVN 3ZSRA 3IDHA 4IJAA 3KLHA 1N8RO 3T1HK 4E7JA 4CGHA 4JKAA 1SAZA 3L3VA 1VQ6N 1NJXA 2D1KA 3V1QA 3ASMA 4PL8A 1JXEA 3IAYA 1S8EA 4B9VA 3AGRA 4FWPA 3KHYA 4JI7K 2B5JA 1GLFO 4IXCA 3WNFA 1L3UA 2P1JA 4CD3A 4MQ3A 1KCFA 4M3ZA 1JLFA 3DLBA 4JI8K 4HWIA 3K9JA 2HHTA 1ATSA 2KW4A 1UA0A 4HTUA 5C15A 1TKDA 1VQKN 4NLBA 3IMXA 3R8EA 1B92A 1VRTA 2O4GA 4DFPA 4W5QA 1HR0K 4FJ7A 2AP1A 4I9LA 4M3RA 4YHHK 2W6KA 2HB5A 1RT6A 3AO2A 3QKBA 3DOKA 1NK5A 2B6AA 4A62A 3KJVA 3L2UA 1X9JA 4DS5A 4H03B 5GAHP 1VSHA 2Q0UA 4IKFA 3CCJN 4FK4A 1VSLA 3VEZA 2E4LA 2QA4N 4UY8O 5HRPA 4K43A 3MECA 4B9TA 4NYNA 3WXMB 1WB9A 2O8DA 2PZSA 5JS1A 4EZ6A 3F9MA 2CH6A 2P9IA 4C8KA 3CJ7A 2HVIA 2F9WA 1TV6A 2Y1IA 1OH6A 1GLBG 1GOCA 1WAFA 4E7HA 2E1YA 4CJTA 1NJ1A 2P9PB 3MX5A 3CM6A 5HBMA 4DLGA 1J9AA 1NU0A 2Q3SA 4FJGA 3HSCA 1X3NA 1TAQA 1JXBA 3PSFA 5LMNK 3JYTA 3AVJA 1IH7A 4B9QA 3ZIHA 2GWKA 1P8ZA 2DFEA 1R0AA 2BGGA 4TWAA 3EY1A 2NLXA 5LMUK 3M6GA 3SPZA 3DWLA 3QEVA 4G1QA 1CLQA 4IDHA 3CCEN 2RKIA 4YKEA 4AILC 1QVFM 3RRGA 5HL7L 4NB4A 3TAPA 4CD1A 3H1VX 1QQMA 3O4NA 3F5TA 5AQTA 4NXNK 4BDPA 4OKEA 4CK2A 1O13A 2EK0A 1ASWA 3AA2A 4FWSA 3MEDA 3C95A 3KK2A 3V9XA 3BY5A 3T1AA 3ZCMA 3V9SA 3T7ZA 2LSNA 4CGJA 5SWMA 1M90O 4B1WB 2DTUA 4EHUA 1T6DA 3ZETA 3EKUA 3R6MA 1EXQA 2QWPA 5AFUH 1SQKA 4CGFA 3DXKB 3CJAA 4EHTA 4OPKA 3CC4N 4DTPA 1EP4A 4CZJA 4K8XA 2BKYX 1YITN 4XH1A 4J2BA 1TK0A 4IOAL 1KAXA 1QS4A 1W2BM 3AO5A 3VESA 4QS9A 3IABA 3NF7A 3SV4A 1LOTB 1G15A 5KTQA 1DTTA 3D2EB 1X9WA 4ILHA 2Q0RA 1JLEA 4Z4GA 3DLKA 3SV3A 1QZ6A 4BVOA 4B9LA 4JD2A 4MDAA 4AQYK 4IOXA 1IG9A 3EKSA 4AHUA 4U67L 4Z4EA 4DV1K 4HVJA 4IFEA 5C25A 4CJKA 3T3FA 3ULEA 4CECA 3H3OB 4N56A 2Y1BA 3LZJA 1MWMA 2VGMA 5EY4A 2GTCA 3K5NA 3KD1E 3TR8A 4DG1A 1NNEA 5AQMA 4DFMA 3TOEA 4Z4IA 3ZX2A 5AQSA 3CJBA 4KREA 3MXJA 3A5LC 4GMJB 4JI3K 4ISFA 1K73O 1ZXOA 3EO3A 2IS3A 3O6WA 1RNHA 2O8CA 3QEIA 4B1XB 1NGAA 3ZYYX 4YY3K 4QCLA 3KKRA 2FBTA 2MX1A 3CF5L 4FLXA 2WONA 3D7EO 1XQSC 3GOIA 3C6HA 2F8TA 4LC9B 3O80A 2Y1JA 3M8SA 3BUZB 3E66A 3LAMA 4L8RB 2E6MA 3AVKA 3KLFA 2GELA 1KAZA 3C7NB 2D4WA 4M7YA 2UXCK 2AJQA 1IBKK 1S1UA 2FBXA 3DOLA 2YI1A 3F73A 5FPDA 2UUAK 5CHIA 2IVPA 4H5RA 4BWJA 2OYQA 3BEXA 1TGOA 4HTLA 3QO9A 4LSNA 3G10A 3RMCA 1NOZA 2A2YA 1XWLA 3HZ7A 3DRRA 4FL9A 1LAVA 1NK8A 4FLYA 1SS6A 3NGIA 3RSEA 3VF6A 3V6DA 1JLQA 5GAEP 3UKRB 4F2SA 4KTZA 1G57A 1T03A 1Q9YA 4BC2A 3CCSN 1NBWA 3HM9A 5KPZA 3E9PA 1ASUA 3AARA 1IBLK 3SUOA 4FFJA 2LXRA 3L8BA 2BH1A 3QINA 3SJHA 4F3OA 2Q1NA 2WTUA 1NMNA 2HHHK 4DSEA 1N32K 4FZZA 3NGZA 3G71N 3VQ6A 3SQ1A 3ZX3A 2OANA 3H46O 4NYFA 3M8QA 2RPIA 2E88A 2O8FB 3VTIA 5AQFA 1V4SA 1WSIA 4B3OA 1FXXA 5KQDA 1J6ZA 4DB3A 4B3SK 4CZGA 1H0YA 1TIGA 4JV5K 4BR2A 1CZAN 1QZ5A 3WBMA 2KZMA 3FLCO 3FZKA 3TARA 5JICA 5HLFA 3ZT1A 3V9ZA 1VSIA 3ULDA 3PV8A 1WSHA 3ATVA 4DSJA 5LY3A 1Y97A 4J8FA 2YNHA 1QVGM 3LP3A 4Z4FA 1K4IA 2BDPA 2ZJQL 3OVNA 1U6ZA 1N6QA 2KHOA 1XHXA 4QOZB 4ZTJA 3AO4A 4FBWA 2J4RA 4I7FA 3OS2A 3PX4A 5M1NA 3THWA 3PY8A 2V51B 5JLFA 3S3OA 3U6FA 3S9HA 4B08A 3LP1A 3NHGA 1NM1A 1HNZK 1II7A 3CCRN 4E1MA 3V1OA 1W97L 3FZFA 1ZC6A 4CHPA 1TKXA 3SZ2A 4HUGA 2YNFA 3AA5X 1NGJA 4Z9EA 3CFRA 5GIPA 4JHDB 5T7BA 1NG9A 1NWKA 3FGUA 4BRDA 3Q7CA 1RBSA 4KI4A 2PYJA 1V4TA 1TKUA 1VSMA 4BY9C 3D2FA 2QWMA 1GLLO 3M8PA 4IG0A 3WXLA 3NH1A 3OYCA 4LF7K 3HPOA 4PA1A 1BI4A 3FFKB 3E1YA 3TABA 4H5WA 1Z25A 3DXMB 4DU1A 4Q0BA 2G8HA 3H07A 4IG3A 1G58A 4ICLA 5ELZA 4FJHA 4B3RK 1S1XA 3CMEN 3EE9A 4CJWA 1N5YA 1S1VA 3QIOA 4IOCL 3QICA 3HM8A 3LVJC 4P6CA 4K41A 2GV9A 4CEAA 4EIAA 4CEZA 4GNIA 4NCGA 4CFBA 3VF2A 3VN5A 1Q82O 1KLMA 4KV8A 3TWHA 4ISEA 3KWGA 3OYKA 3CJ1A 3MDQA 4LF5K 4L3QA 3FR0A 1YJWN 3VQPA 2HNDA 2P9NA 2VG7A 3UKUB 4I9QA 2P9KB 2CGLA 4RG8A 4CJVA 2EHGA 4CJFA 2HF4A 3WUHA 2QXFA 5AFUA 1YVUA 1SZ2A 4B8CA 5H1SQ 4OPHA 1N33K 4XEIA 5LL6Z 1S72N 1BGXT 4YDUA 3T69A 3HYFA 1XI1A 4IZ9A 2YNIA 3ZT0A 3DAWA 1S6PA 1HNWK 3TSPA 1XEZA 5J2NA 2NRRA 3ENOA 1KK9A 2O4IA 3EN9A 4CZHA 5CR4A 4Q15A 4DQRA 1NMDA 4IDKA 1UAXA 1LN4A 1C1CA 2W6LA 2NUBA 4KH6A 3C6TA 3I0SA 3WXKA 4OVLA 2ASOA 4H5VA 2E2PA 4O5FA 1MDUB 2G8VA 3VENA 2NZTA 1X9MA 4IFYA 5FPNA 5KRTA 3HOSA 5GAGP 2VG5A 1LWFA 3IFRA 3AV9A 4FWKA 3JS6A 5FDLA 3HXMA 3U3YA 4FXDA 4JKHA 4NLCA 2Z7CA 2YHXA 4N41A 4HVZA 4JYAK 3AGKA 3L7VA 5AQZA 1TYQA 5C2DA 4OLFA 4BVPA 1P90A 3SQ0A 5CE3A 3K59A 2ZQBA 3K2PA 4EZ9A 4CIGA 4O8UA 3C94A 1IG8A 3RRHA 4FBQA 1ILYA 2QWOA 1TKZA 3RMDA 4YNQA 4U7BA 2YHYA 4YFUA 1E4GT 1NJWA 4JLHA 5MLCQ 1K9MO 3WNGA 2E1ZA 3B6PA 4JK9A 2BTFA 3LZIA 4OGCA 4FPAA 1NJZA 4CIFA 3K5MA 2A42A 4DU4A 3WQTA 5I3UA 3P31A 3QEXA 3ITHA 4HVCA 4BDZA 3ISNC 4YOXA 4FPBA 4DTXA 2ZGZA 3J7ZO 4NCAA 3VERA 4LF4K 5BRFA 1FK9A 3QB0A 4FYDA 1BIZA 3J80O 3J81O 2IC3A 2NRZA 3I56N 2A6AA 1LWCA 1WAJA 4CHOA 2G8FA 4IJNA 3A0IX 5E84A 1XNQK 1K49A 2HMPA 2UXBK 5CZ2A 3CPEA 3PUFA 5AQVA 5J2PA 1BU6O 2HBMA 4CEFA 1D8YA 4BRAA 4BRKA 3D45A 1ZBHA 5AJ3K 2JWKA 4FOIA 5F1XA 4M3XA 1HJRA 4BR0A 2QWLA 3AVCA 3TAGA 3VGMA 1L3SA 3AVAA 4LFCK 3PX0A 4RW6A 1KFDA 3QMLA 2HVHA 2VWJA 4KHUA 3L2WA 3O9RA 1RT7A 1KVAA 3R1XA 3LM9A 2VG6A 2KQ2A 4E3SA 1D5AA 2YV0X 3EZWA 3VEYA 3THXB 1JLCA 2D0AA 5AQJA 4A2AA 4CF8A 5LJWA 1RT4A 4DQQA 4CK1A 3ZSYA 3U8XA 2OZMA 1JLAA 1LW0A 4BRMA 4BC5A 3ID6A 1JLGA 4DF8A 4KFBA 4CJ5A 3BDPA 2E6LA 2YKMA 4CE9A 3V1RA 4CZKA 1L5UA 3SQ2A 2VYPA 3VQCA 4M3UA 5E26A 1NK7A 3SMSA 4FWMA 2WOMA 3S3MA 3O4WA 4MLHA 4KB0A 1HRUA 3CPWM 4C1NI 4GW6A 3OJUA 4FJ8A 2ZJRL 4BROA 1CXUA 3THYB 5KPTA 3NF6A 2HBKA 1ZBLA 2JGUA 3TAEA 1CXQA 1K8AO 2IDOA 1RT2A 4JKBA 2KZZA 4Z4CA 4H4OA 2X74A 4YOWA 5B8HA 4DTSA 1IJJA 2ASMA 3SPYA 3VTHA 1WSJA 3RR7A 5LJVA 4DV7K 1RQ8A 3HJFA 4P8JA 1SL1A 2KFZA 3G4SN 4A61A 4OJRA 3GL1A 4FM2A 3KLGA 1JJ2M 5AZIB 5GINA 1BDGA 4GV3A 1K8KB 3VPZA 2Z1JA 4R79A 3O1WA 4B1ZA 3CETA 2OCEA 4ZTFA 3TTFA 4KO0A 3O9QA 4YOTA 5EOYA 1RFQA 1EETA 3VA3A 1C0UA 2F4VK 3NF9A 2P9LB 2YJFA 1S5JA 4H8KA 4DUZK 3IKMA 4FW2A 4H5TA 3CMAN 1WSEA 4O4GA 1N34K 1OH8A 3CQ8A 4N47A 3SQ4A 3AVBA 3NF8A 1LW2A 1WOQA 1JO0A 4Y0WA 2HHUA 4AHTA 4JKDA 1MWKA 3SUQA 3QNOA 4HCCA 3MEGA 2G8KA 4B9NA 1VSEA 2I7NA 4BRLA 2DY4A 5HRNA 4N5SA 3KVGA 1PVWA 1F21A 4JI6K 3AVGA 4Q5VA 1GOAA 2P9SA 4FJKA 2KTQA 3VEWA 5BPLA 4FZXC 5GADP 2EH1A 4JS5A 3T1IA 3SCXA 3J8AA 4FLTA 4FCXA 4DTUA 2NRWA 3TI0A 4E7IA 4DSLA 4YOVA 2XY6A 3ZT4A 1HYVA 1IEZA 3CCQN 3SI6A 4ZHRA 3DRPA 2O8EB 4BGBA 2UU9K 2P9KA 3A5OC 5M1OA 4M42A 4QAGA 2QW9A 3MN6A 4FK2A 1HRHA 4LH5A 4B1VA 1A5XA 1IO2A 4FOEA 4CK3A 2GWJA 4CF2A 3P4IA 3PIPL 5C12A 4JK7A 2XY7A 3DJCA 3AO3A 2QM1A 4EO0A 1X3MA 3OTOK 4P6DA 1U2VB 2E2NA 1X1PA 2HHSA 5C0YA 3J7YP 1NJIO 4OPAA 3DSCA 3ZEUB 4DUYK 1KQSM 1XC9A 2D0BA 3TAQA 2WC9A 3SMPA 1OH5A 1ZYQA 2VCPA 2RE2A 3VQEA 4B9MA 3QBXA 4E19A 2PAVA 3ATUA 1T7PA 4PHTX 4GY2B 3IG1A 1KC8O 3UB5A 3QBWA 2D0CA 5AQNA 1BL3A 3I8DA 3CI5A 3OBYA 4X64K 2V7ZA 3R9PA 3MGZA 3AVIA 2X6NA 3NH0A 4FJMA 4B8AB 2IGIA 4PKGA 3PSIA 1ASVA 2DPNA 2XRIA 3CJ9A 4LH4A 4BRCA 3KLIA 3LDSA 4KI6A 2XY8A 4JKGB 1I39A 2HF3A 5K14A 2X78A 3BF3A 4I6MB 2HMIA 4P8EA 3OHRA 1RTJA 2HHQA 3NH2A 3DLHA 3DLEA 4QS8A 3EEQA 2BANA 1VQ5N 3VEOA 1MU2A 3FFIA 1RTDA 3AVHA 3U6YA 1BUPA 5EU7A 1HC7A 4CJRA 3VGLA 4CJQA 1C1BA 3CJCA 3I33A 3MAQA 3FZLA 3ZT3A 4BRHA 4HUFA 4HCBA 1NGEA 3AAQA 1KAYA 2ZD1A 2CGJA 3OBWA 4K87A 1VSKA 3A5NC 2VGNA 1WLJA 4WQ4A 2HBLA 4NXMK 2VQEK 4E7LA 4MDBA 3H6EA 1VHXA 1RDUA 4CZLA 4GV9A 2P9UA 3A5MC 2PY5A 3TTCA 3K58A 4AH9A 2O8BA 1Q86O 2Z1HA 1J54A 4OKJA 2A5XA 3O1BA 1UDVA 1ITGA 1XUPO 5AR0A 1NK6A 4BRGA 1YTAA 5KI6A 3LWLA 1E4FT 4PQUA 5BRDA 4C23A 4DV6K 3PO4A 3C6AA 3EL2A 3QFPA 4BACA 4H0XB 2GBZA 2RISA 1BIUA 3P5JA 4KTWA 3FZHA 3VA0A 1JCFA 3O9TA 2ATQA 3CIPA 5FRMA 4EFHA 4O0JA 4UQGA 5AQKA 4CGGA 3ZSXA 2IOCA 4FJJA 1HPMA 1L3TA 1BQMA 1BG3A 4WYBA 3VEXA 4E1JA 3SAGA 1BA1A 3Q7BA 1NJ6A 3RR8A 1YAGA 3W3DA 4Z0UA 1ZBSA 3AA4A 3MWTA 1LWEA 4FO0A 4HD0A 3VQ7A 4CEBA 3AO1A 4GVMA 4K8ZA 1IKXA 2OA8A 4A59A 4KHYA 1OVQA 1BOTO 5AQQA 5KRSA 3T1YK 4CZFA 1IBMK 5C2FA 4M3WA 1VSJA 4B9UA 4BE0A 2O8DB 1D9FA 5AZJB 3LQUA 1JKHA 1S6QA 2ITMA 1RDCA 4KHWA 1RDDA 2YCHA 4G9ZA 4I14A 2P9IB 3OYDA 3K5OA 4KHSA 4BRFA 3KK1A 1RBVA 2LN3A 4BWMA 4J2AA 5KGXA 2HHVA 5M1QA 2E2QA 1Y9XA 3QEPA 4I2QA 3LDPA 1HLUA 5BRHA 2IVOA 4CHNA 4DQSA 5F0XA 1XHZA 4TSXA 5BN8A 2NRTA 4CJLA 4CJUA 1QSLA 1K6YA 3B6OA 4AM7A 4DTOA 3VQ4A 1RBTA 2OTLN 1NGGA 4LD0A 1U4BA 4A57A 1QE1A 4FWLA 3LS6A 3OY9A 1RILA 1ESVA 4CGIA 4F9OA 5E41A 3OYBA 4OX9K 2IVNA 4DTMA 4RW7A 3RMBA 4HUEA 3SYZA 3VOVA 3CXCM 1U45A 3TPQA 3GG4A 3B8AX 3HP9A 1Y64A 4JRQA 1NK4A 4P77A 1QSYA 3H3NO 1VQPN 4KBOA 4B1YB 3CCMN 4MO5A 3V81A 4JEPA 3BZCA 1HNIA 5AQPA 3ZSVA 1EX4A 3AVLA 4QS7A 3HPGA 4ID1A 1J53A 2WBNA 3LP2A 2QWQA 2P9PA 1VK0A 2QI2A 3VQDA 3BP8A 1Z6RA 1YIJN 1T6CA 4DTJA 2FC0A 4LFBK 3VETA 3CCUN 3L2RA 2CH5A 1C0FA 5IWAK 1LV5A 4CHYA 3CYMA 3ZETB 5FROA 5BR9A 1RT1A 4FLUA 4N76A 4DF4A 3FZMA 4LF6K 3ID8A 3G25A 4WFAL 4DWIA 3WNEA 3QEWA 4JN4A 3MMVA 3WXIA 1FJGK 1DT9A 3MK6A 2WFBA
chains in the Genus database with same CATH topology
4EHUA 1T6DA 4YDUC 4DCHA 3ZETA 3UE5A 3HTVA 3O9RA 1HKCA 3R1XA 4IO8A 3LM9A 3EKUA 3R6MA 2YX6A 5AFUH 2QWPA 1SQKA 1KXPA 2YHWA 3CJAA 3DXKB 4EHTA 3CC4N 4CZJA 5AQRA 3H1QA 1GLDG 3EZWA 4JD2B 3VEYA 1SNNA 1EQYA 4XH1A 1YITN 5AQJA 1VAZA 4A2AA 1KAXA 4IOAL 1W2BM 1VQ8N 2GTDA 3VESA 4QS9A 5LJWA 1LOTB 3ULEB 4FSVA 3SAHA 4Z94A 3D2EB 1OVYA 3U8XA 2AA4A 2QEXN 4ILHA 2Q0RA 4BRMA 3ENHA 5GIOA 1QZ6A 3DXKA 3ID6A 4BC5A 1YUWA 4BVOA 4JD2A 4MDAA 1GLEG 3KWIA 4P6PA 4JK8A 4IOXA 1XC3A 3EKSA 4WQ5C 4CZKA 4WQ5A 1YVNA 4U67L 2VYPA 1Q7YO 3ZIGA 2FXUA 4IFEA 4H5NA 2CGKA 2EWSA 5E26A 3ULEA 3SMSA 5BN9A 4FWMA 3PIOL 3OW2M 3H3OB 3D2EA 3O4WA 4MLHA 3ZIEA 3R3LA 1HJOA 4FWRA 5AQHA 1YHQN 1HRUA 1MWMA 2VGMA 5EY4A 4BR4A 3CPWM 4C1NI 5AQLA 2ZJRL 4BROA 3N4PA 1RGIA 1RDWX 5AQMA 5KPTA 3ZX2A 5AQSA 2HBKA 3CJBA 5TKYA 5BPMA 3A5LC 1K8AO 4NZRM 3HRGA 4JNEA 4ISFA 3MN5A 3O9UA 1K73O 1ZXOA 3CQYA 3EO3A 3O6WA 3SK3A 2Q2RA 3LL3A 4JKBA 5M1KA 4B1XB 1NGAA 1M1KO 3L4IA 5JVGL 4FBKA 1HUXA 1NGHA 3C65A 3ZYYX 4BR9A 4GV9A 4MO4A 3SLCA 2MX1A 4YOWA 4JKEA 5B8HA 3CF5L 1GLCG 1IJJA 2Q31A 4AM6A 1QHAA 2ASMA 3D7EO 1XQSC 3GOIA 3C6HA 4LC9B 3O80A 4E1BA 3QFUA 3VTHA 1VQLN 2H3GX 3MWPA 3BUZB 1MA9B 3E66A 4BRPA 4WCEL 5LJVA 4PL7A 2ZJPL 4P8JA 1YI2N 4BQLA 3G4SN 2GELA 4A61A 1KAZA 3C7NB 2D4WA 3N4QA 4M7YA 2HSTA 3GL1A 5AQIA 5F2RA 5DM7L 1NGBA 1JCGA 2UYTA 5KPRA 4CZEA 4DQ8A 1JJ2M 5AZIB 5GINA 3K9KA 1BDGA 3CCLN 4GV3A 2YI1A 2PBDA 3CHWA 1HX1A 1K8KB 3MIOA 3VPZA 3U9DA 5FPDA 4GV6A 5CHIA 4R79A 2IVPA 4DHYA 4YOYA 3FE1A 3O1WA 1S3XA 3CETA 4FWOA 4H5RA 4B1ZA 3RSEB 1K4OA 3BEXA 3HZ6A 3TTFA 3GBTA 5ADXH 3O9QA 4YOTA 3C7NA 5EOYA 1RFQA 2ZGYA 4HTLA 1NGDA 4M63C 3TSQA 4RCHA 4BC3A 5AZIA 3CERA 1EO1A 4FL9A 3G6EN 2P9LB 2YJFA 1K8KA 3VGKA 1SS6A 2GX9A 3IKMA 4H5TA 2D0PA 5EXWA 3RSEA 3VF6A 3TTDA 4IEEA 3CMAN 5GAEP 3UKRB 2P9SB 1G57A 1OKJA 3NVMA 3W0LA 2EQAA 4BC2A 3KK7A 1WOQA 3CCSN 4RTFD 3HBTA 1NBWA 5KPZA 1VQ4N 1S22A 2W40A 3E9PA 1H1VA 4Y0WA 5JMVA 4B1UB 3AARA 2V52B 3MCPA 4JKDA 1MWKA 2P9LA 2FF6A 1Z05A 4FFJA 2I7NA 4BRLA 4ILGB 5TKWA 3CC7N 3KVGA 1PVWA 2BH1A 2P9BA 4XH5A 3UKRA 2P9SA 3ENBA 3SJHA 3LRJA 2Q1NA 1QQOA 3H45C 1YF5L 1GLAG 2FSKA 3VEWA 5BPLA 5GADP 2A40A 3T1IA 4NZTM 3G71N 4H0VB 3L0QA 2F9TA 3J8AA 4FCXA 3LDLA 1D4XA 4AF1A 3ZX3A 1VQMN 2OANA 4H0TB 4PKIA 3H46O 2NRWA 3O5BA 2E88A 3M5RA 3VTIA 5DM6L 5AQFA 1LCUA 4CZIA 1V4SA 4YOVA 2NRXA 1IEZA 3CCQN 1PVYA 2Q97A 1YJ9N 1DGKN 2GUPA 3CQXA 5KQDA 1J6ZA 4DB3A 2JWLA 4YORA 4BGBA 4C1NK 4CZGA 2P9KA 5FPEA 3A5OC 3C0BA 5M1OA 4BR2A 1BA0A 1CZAN 1QZ5A 2QW9A 3MN6A 3FLCO 1Q18A 2NRVA 5AQOA 3FZKA 4B1VA 1VQ9N 4FOEA 2HBJA 5JICA 2GWJA 3P4IA 3PIPL 4YOUA 5C12A 1TKSA 3WT0A 4JK7A 1YXQA 3ATVA 3DJCA 2QM1A 4EO0A 3WEEA 2ZWHA 5HOOA 1X3MA 2FF3B 1DKGD 1U2VB 2E2NA 3L6QA 4JKCA 4J8FA 5LY3A 1QVGM 5C0YA 4P6DA 2I7PA 1NJIO 2ASPA 4O8KA 4CBWA 1K4IA 2ZJQL 4OPAA 1U6ZA 3ZEUB 3LDNA 3QDKA 4A5AA 1NGFA 1KQSM 4FVUA 5EVZA 2KHOA 3AAPA 2WC9A 3RVCA 1JCEA 3SMPA 1ATNA 4BGAA 4FBWA 2J4RA 5AQXA 1VQ7N 2VCPA 4EAHD 2V7YA 3M3ZA 3O08A 2RE2A 5M1NA 3QBXA 4H0OA 2PAVA 3ATUA 1VQNN 4PHTX 4GY2B 3CC2N 1U2VA 2V51B 3P04A 3E9OA 4DKWA 1T44A 4GVEA 3UB5A 5JLFA 3QBWA 1KC8O 3I8BA 5AQNA 1C0GA 4XH4A 1DEJA 1NM1A 4BRNA 3ZIIA 2ZF5O 4PKHA 3ZEUA 3CCRN 2A3ZA 3CI5A 3OBYA 1W97L 3WXJA 4WFNL 3P39A 3TSUA 3D2FB 3FZFA 1ZC6A 1R59O 4KH5A 1K7JA 4K25A 1JCUA 2V7ZA 3BF1A 4RWTA 4H0YB 1HKGA 3R9PA 3AJEA 3HI0A 5AQWA 3MGZA 3O9SA 4CI6A 4WF9L 2DPNA 4PKGA 1NGJA 3CJ9A 4BRCA 4CBXA 5GIPA 1YJNN 5AZJA 3AY9A 4JHDB 2QTDA 3U4LA 1NWKA 1BWFO 3FGUA 4JKGB 4A2BA 4BRDA 2HF3A 2BUPA 3BF3A 3Q7CA 4I6MB 3VMFB 4P8EA 3OHRA 1TKUA 1V4TA 4QS8A 4BR7A 3CD6N 4BY9C 3D2FA 2QWMA 1GLLO 3WXLA 4BG9A 5I9EB 1VQ5N 3VEOA 3FFKB 3E1YA 4IEIA 4H5WA 2VWBA 3DXMB 4BREA 2P9UB 1BUPA 4A5BA 3VGLA 2QWNA 3M1FA 4JHDA 3H07A 4FWNA 1G58A 2RHKA 3CJCA 3I33A 4JKGA 5JLHA 3FZLA 5ELZA 3VEVA 1WUAA 4BRHA 3E9LA 3IUCA 1NGEA 3AAQA 4I6MA 1KAYA 3OBWA 2CGJA 2E8AA 3O8MA 4BC4A 3EE9A 3A5NC 3MK5A 2VGNA 4WQ4A 2HBLA 2E20A 4IOCL 1G99A 3MCAB 3HM8A 3QICA 4MDBA 4BQZA 3H6EA 4P6CA 2FLOA 1RDUA 4NO7A 3DXMA 2P9NB 4BR5A 4ISGA 2P9UA 2YJEA 3A5MC 4K41A 3TTCA 4CZLA 4EIAA 3MX2A 1Q86O 3NMUA 2Q36A 4GNIA 4M7XA 3WQUA 2A5XA 4WFBL 3O1BA 3VF2A 3ZX0A 1Q82O 3OA9A 3EE8A 4IWVA 3VF4A 2F7TA 3LDOA 4ISEA 1NGCA 3KWGA 1XUPO 3CJ1A 1TUYA 5AR0A 3MDQA 4BRGA 4L3QA 3FR0A 3KZBA 1YJWN 2P9NA 3UKUB 4OO1J 1E4FT 1GLJO 2P9KB 2IIRA 5BRDA 4C23A 2CGLA 1K4PA 3F2KA 4KH4A 2WUSA 3C6AA 3EL2A 3QFPA 2HF4A 4H0XB 3WUHA 2QWRA 2NNWA 1QQNA 4ILJA 1SZ2A 3GE1A 5AFUA 5H1SQ 2RISA 4OPHA 4XEIA 3L4QA 3P38A 1S72N 5AQYA 3FZHA 4JKFA 4YDUA 3T69A 5JVHL 1JCFA 3CCVN 3IDHA 3O9TA 4IJAA 3WEEB 3SAFA 4IZ9A 3CIPA 4BRIA 1N8RO 4EFHA 1NGIA 3UKUA 3DAWA 5AQKA 4JKAA 1SAZA 3LM2A 3HOTA 3TSPA 1VQ6N 1XEZA 3U9ZA 2NRRA 1HPMA 2D1KA 3ENOA 1KK9A 4PL8A 3EN9A 3LDQA 4CZHA 3SBGA 1BG3A 4WYBA 5CR4A 3VEXA 4K42A 4E1JA 3AGRA 1NMDA 4FWPA 3SAGA 1BA1A 3KHYA 3Q7BA 4KH6A 1GLFO 4IXCA 3WXKA 1ATRA 3PLAA 2ASOA 4CD3A 4H5VA 2E2PA 4MLEA 4O5FA 1NLVA 1MDUB 2NRHA 3VENA 1YAGA 4HWIA 3W3DA 2NZTA 1ZBSA 3K9JA 5FPNA 4CJ7A 3MWTA 4FO0A 1TYQB 2QXLA 3HOSA 5GAGP 1ATSA 5EX5A 3IFRA 5C15A 1VQKN 3I55N 4NLBA 3IMXA 4FWKA 3JS6A 4A59A 3R8EA 1BOTO 5AQQA 4JKHA 4CZFA 2HOEA 4NLCA 3NVKA 5C2FA 2W41A 1HKBA 2YHXA 2AP1A 3S41A 3LQUA 5AZJB 4HVZA 2RIUA 4G9ZA 2ITMA 3AGKA 2YCHA 3L7VA 1BO5O 5AQZA 4I14A 5AQUA 2P9IB 1TYQA 5C2DA 4BVPA 1P90A 5M1PA 4BRFA 5CE3A 4A62A 2D0OA 2LN3A 1X9JA 5FPMA 5KQ8A 4H03B 5GAHP 5M1QA 2KLAA 2Q0UA 4UY8O 4O8UA 3CCJN 2E2QA 3VEZA 2QA4N 3LDPA 1HLUA 5BRHA 1IG8A 2IVOA 5BPNA 5F0XA 4K43A 4FBQA 5BN8A 3WXMB 2NRTA 1ILYA 2QWOA 4U7BA 2YHYA 4AM7A 4BRQA 1E4GT 3F9MA 1KD1O 2CH6A 2P9IA 5MLCQ 2OTLN 1K9MO 1NGGA 3SBTA 2E1ZA 4A57A 4FWLA 4JK9A 2BTFA 2A41A 3TU5A 3LS6A 3MN9A 3CJ7A 1TUUA 1ESVA 4F9OA 2F9WA 4CZMA 2IVNA 4FPAA 1GLBG 2A42A 2E1YA 3VOVA 3CXCM 5AQGA 2E2OA 3TPQA 3WQTA 2P9PB 3GG4A 3P31A 3B8AX 2GEMA 3MX5A 3CMEN 3GDQA 5ADXA 1Y64A 1T3VA 4P77A 3H3NO 4YOXA 4FWQA 4FPBA 1VQPN 4KBOA 4B1YB 3CCMN 4MO5A 5BREA 2ZGZA 2OTJN 4JEPA 3J7ZO 4WQ4C 3HSCA 1X3NA 3VERA 2FSJA 2FSNA 5AQPA 4IO9L 5M1FA 1K4LA 4QS7A 4CBUA 4JAXA 5BRFA 3QB0A 2WBNA 4B9QA 3ZIHA 2QWQA 2GWKA 2P9PA 1P8ZA 2QI2A 3JXUA 3BP8A 2NRZA 3I56N 2A6AA 1Z6RA 2NLXA 1YIJN 3M6GA 1T6CA 3A8YA 4IJNA 3D6RA 3A0IX 3DWLA 5E84A 3VETA 3CCUN 4H0PA 1K49A 2HMPA 2CH5A 1C0FA 3DLLL 1VQON 4IDHA 3CCEN 3CPEA 4YKEA 5AQVA 1QVFM 4BG8A 1BU6O 2HBMA 3ZETB 5HL7L 5C10A 5BR9A 4BRAA 4BRKA 1Q81O 2JWKA 4FOIA 4NB4A 5F1XA 2KKZA 3FZMA 4CD1A 3H1VX 1QQMA 2PFUA 3F5TA 3ID8A 5AQTA 2QWLA 3G25A 4BR0A 4WFAL 3VGMA 1O13A 3MN7A 4FWSA 4JN4A 3MMVA 3WXIA 1DT9A 3MK6A 3QMLA 3T7ZA 2WFBA 1M90O 4B1WB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VES A;  3VTI A;  3TSU A;  3TTD A;  3VTH A;  3VER A;  3VF2 A;  3TTC A;  3VEW A;  3VEZ A;  3TSP A;  3TSQ A;  3TTF A;  3VEO A;  3VET A;  3VEX A;  3VF4 A;  3VEN A; 
#chains in the Genus database with same CATH topology
 1SKW A;  5JS2 A;  3IAB B;  4F2R A;  4YDU C;  4DCH A;  1FW6 A;  3C6U A;  1SL2 A;  3UE5 A;  3HTV A;  3ALY A;  1KFS A;  1A5V A;  1KLN A;  5J2M A;  1Q9X A;  4DQP A;  2YHW A;  5AQR A;  1ZBU A;  1GLD G;  1Z26 A;  4JD2 B;  1SNN A;  4WI1 A;  3K0S A;  3SUN A;  1VQ8 N;  4HHT A;  3S3N A;  4AHV A;  4Y1C A;  3ULE B;  4Z94 A;  1RBR A;  4LSL A;  2OPP A;  4KAZ A;  2ZE2 A;  5GIO A;  4DR4 K;  3DXK A;  3K57 A;  3LVK B;  1LAW A;  3TAF A;  3KWI A;  3KD5 E;  4JK8 A;  4CJ4 A;  1XC3 A;  1YVN A;  4DR6 K;  4FZY A;  1O1W A;  3M8R A;  1TL3 A;  4H5N A;  5BN9 A;  3PIO L;  3OW2 M;  2O8C B;  4KHP K;  3D2E A;  3R3L A;  4FWR A;  5AQH A;  1YHQ N;  4FCY A;  2UUB K;  2O8E A;  5AQL A;  3L3U A;  1RGI A;  1RDW X;  1N36 K;  4C8O A;  1E3M A;  5TKY A;  4IBN A;  4CER A;  4NZR M;  4JNE A;  3O9U A;  1WBD A;  2Q2R A;  3LL3 A;  5M1K A;  1M1K O;  3L4I A;  5JVG L;  4FBK A;  1FKP A;  1HUX A;  3C65 A;  4BR9 A;  4CHZ A;  3O4Q A;  4JKE A;  5CYQ A;  1VSD A;  3VQA A;  4CGD A;  4OLA A;  1DCJ A;  3QFU A;  2OZS A;  1BCO A;  3NBP A;  1VQL N;  4R5P A;  4OLB A;  3MWP A;  4BRP A;  4WCE L;  4PL7 A;  4KB1 A;  5DM7 L;  2HST A;  5AQI A;  3P1G A;  1JCG A;  2UYT A;  5KPR A;  4CZE A;  4DQ8 A;  5CZ1 A;  4NCB A;  4O5B A;  2PBD A;  3CHW A;  1HX1 A;  3MIO A;  1WBB A;  3U9D A;  4YOY A;  4DHY A;  3RSE B;  3HZ6 A;  4CF0 A;  1BQN A;  3AVM A;  4CFD A;  4CW7 B;  5ADX H;  3C7N A;  2ZGY A;  1NGD A;  4EP5 A;  4DR3 K;  3RMA A;  3CER A;  4DR1 K;  4FJ9 A;  4K0K K;  2HW3 A;  1EO1 A;  3G6E N;  3HVR A;  3KTQ A;  5EXW A;  1IKW A;  4RW4 A;  4IEE A;  3NAE A;  1NJ8 A;  1ZBF A;  4DFJ A;  2EQA A;  3KK7 A;  1H4Q A;  1BIS A;  4RTF D;  3HBT A;  1S22 A;  2W40 A;  3LPU A;  1H1V A;  4FJX A;  2QKK A;  2P5O A;  4C8L A;  3V9U A;  2FF6 A;  4GKK K;  4B3T K;  1GOB A;  3CC7 N;  3DI6 A;  2P9B A;  4LF9 K;  3UKR A;  4GKJ K;  3ENB A;  4E0D A;  1WN7 A;  1EKE A;  3LRJ A;  4WE1 A;  1QQO A;  3VQ8 A;  5J2Q A;  1YF5 L;  2FSK A;  1HPZ A;  2A40 A;  3KIO A;  1HNX K;  4NZT M;  3LWM A;  1JLB A;  3L0Q A;  2F9T A;  4OGE A;  1D4X A;  1HQE A;  3D0P A;  3G0Z A;  4PKI A;  1KSP A;  2B4J A;  4F3T A;  1NKC A;  3M5R A;  5J1E A;  5DM6 L;  1LCU A;  1VM0 A;  4CZI A;  3DM2 A;  4FJI A;  3VQQ A;  2Q97 A;  5I42 A;  2JWL A;  4YOR A;  3U3G A;  3WNH A;  4DV3 K;  4FLZ A;  3DSD A;  3O3H A;  4E89 A;  1U48 A;  4F4K A;  1Q18 A;  2O8F A;  5AQO A;  1VQ9 N;  5SZT A;  3HST B;  2X6S A;  3WT0 A;  3HL8 A;  1YXQ A;  4W5T A;  2VWK A;  1DKG D;  3THW B;  2HNY A;  4JKC A;  3PX6 A;  2I7P A;  2ASP A;  3NCI A;  4A5A A;  3LDN A;  4FVU A;  1NGF A;  5EVZ A;  1JCE A;  1ATN A;  4BGA A;  5AQX A;  4BDY A;  1VQ7 N;  2V7Y A;  3O08 A;  4H0O A;  4ID5 A;  4JS4 A;  1NJ5 A;  1VQN N;  3CC2 N;  3E9O A;  3P04 A;  3I8B A;  5HRR A;  4BRN A;  3ZII A;  4PKH A;  1NH9 A;  2A3Z A;  4WFN L;  5HRS A;  1CZ9 A;  3TSU A;  3D2F B;  4CJ3 A;  1RBU A;  3QIP A;  4K25 A;  3BF1 A;  1JDQ A;  4RWT A;  4H0Y B;  1BI4 B;  5AQW A;  3O9S A;  4CI6 A;  1JL1 A;  1W9H A;  3SJJ A;  4CBX A;  3CG7 A;  3QET A;  1W7A A;  5AZJ A;  4DTN A;  4CES A;  2P51 A;  3RTV A;  2Z1I A;  3U4L A;  1BWF O;  4DR2 K;  2BUP A;  3VMF B;  1DLO A;  4BR7 A;  1WNS A;  4BG9 A;  5I9E B;  1TK5 A;  4IEI A;  4BRE A;  4DV5 K;  2YNG A;  3M1F A;  4JHD A;  3E01 A;  1S1W A;  5JLH A;  2BE2 A;  3CM5 A;  5C42 A;  1WUA A;  3IUC A;  1HMV A;  1I94 K;  3OS0 A;  4ELV A;  1JE3 A;  4DLE A;  3LAK A;  5DMR A;  2E20 A;  3HK2 A;  1IV0 A;  1G99 A;  4BQZ A;  4B9S A;  2FLO A;  4O0I A;  3DXM A;  2P9N B;  4BR5 A;  2IFE A;  2RN2 A;  2YJE A;  4ISG A;  1U04 A;  3MX2 A;  2Q36 A;  4M7X A;  1NJY A;  4CEQ A;  3L2Q A;  3ZX0 A;  3AVF A;  2H9U A;  3EE8 A;  4IWV A;  2F7T A;  3LDO A;  2OPR A;  1TUY A;  4KRF A;  2IIR A;  4CEE A;  3F2K A;  4KH4 A;  4ILJ A;  4JRP A;  3KK3 A;  3L4Q A;  2XY5 A;  4JKF A;  4JI0 K;  5JVH L;  3WEE B;  3SAF A;  1EWQ A;  1A5W A;  4BRI A;  1NGI A;  3UKU A;  4JI1 K;  4AHC A;  1L3V A;  3LM2 A;  4MFB A;  1H4T A;  3HOT A;  3U9Z A;  4CEO A;  3LDQ A;  1QQC A;  3SBG A;  3VQB A;  4K42 A;  2UUC K;  1ATR A;  3PLA A;  4MLE A;  4DV4 K;  1NLV A;  2NRH A;  4CJ7 A;  1TYQ B;  2QXL A;  5EX5 A;  4JI5 K;  1CZB A;  2D5R A;  3I55 N;  4E7K A;  4ELT A;  2XHB A;  4O44 A;  4XIU A;  4FJN A;  2HOE A;  3NVK A;  2W41 A;  1HKB A;  3OYF A;  3S41 A;  3NDK A;  2RIU A;  3DLG A;  1BO5 O;  5AQU A;  4LY7 A;  4DV2 K;  4E1N A;  1IKY A;  5M1P A;  1TAU A;  2W42 A;  3QES A;  2D0O A;  5KQ8 A;  1I3A A;  4O55 A;  5FPM A;  2KLA A;  1BHL A;  4DSK A;  4FVM A;  5BPN A;  1U49 A;  1RCH A;  1YT3 A;  2VQF K;  2I5J A;  4BRQ A;  1KD1 O;  3SBT A;  3TU5 A;  2A41 A;  2F8S A;  3MN9 A;  1UWB A;  4YDQ A;  1TUU A;  4KKO A;  1WSF A;  4CZM A;  4CED A;  5AQG A;  2E2O A;  4KTQ A;  4H4M A;  1J5O A;  3HO1 A;  2UXD K;  2GEM A;  2XO7 A;  3OYH A;  3GDQ A;  5ADX A;  4FW1 A;  1YTU A;  1T3V A;  3SNN A;  4FWQ A;  3BGR A;  5FLX O;  1XNR K;  2HHW A;  5BRE A;  2OTJ N;  1SKS A;  1TVR A;  4WQ4 C;  1FKO A;  2FSJ A;  2FSN A;  2Z1G A;  4IO9 L;  5M1F A;  1K4L A;  3VQ5 A;  4CBU A;  4JAX A;  1D9D A;  1VR4 A;  4W5N A;  3A2F A;  4X65 K;  2P5G A;  3ZSZ A;  3JXU A;  3ZLJ A;  3BZK A;  2HHX A;  3V9W A;  3A8Y A;  3D6R A;  3OYN A;  1S9E A;  4FM0 A;  4H0P A;  1KVB A;  1VQO N;  3DLL L;  2E5L K;  2DFF A;  4BG8 A;  1C6V A;  1C0T A;  4FJ5 A;  4CF1 A;  4K88 A;  1KRP A;  3OYA A;  5C10 A;  3F9K A;  3O3G A;  3THV A;  2KKZ A;  2PFU A;  3MN7 A;  3ZSQ A;  4B3M K;  2A1S A;  3HVT A;  4Z4H A;  3HT3 A;  3T19 A;  4OPJ A;  5C24 A;  2YHB A;  1HKC A;  4IO8 A;  2YX6 A;  3IRX A;  3IAL A;  1NFJ A;  1KXP A;  2G8U A;  3H1Q A;  1J5E K;  1EQY A;  1VAZ A;  2GTD A;  4X62 K;  4FSV A;  3SAH A;  4X66 K;  4C8N A;  1NOY A;  1OVY A;  2L8Y A;  3LPT A;  2AA4 A;  2QEX N;  1C0M A;  3ENH A;  2YKN A;  1YUW A;  4IFV A;  2QK9 A;  1QHT A;  3THX A;  2Q3V A;  3IS9 A;  1GLE G;  4P6P A;  4WQ5 C;  3JSM A;  4WQ5 A;  3MEE A;  1Q7Y O;  3QLH A;  3ZIG A;  2FXU A;  1UA1 A;  2CGK A;  2EWS A;  2R7Y A;  3NE6 A;  3EZ5 A;  5A2Q O;  3V4I A;  3ZIE A;  1HJO A;  1TL1 A;  4M45 A;  2GUI A;  4BR4 A;  4OKK A;  4PUO A;  3N4P A;  3RWU A;  1HYS A;  5BPM A;  3QNN A;  1NKB A;  3HRG A;  3PO5 A;  1KTQ A;  3MN5 A;  3CQY A;  4M41 A;  1C1A A;  3SK3 A;  4I2P A;  1QTM A;  2ITG A;  3NFA A;  1NGH A;  3DLR A;  4DSF A;  3K5L A;  4MO4 A;  3SLC A;  3VQ9 A;  1GLC G;  2Q31 A;  4AM6 A;  1NJ2 A;  1Y2I A;  1QHA A;  3THY A;  2HNZ A;  2FBY A;  4NCX A;  2H3G X;  1MA9 B;  2ZJP L;  3OYM A;  1VRU A;  1YI2 N;  4RW8 A;  2CRQ A;  4BQL A;  3N4Q A;  5F2R A;  4AHR A;  4KHN A;  4PWD A;  1NGB A;  3QER A;  1B9D A;  1NKE A;  3K9K A;  3CCL N;  3DYA A;  4GV6 A;  3FE1 A;  4FWO A;  1S3X A;  1K4O A;  4DQI A;  3OYG A;  3GBT A;  3NGY A;  4M63 C;  5KGW A;  3TSQ A;  4RCH A;  3OYE A;  4BC3 A;  5AZI A;  1RT3 A;  1T8E A;  3OS1 A;  2IAJ A;  3VGK A;  1K8K A;  1SUQ A;  3OYJ A;  1RDA A;  2GX9 A;  2D0P A;  1Q8I A;  3TTD A;  1OH7 A;  4KHQ A;  3AVN A;  1BCM A;  3LAL A;  2P9S B;  1OKJ A;  2RF2 A;  3NVM A;  3W0L A;  4JI4 K;  4FK0 A;  1SKR A;  3DRS A;  5D3G A;  3HPH A;  4M3Y A;  1VQ4 N;  5JMV A;  4DSI A;  4B1U B;  2V52 B;  1S9G A;  3MCP A;  3TAM A;  4DV0 K;  1IKV A;  2P9L A;  1Z05 A;  4ILG B;  5TKW A;  4EP4 A;  4XH5 A;  1REV A;  4W5R A;  1S1T A;  1SL0 A;  1TKT A;  4CCH A;  2F96 A;  1WSG A;  3H45 C;  1QSS A;  1GLA G;  2OPQ A;  3AA3 A;  4H0V B;  3LDL A;  1VQM N;  4AF1 A;  5DK5 A;  4H0T B;  1H0X A;  2QKB A;  3O5B A;  3KLE A;  2M71 A;  2NRX A;  1PVY A;  1YJ9 N;  1DGK N;  3OYL A;  2GUP A;  3CQX A;  4CJE A;  4CJP A;  4BE1 A;  2PYL A;  1RDB A;  4K86 A;  3ZSO A;  3MXI A;  4F8R A;  4C1N K;  5FPE A;  3C0B A;  1BA0 A;  4DR7 K;  1H4S A;  4FJL A;  4KPY A;  4W5O A;  2NRV A;  4FM1 A;  3KKS A;  2HBJ A;  4BE2 A;  1TKS A;  4YOU A;  4CFA A;  1SV5 A;  3WEE A;  4DMN A;  2ZWH A;  5HOO A;  2FF3 B;  3L6Q A;  1RTI A;  4CJS A;  4O8K A;  1RT5 A;  3OJS A;  4CBW A;  3HP6 A;  1EWR A;  3CFP A;  1B9F A;  4Y1D A;  3QDK A;  2ETJ A;  3AAP A;  3RVC A;  2ZM6 K;  1KVC A;  4CIE A;  4EAH D;  3JAM O;  3M3Z A;  4CVN E;  1T05 A;  2FBV A;  1ZBI A;  1U2V A;  4E1B A;  4DKW A;  1T44 A;  4GVE A;  4DU3 A;  1XMO K;  1C0G A;  4XH4 A;  1DEJ A;  4CHQ A;  2ZF5 O;  3ZEU A;  2G8I A;  2G8W A;  3WXJ A;  3P39 A;  4KH5 A;  4DR5 K;  1R59 O;  1K7J A;  1JCU A;  1HKG A;  3AJE A;  3HI0 A;  3UIQ A;  3DMJ A;  4WF9 L;  2YHA A;  1YJN N;  1HQU A;  1NFH A;  1HNV A;  3AY9 A;  2QTD A;  1RTH A;  4A2B A;  2DFH A;  1NK0 A;  4FLV A;  2KFN A;  3CD6 N;  4M3T A;  1PAV A;  1X9S A;  2OPS A;  3ZSW A;  4RW9 A;  4PY5 A;  1DTQ A;  2VWB A;  3L2V A;  4ELU A;  3OYI A;  5HRO A;  2P9U B;  4A5B A;  4FLW A;  2QWN A;  2O8B B;  1TK8 A;  3LAN A;  4FWN A;  2RHK A;  4LF8 K;  3H08 A;  4JKG A;  3O3F A;  1U47 A;  4J2E A;  3VEV A;  3CFO A;  5BR8 K;  3E9L A;  4I6M A;  4BC4 A;  3O8M A;  5IT9 O;  2E8A A;  3MK5 A;  5FRN A;  4CFC A;  4AHS A;  4LFA K;  5CYM A;  3MCA B;  4NO7 A;  1Q81 O;  3NMU A;  3WQU A;  4WFB L;  4J2D A;  1W0H A;  3J7A P;  3OA9 A;  3ZT2 A;  3VF4 A;  3P83 D;  1NGC A;  4CF9 A;  1NK9 A;  1HYZ A;  4DFK A;  2JLE A;  3SUP A;  5CY4 A;  4C8M A;  3LP0 A;  3KZB A;  1VSF A;  4OO1 J;  1GLJ O;  3MXM A;  4DS4 A;  5HP1 A;  1XMQ K;  1K4P A;  2EX3 A;  3TAN A;  1JL2 A;  2WUS A;  4DTR A;  4V19 S;  2QWR A;  2NNW A;  1QQN A;  3GE1 A;  1UOC A;  3EYZ A;  3P38 A;  5AQY A;  3I0R A;  2A1R A;  4JI2 K;  3CCV N;  3ZSR A;  3IDH A;  4IJA A;  3KLH A;  1N8R O;  3T1H K;  4E7J A;  4CGH A;  4JKA A;  1SAZ A;  3L3V A;  1VQ6 N;  1NJX A;  2D1K A;  3V1Q A;  3ASM A;  4PL8 A;  1JXE A;  3IAY A;  1S8E A;  4B9V A;  3AGR A;  4FWP A;  3KHY A;  4JI7 K;  2B5J A;  1GLF O;  4IXC A;  3WNF A;  1L3U A;  2P1J A;  4CD3 A;  4MQ3 A;  1KCF A;  4M3Z A;  1JLF A;  3DLB A;  4JI8 K;  4HWI A;  3K9J A;  2HHT A;  1ATS A;  2KW4 A;  1UA0 A;  4HTU A;  5C15 A;  1TKD A;  1VQK N;  4NLB A;  3IMX A;  3R8E A;  1B92 A;  1VRT A;  2O4G A;  4DFP A;  4W5Q A;  1HR0 K;  4FJ7 A;  2AP1 A;  4I9L A;  4M3R A;  4YHH K;  2W6K A;  2HB5 A;  1RT6 A;  3AO2 A;  3QKB A;  3DOK A;  1NK5 A;  2B6A A;  4A62 A;  3KJV A;  3L2U A;  1X9J A;  4DS5 A;  4H03 B;  5GAH P;  1VSH A;  2Q0U A;  4IKF A;  3CCJ N;  4FK4 A;  1VSL A;  3VEZ A;  2E4L A;  2QA4 N;  4UY8 O;  5HRP A;  4K43 A;  3MEC A;  4B9T A;  4NYN A;  3WXM B;  1WB9 A;  2O8D A;  2PZS A;  5JS1 A;  4EZ6 A;  3F9M A;  2CH6 A;  2P9I A;  4C8K A;  3CJ7 A;  2HVI A;  2F9W A;  1TV6 A;  2Y1I A;  1OH6 A;  1GLB G;  1GOC A;  1WAF A;  4E7H A;  2E1Y A;  4CJT A;  1NJ1 A;  2P9P B;  3MX5 A;  3CM6 A;  5HBM A;  4DLG A;  1J9A A;  1NU0 A;  2Q3S A;  4FJG A;  3HSC A;  1X3N A;  1TAQ A;  1JXB A;  3PSF A;  5LMN K;  3JYT A;  3AVJ A;  1IH7 A;  4B9Q A;  3ZIH A;  2GWK A;  1P8Z A;  2DFE A;  1R0A A;  2BGG A;  4TWA A;  3EY1 A;  2NLX A;  5LMU K;  3M6G A;  3SPZ A;  3DWL A;  3QEV A;  4G1Q A;  1CLQ A;  4IDH A;  3CCE N;  2RKI A;  4YKE A;  4AIL C;  1QVF M;  3RRG A;  5HL7 L;  4NB4 A;  3TAP A;  4CD1 A;  3H1V X;  1QQM A;  3O4N A;  3F5T A;  5AQT A;  4NXN K;  4BDP A;  4OKE A;  4CK2 A;  1O13 A;  2EK0 A;  1ASW A;  3AA2 A;  4FWS A;  3MED A;  3C95 A;  3KK2 A;  3V9X A;  3BY5 A;  3T1A A;  3ZCM A;  3V9S A;  3T7Z A;  2LSN A;  4CGJ A;  5SWM A;  1M90 O;  4B1W B;  2DTU A;  4EHU A;  1T6D A;  3ZET A;  3EKU A;  3R6M A;  1EXQ A;  2QWP A;  5AFU H;  1SQK A;  4CGF A;  3DXK B;  3CJA A;  4EHT A;  4OPK A;  3CC4 N;  4DTP A;  1EP4 A;  4CZJ A;  4K8X A;  2BKY X;  1YIT N;  4XH1 A;  4J2B A;  1TK0 A;  4IOA L;  1KAX A;  1QS4 A;  1W2B M;  3AO5 A;  3VES A;  4QS9 A;  3IAB A;  3NF7 A;  3SV4 A;  1LOT B;  1G15 A;  5KTQ A;  1DTT A;  3D2E B;  1X9W A;  4ILH A;  2Q0R A;  1JLE A;  4Z4G A;  3DLK A;  3SV3 A;  1QZ6 A;  4BVO A;  4B9L A;  4JD2 A;  4MDA A;  4AQY K;  4IOX A;  1IG9 A;  3EKS A;  4AHU A;  4U67 L;  4Z4E A;  4DV1 K;  4HVJ A;  4IFE A;  5C25 A;  4CJK A;  3T3F A;  3ULE A;  4CEC A;  3H3O B;  4N56 A;  2Y1B A;  3LZJ A;  1MWM A;  2VGM A;  5EY4 A;  2GTC A;  3K5N A;  3KD1 E;  3TR8 A;  4DG1 A;  1NNE A;  5AQM A;  4DFM A;  3TOE A;  4Z4I A;  3ZX2 A;  5AQS A;  3CJB A;  4KRE A;  3MXJ A;  3A5L C;  4GMJ B;  4JI3 K;  4ISF A;  1K73 O;  1ZXO A;  3EO3 A;  2IS3 A;  3O6W A;  1RNH A;  2O8C A;  3QEI A;  4B1X B;  1NGA A;  3ZYY X;  4YY3 K;  4QCL A;  3KKR A;  2FBT A;  2MX1 A;  3CF5 L;  4FLX A;  2WON A;  3D7E O;  1XQS C;  3GOI A;  3C6H A;  2F8T A;  4LC9 B;  3O80 A;  2Y1J A;  3M8S A;  3BUZ B;  3E66 A;  3LAM A;  4L8R B;  2E6M A;  3AVK A;  3KLF A;  2GEL A;  1KAZ A;  3C7N B;  2D4W A;  4M7Y A;  2UXC K;  2AJQ A;  1IBK K;  1S1U A;  2FBX A;  3DOL A;  2YI1 A;  3F73 A;  5FPD A;  2UUA K;  5CHI A;  2IVP A;  4H5R A;  4BWJ A;  2OYQ A;  3BEX A;  1TGO A;  4HTL A;  3QO9 A;  4LSN A;  3G10 A;  3RMC A;  1NOZ A;  2A2Y A;  1XWL A;  3HZ7 A;  3DRR A;  4FL9 A;  1LAV A;  1NK8 A;  4FLY A;  1SS6 A;  3NGI A;  3RSE A;  3VF6 A;  3V6D A;  1JLQ A;  5GAE P;  3UKR B;  4F2S A;  4KTZ A;  1G57 A;  1T03 A;  1Q9Y A;  4BC2 A;  3CCS N;  1NBW A;  3HM9 A;  5KPZ A;  3E9P A;  1ASU A;  3AAR A;  1IBL K;  3SUO A;  4FFJ A;  2LXR A;  3L8B A;  2BH1 A;  3QIN A;  3SJH A;  4F3O A;  2Q1N A;  2WTU A;  1NMN A;  2HHH K;  4DSE A;  1N32 K;  4FZZ A;  3NGZ A;  3G71 N;  3VQ6 A;  3SQ1 A;  3ZX3 A;  2OAN A;  3H46 O;  4NYF A;  3M8Q A;  2RPI A;  2E88 A;  2O8F B;  3VTI A;  5AQF A;  1V4S A;  1WSI A;  4B3O A;  1FXX A;  5KQD A;  1J6Z A;  4DB3 A;  4B3S K;  4CZG A;  1H0Y A;  1TIG A;  4JV5 K;  4BR2 A;  1CZA N;  1QZ5 A;  3WBM A;  2KZM A;  3FLC O;  3FZK A;  3TAR A;  5JIC A;  5HLF A;  3ZT1 A;  3V9Z A;  1VSI A;  3ULD A;  3PV8 A;  1WSH A;  3ATV A;  4DSJ A;  5LY3 A;  1Y97 A;  4J8F A;  2YNH A;  1QVG M;  3LP3 A;  4Z4F A;  1K4I A;  2BDP A;  2ZJQ L;  3OVN A;  1U6Z A;  1N6Q A;  2KHO A;  1XHX A;  4QOZ B;  4ZTJ A;  3AO4 A;  4FBW A;  2J4R A;  4I7F A;  3OS2 A;  3PX4 A;  5M1N A;  3THW A;  3PY8 A;  2V51 B;  5JLF A;  3S3O A;  3U6F A;  3S9H A;  4B08 A;  3LP1 A;  3NHG A;  1NM1 A;  1HNZ K;  1II7 A;  3CCR N;  4E1M A;  3V1O A;  1W97 L;  3FZF A;  1ZC6 A;  4CHP A;  1TKX A;  3SZ2 A;  4HUG A;  2YNF A;  3AA5 X;  1NGJ A;  4Z9E A;  3CFR A;  5GIP A;  4JHD B;  5T7B A;  1NG9 A;  1NWK A;  3FGU A;  4BRD A;  3Q7C A;  1RBS A;  4KI4 A;  2PYJ A;  1V4T A;  1TKU A;  1VSM A;  4BY9 C;  3D2F A;  2QWM A;  1GLL O;  3M8P A;  4IG0 A;  3WXL A;  3NH1 A;  3OYC A;  4LF7 K;  3HPO A;  4PA1 A;  1BI4 A;  3FFK B;  3E1Y A;  3TAB A;  4H5W A;  1Z25 A;  3DXM B;  4DU1 A;  4Q0B A;  2G8H A;  3H07 A;  4IG3 A;  1G58 A;  4ICL A;  5ELZ A;  4FJH A;  4B3R K;  1S1X A;  3CME N;  3EE9 A;  4CJW A;  1N5Y A;  1S1V A;  3QIO A;  4IOC L;  3QIC A;  3HM8 A;  3LVJ C;  4P6C A;  4K41 A;  2GV9 A;  4CEA A;  4EIA A;  4CEZ A;  4GNI A;  4NCG A;  4CFB A;  3VF2 A;  3VN5 A;  1Q82 O;  1KLM A;  4KV8 A;  3TWH A;  4ISE A;  3KWG A;  3OYK A;  3CJ1 A;  3MDQ A;  4LF5 K;  4L3Q A;  3FR0 A;  1YJW N;  3VQP A;  2HND A;  2P9N A;  2VG7 A;  3UKU B;  4I9Q A;  2P9K B;  2CGL A;  4RG8 A;  4CJV A;  2EHG A;  4CJF A;  2HF4 A;  3WUH A;  2QXF A;  5AFU A;  1YVU A;  1SZ2 A;  4B8C A;  5H1S Q;  4OPH A;  1N33 K;  4XEI A;  5LL6 Z;  1S72 N;  1BGX T;  4YDU A;  3T69 A;  3HYF A;  1XI1 A;  4IZ9 A;  2YNI A;  3ZT0 A;  3DAW A;  1S6P A;  1HNW K;  3TSP A;  1XEZ A;  5J2N A;  2NRR A;  3ENO A;  1KK9 A;  2O4I A;  3EN9 A;  4CZH A;  5CR4 A;  4Q15 A;  4DQR A;  1NMD A;  4IDK A;  1UAX A;  1LN4 A;  1C1C A;  2W6L A;  2NUB A;  4KH6 A;  3C6T A;  3I0S A;  3WXK A;  4OVL A;  2ASO A;  4H5V A;  2E2P A;  4O5F A;  1MDU B;  2G8V A;  3VEN A;  2NZT A;  1X9M A;  4IFY A;  5FPN A;  5KRT A;  3HOS A;  5GAG P;  2VG5 A;  1LWF A;  3IFR A;  3AV9 A;  4FWK A;  3JS6 A;  5FDL A;  3HXM A;  3U3Y A;  4FXD A;  4JKH A;  4NLC A;  2Z7C A;  2YHX A;  4N41 A;  4HVZ A;  4JYA K;  3AGK A;  3L7V A;  5AQZ A;  1TYQ A;  5C2D A;  4OLF A;  4BVP A;  1P90 A;  3SQ0 A;  5CE3 A;  3K59 A;  2ZQB A;  3K2P A;  4EZ9 A;  4CIG A;  4O8U A;  3C94 A;  1IG8 A;  3RRH A;  4FBQ A;  1ILY A;  2QWO A;  1TKZ A;  3RMD A;  4YNQ A;  4U7B A;  2YHY A;  4YFU A;  1E4G T;  1NJW A;  4JLH A;  5MLC Q;  1K9M O;  3WNG A;  2E1Z A;  3B6P A;  4JK9 A;  2BTF A;  3LZI A;  4OGC A;  4FPA A;  1NJZ A;  4CIF A;  3K5M A;  2A42 A;  4DU4 A;  3WQT A;  5I3U A;  3P31 A;  3QEX A;  3ITH A;  4HVC A;  4BDZ A;  3ISN C;  4YOX A;  4FPB A;  4DTX A;  2ZGZ A;  3J7Z O;  4NCA A;  3VER A;  4LF4 K;  5BRF A;  1FK9 A;  3QB0 A;  4FYD A;  1BIZ A;  3J80 O;  3J81 O;  2IC3 A;  2NRZ A;  3I56 N;  2A6A A;  1LWC A;  1WAJ A;  4CHO A;  2G8F A;  4IJN A;  3A0I X;  5E84 A;  1XNQ K;  1K49 A;  2HMP A;  2UXB K;  5CZ2 A;  3CPE A;  3PUF A;  5AQV A;  5J2P A;  1BU6 O;  2HBM A;  4CEF A;  1D8Y A;  4BRA A;  4BRK A;  3D45 A;  1ZBH A;  5AJ3 K;  2JWK A;  4FOI A;  5F1X A;  4M3X A;  1HJR A;  4BR0 A;  2QWL A;  3AVC A;  3TAG A;  3VGM A;  1L3S A;  3AVA A;  4LFC K;  3PX0 A;  4RW6 A;  1KFD A;  3QML A;  2HVH A;  2VWJ A;  4KHU A;  3L2W A;  3O9R A;  1RT7 A;  1KVA A;  3R1X A;  3LM9 A;  2VG6 A;  2KQ2 A;  4E3S A;  1D5A A;  2YV0 X;  3EZW A;  3VEY A;  3THX B;  1JLC A;  2D0A A;  5AQJ A;  4A2A A;  4CF8 A;  5LJW A;  1RT4 A;  4DQQ A;  4CK1 A;  3ZSY A;  3U8X A;  2OZM A;  1JLA A;  1LW0 A;  4BRM A;  4BC5 A;  3ID6 A;  1JLG A;  4DF8 A;  4KFB A;  4CJ5 A;  3BDP A;  2E6L A;  2YKM A;  4CE9 A;  3V1R A;  4CZK A;  1L5U A;  3SQ2 A;  2VYP A;  3VQC A;  4M3U A;  5E26 A;  1NK7 A;  3SMS A;  4FWM A;  2WOM A;  3S3M A;  3O4W A;  4MLH A;  4KB0 A;  1HRU A;  3CPW M;  4C1N I;  4GW6 A;  3OJU A;  4FJ8 A;  2ZJR L;  4BRO A;  1CXU A;  3THY B;  5KPT A;  3NF6 A;  2HBK A;  1ZBL A;  2JGU A;  3TAE A;  1CXQ A;  1K8A O;  2IDO A;  1RT2 A;  4JKB A;  2KZZ A;  4Z4C A;  4H4O A;  2X74 A;  4YOW A;  5B8H A;  4DTS A;  1IJJ A;  2ASM A;  3SPY A;  3VTH A;  1WSJ A;  3RR7 A;  5LJV A;  4DV7 K;  1RQ8 A;  3HJF A;  4P8J A;  1SL1 A;  2KFZ A;  3G4S N;  4A61 A;  4OJR A;  3GL1 A;  4FM2 A;  3KLG A;  1JJ2 M;  5AZI B;  5GIN A;  1BDG A;  4GV3 A;  1K8K B;  3VPZ A;  2Z1J A;  4R79 A;  3O1W A;  4B1Z A;  3CET A;  2OCE A;  4ZTF A;  3TTF A;  4KO0 A;  3O9Q A;  4YOT A;  5EOY A;  1RFQ A;  1EET A;  3VA3 A;  1C0U A;  2F4V K;  3NF9 A;  2P9L B;  2YJF A;  1S5J A;  4H8K A;  4DUZ K;  3IKM A;  4FW2 A;  4H5T A;  3CMA N;  1WSE A;  4O4G A;  1N34 K;  1OH8 A;  3CQ8 A;  4N47 A;  3SQ4 A;  3AVB A;  3NF8 A;  1LW2 A;  1WOQ A;  1JO0 A;  4Y0W A;  2HHU A;  4AHT A;  4JKD A;  1MWK A;  3SUQ A;  3QNO A;  4HCC A;  3MEG A;  2G8K A;  4B9N A;  1VSE A;  2I7N A;  4BRL A;  2DY4 A;  5HRN A;  4N5S A;  3KVG A;  1PVW A;  1F21 A;  4JI6 K;  3AVG A;  4Q5V A;  1GOA A;  2P9S A;  4FJK A;  2KTQ A;  3VEW A;  5BPL A;  4FZX C;  5GAD P;  2EH1 A;  4JS5 A;  3T1I A;  3SCX A;  3J8A A;  4FLT A;  4FCX A;  4DTU A;  2NRW A;  3TI0 A;  4E7I A;  4DSL A;  4YOV A;  2XY6 A;  3ZT4 A;  1HYV A;  1IEZ A;  3CCQ N;  3SI6 A;  4ZHR A;  3DRP A;  2O8E B;  4BGB A;  2UU9 K;  2P9K A;  3A5O C;  5M1O A;  4M42 A;  4QAG A;  2QW9 A;  3MN6 A;  4FK2 A;  1HRH A;  4LH5 A;  4B1V A;  1A5X A;  1IO2 A;  4FOE A;  4CK3 A;  2GWJ A;  4CF2 A;  3P4I A;  3PIP L;  5C12 A;  4JK7 A;  2XY7 A;  3DJC A;  3AO3 A;  2QM1 A;  4EO0 A;  1X3M A;  3OTO K;  4P6D A;  1U2V B;  2E2N A;  1X1P A;  2HHS A;  5C0Y A;  3J7Y P;  1NJI O;  4OPA A;  3DSC A;  3ZEU B;  4DUY K;  1KQS M;  1XC9 A;  2D0B A;  3TAQ A;  2WC9 A;  3SMP A;  1OH5 A;  1ZYQ A;  2VCP A;  2RE2 A;  3VQE A;  4B9M A;  3QBX A;  4E19 A;  2PAV A;  3ATU A;  1T7P A;  4PHT X;  4GY2 B;  3IG1 A;  1KC8 O;  3UB5 A;  3QBW A;  2D0C A;  5AQN A;  1BL3 A;  3I8D A;  3CI5 A;  3OBY A;  4X64 K;  2V7Z A;  3R9P A;  3MGZ A;  3AVI A;  2X6N A;  3NH0 A;  4FJM A;  4B8A B;  2IGI A;  4PKG A;  3PSI A;  1ASV A;  2DPN A;  2XRI A;  3CJ9 A;  4LH4 A;  4BRC A;  3KLI A;  3LDS A;  4KI6 A;  2XY8 A;  4JKG B;  1I39 A;  2HF3 A;  5K14 A;  2X78 A;  3BF3 A;  4I6M B;  2HMI A;  4P8E A;  3OHR A;  1RTJ A;  2HHQ A;  3NH2 A;  3DLH A;  3DLE A;  4QS8 A;  3EEQ A;  2BAN A;  1VQ5 N;  3VEO A;  1MU2 A;  3FFI A;  1RTD A;  3AVH A;  3U6Y A;  1BUP A;  5EU7 A;  1HC7 A;  4CJR A;  3VGL A;  4CJQ A;  1C1B A;  3CJC A;  3I33 A;  3MAQ A;  3FZL A;  3ZT3 A;  4BRH A;  4HUF A;  4HCB A;  1NGE A;  3AAQ A;  1KAY A;  2ZD1 A;  2CGJ A;  3OBW A;  4K87 A;  1VSK A;  3A5N C;  2VGN A;  1WLJ A;  4WQ4 A;  2HBL A;  4NXM K;  2VQE K;  4E7L A;  4MDB A;  3H6E A;  1VHX A;  1RDU A;  4CZL A;  4GV9 A;  2P9U A;  3A5M C;  2PY5 A;  3TTC A;  3K58 A;  4AH9 A;  2O8B A;  1Q86 O;  2Z1H A;  1J54 A;  4OKJ A;  2A5X A;  3O1B A;  1UDV A;  1ITG A;  1XUP O;  5AR0 A;  1NK6 A;  4BRG A;  1YTA A;  5KI6 A;  3LWL A;  1E4F T;  4PQU A;  5BRD A;  4C23 A;  4DV6 K;  3PO4 A;  3C6A A;  3EL2 A;  3QFP A;  4BAC A;  4H0X B;  2GBZ A;  2RIS A;  1BIU A;  3P5J A;  4KTW A;  3FZH A;  3VA0 A;  1JCF A;  3O9T A;  2ATQ A;  3CIP A;  5FRM A;  4EFH A;  4O0J A;  4UQG A;  5AQK A;  4CGG A;  3ZSX A;  2IOC A;  4FJJ A;  1HPM A;  1L3T A;  1BQM A;  1BG3 A;  4WYB A;  3VEX A;  4E1J A;  3SAG A;  1BA1 A;  3Q7B A;  1NJ6 A;  3RR8 A;  1YAG A;  3W3D A;  4Z0U A;  1ZBS A;  3AA4 A;  3MWT A;  1LWE A;  4FO0 A;  4HD0 A;  3VQ7 A;  4CEB A;  3AO1 A;  4GVM A;  4K8Z A;  1IKX A;  2OA8 A;  4A59 A;  4KHY A;  1OVQ A;  1BOT O;  5AQQ A;  5KRS A;  3T1Y K;  4CZF A;  1IBM K;  5C2F A;  4M3W A;  1VSJ A;  4B9U A;  4BE0 A;  2O8D B;  1D9F A;  5AZJ B;  3LQU A;  1JKH A;  1S6Q A;  2ITM A;  1RDC A;  4KHW A;  1RDD A;  2YCH A;  4G9Z A;  4I14 A;  2P9I B;  3OYD A;  3K5O A;  4KHS A;  4BRF A;  3KK1 A;  1RBV A;  2LN3 A;  4BWM A;  4J2A A;  5KGX A;  2HHV A;  5M1Q A;  2E2Q A;  1Y9X A;  3QEP A;  4I2Q A;  3LDP A;  1HLU A;  5BRH A;  2IVO A;  4CHN A;  4DQS A;  5F0X A;  1XHZ A;  4TSX A;  5BN8 A;  2NRT A;  4CJL A;  4CJU A;  1QSL A;  1K6Y A;  3B6O A;  4AM7 A;  4DTO A;  3VQ4 A;  1RBT A;  2OTL N;  1NGG A;  4LD0 A;  1U4B A;  4A57 A;  1QE1 A;  4FWL A;  3LS6 A;  3OY9 A;  1RIL A;  1ESV A;  4CGI A;  4F9O A;  5E41 A;  3OYB A;  4OX9 K;  2IVN A;  4DTM A;  4RW7 A;  3RMB A;  4HUE A;  3SYZ A;  3VOV A;  3CXC M;  1U45 A;  3TPQ A;  3GG4 A;  3B8A X;  3HP9 A;  1Y64 A;  4JRQ A;  1NK4 A;  4P77 A;  1QSY A;  3H3N O;  1VQP N;  4KBO A;  4B1Y B;  3CCM N;  4MO5 A;  3V81 A;  4JEP A;  3BZC A;  1HNI A;  5AQP A;  3ZSV A;  1EX4 A;  3AVL A;  4QS7 A;  3HPG A;  4ID1 A;  1J53 A;  2WBN A;  3LP2 A;  2QWQ A;  2P9P A;  1VK0 A;  2QI2 A;  3VQD A;  3BP8 A;  1Z6R A;  1YIJ N;  1T6C A;  4DTJ A;  2FC0 A;  4LFB K;  3VET A;  3CCU N;  3L2R A;  2CH5 A;  1C0F A;  5IWA K;  1LV5 A;  4CHY A;  3CYM A;  3ZET B;  5FRO A;  5BR9 A;  1RT1 A;  4FLU A;  4N76 A;  4DF4 A;  3FZM A;  4LF6 K;  3ID8 A;  3G25 A;  4WFA L;  4DWI A;  3WNE A;  3QEW A;  4JN4 A;  3MMV A;  3WXI A;  1FJG K;  1DT9 A;  3MK6 A;  2WFB A; 
#chains in the Genus database with same CATH homology
 4EHU A;  1T6D A;  4YDU C;  4DCH A;  3ZET A;  3UE5 A;  3HTV A;  3O9R A;  1HKC A;  3R1X A;  4IO8 A;  3LM9 A;  3EKU A;  3R6M A;  2YX6 A;  5AFU H;  2QWP A;  1SQK A;  1KXP A;  2YHW A;  3CJA A;  3DXK B;  4EHT A;  3CC4 N;  4CZJ A;  5AQR A;  3H1Q A;  1GLD G;  3EZW A;  4JD2 B;  3VEY A;  1SNN A;  1EQY A;  4XH1 A;  1YIT N;  5AQJ A;  1VAZ A;  4A2A A;  1KAX A;  4IOA L;  1W2B M;  1VQ8 N;  2GTD A;  3VES A;  4QS9 A;  5LJW A;  1LOT B;  3ULE B;  4FSV A;  3SAH A;  4Z94 A;  3D2E B;  1OVY A;  3U8X A;  2AA4 A;  2QEX N;  4ILH A;  2Q0R A;  4BRM A;  3ENH A;  5GIO A;  1QZ6 A;  3DXK A;  3ID6 A;  4BC5 A;  1YUW A;  4BVO A;  4JD2 A;  4MDA A;  1GLE G;  3KWI A;  4P6P A;  4JK8 A;  4IOX A;  1XC3 A;  3EKS A;  4WQ5 C;  4CZK A;  4WQ5 A;  1YVN A;  4U67 L;  2VYP A;  1Q7Y O;  3ZIG A;  2FXU A;  4IFE A;  4H5N A;  2CGK A;  2EWS A;  5E26 A;  3ULE A;  3SMS A;  5BN9 A;  4FWM A;  3PIO L;  3OW2 M;  3H3O B;  3D2E A;  3O4W A;  4MLH A;  3ZIE A;  3R3L A;  1HJO A;  4FWR A;  5AQH A;  1YHQ N;  1HRU A;  1MWM A;  2VGM A;  5EY4 A;  4BR4 A;  3CPW M;  4C1N I;  5AQL A;  2ZJR L;  4BRO A;  3N4P A;  1RGI A;  1RDW X;  5AQM A;  5KPT A;  3ZX2 A;  5AQS A;  2HBK A;  3CJB A;  5TKY A;  5BPM A;  3A5L C;  1K8A O;  4NZR M;  3HRG A;  4JNE A;  4ISF A;  3MN5 A;  3O9U A;  1K73 O;  1ZXO A;  3CQY A;  3EO3 A;  3O6W A;  3SK3 A;  2Q2R A;  3LL3 A;  4JKB A;  5M1K A;  4B1X B;  1NGA A;  1M1K O;  3L4I A;  5JVG L;  4FBK A;  1HUX A;  1NGH A;  3C65 A;  3ZYY X;  4BR9 A;  4GV9 A;  4MO4 A;  3SLC A;  2MX1 A;  4YOW A;  4JKE A;  5B8H A;  3CF5 L;  1GLC G;  1IJJ A;  2Q31 A;  4AM6 A;  1QHA A;  2ASM A;  3D7E O;  1XQS C;  3GOI A;  3C6H A;  4LC9 B;  3O80 A;  4E1B A;  3QFU A;  3VTH A;  1VQL N;  2H3G X;  3MWP A;  3BUZ B;  1MA9 B;  3E66 A;  4BRP A;  4WCE L;  5LJV A;  4PL7 A;  2ZJP L;  4P8J A;  1YI2 N;  4BQL A;  3G4S N;  2GEL A;  4A61 A;  1KAZ A;  3C7N B;  2D4W A;  3N4Q A;  4M7Y A;  2HST A;  3GL1 A;  5AQI A;  5F2R A;  5DM7 L;  1NGB A;  1JCG A;  2UYT A;  5KPR A;  4CZE A;  4DQ8 A;  1JJ2 M;  5AZI B;  5GIN A;  3K9K A;  1BDG A;  3CCL N;  4GV3 A;  2YI1 A;  2PBD A;  3CHW A;  1HX1 A;  1K8K B;  3MIO A;  3VPZ A;  3U9D A;  5FPD A;  4GV6 A;  5CHI A;  4R79 A;  2IVP A;  4DHY A;  4YOY A;  3FE1 A;  3O1W A;  1S3X A;  3CET A;  4FWO A;  4H5R A;  4B1Z A;  3RSE B;  1K4O A;  3BEX A;  3HZ6 A;  3TTF A;  3GBT A;  5ADX H;  3O9Q A;  4YOT A;  3C7N A;  5EOY A;  1RFQ A;  2ZGY A;  4HTL A;  1NGD A;  4M63 C;  3TSQ A;  4RCH A;  4BC3 A;  5AZI A;  3CER A;  1EO1 A;  4FL9 A;  3G6E N;  2P9L B;  2YJF A;  1K8K A;  3VGK A;  1SS6 A;  2GX9 A;  3IKM A;  4H5T A;  2D0P A;  5EXW A;  3RSE A;  3VF6 A;  3TTD A;  4IEE A;  3CMA N;  5GAE P;  3UKR B;  2P9S B;  1G57 A;  1OKJ A;  3NVM A;  3W0L A;  2EQA A;  4BC2 A;  3KK7 A;  1WOQ A;  3CCS N;  4RTF D;  3HBT A;  1NBW A;  5KPZ A;  1VQ4 N;  1S22 A;  2W40 A;  3E9P A;  1H1V A;  4Y0W A;  5JMV A;  4B1U B;  3AAR A;  2V52 B;  3MCP A;  4JKD A;  1MWK A;  2P9L A;  2FF6 A;  1Z05 A;  4FFJ A;  2I7N A;  4BRL A;  4ILG B;  5TKW A;  3CC7 N;  3KVG A;  1PVW A;  2BH1 A;  2P9B A;  4XH5 A;  3UKR A;  2P9S A;  3ENB A;  3SJH A;  3LRJ A;  2Q1N A;  1QQO A;  3H45 C;  1YF5 L;  1GLA G;  2FSK A;  3VEW A;  5BPL A;  5GAD P;  2A40 A;  3T1I A;  4NZT M;  3G71 N;  4H0V B;  3L0Q A;  2F9T A;  3J8A A;  4FCX A;  3LDL A;  1D4X A;  4AF1 A;  3ZX3 A;  1VQM N;  2OAN A;  4H0T B;  4PKI A;  3H46 O;  2NRW A;  3O5B A;  2E88 A;  3M5R A;  3VTI A;  5DM6 L;  5AQF A;  1LCU A;  4CZI A;  1V4S A;  4YOV A;  2NRX A;  1IEZ A;  3CCQ N;  1PVY A;  2Q97 A;  1YJ9 N;  1DGK N;  2GUP A;  3CQX A;  5KQD A;  1J6Z A;  4DB3 A;  2JWL A;  4YOR A;  4BGB A;  4C1N K;  4CZG A;  2P9K A;  5FPE A;  3A5O C;  3C0B A;  5M1O A;  4BR2 A;  1BA0 A;  1CZA N;  1QZ5 A;  2QW9 A;  3MN6 A;  3FLC O;  1Q18 A;  2NRV A;  5AQO A;  3FZK A;  4B1V A;  1VQ9 N;  4FOE A;  2HBJ A;  5JIC A;  2GWJ A;  3P4I A;  3PIP L;  4YOU A;  5C12 A;  1TKS A;  3WT0 A;  4JK7 A;  1YXQ A;  3ATV A;  3DJC A;  2QM1 A;  4EO0 A;  3WEE A;  2ZWH A;  5HOO A;  1X3M A;  2FF3 B;  1DKG D;  1U2V B;  2E2N A;  3L6Q A;  4JKC A;  4J8F A;  5LY3 A;  1QVG M;  5C0Y A;  4P6D A;  2I7P A;  1NJI O;  2ASP A;  4O8K A;  4CBW A;  1K4I A;  2ZJQ L;  4OPA A;  1U6Z A;  3ZEU B;  3LDN A;  3QDK A;  4A5A A;  1NGF A;  1KQS M;  4FVU A;  5EVZ A;  2KHO A;  3AAP A;  2WC9 A;  3RVC A;  1JCE A;  3SMP A;  1ATN A;  4BGA A;  4FBW A;  2J4R A;  5AQX A;  1VQ7 N;  2VCP A;  4EAH D;  2V7Y A;  3M3Z A;  3O08 A;  2RE2 A;  5M1N A;  3QBX A;  4H0O A;  2PAV A;  3ATU A;  1VQN N;  4PHT X;  4GY2 B;  3CC2 N;  1U2V A;  2V51 B;  3P04 A;  3E9O A;  4DKW A;  1T44 A;  4GVE A;  3UB5 A;  5JLF A;  3QBW A;  1KC8 O;  3I8B A;  5AQN A;  1C0G A;  4XH4 A;  1DEJ A;  1NM1 A;  4BRN A;  3ZII A;  2ZF5 O;  4PKH A;  3ZEU A;  3CCR N;  2A3Z A;  3CI5 A;  3OBY A;  1W97 L;  3WXJ A;  4WFN L;  3P39 A;  3TSU A;  3D2F B;  3FZF A;  1ZC6 A;  1R59 O;  4KH5 A;  1K7J A;  4K25 A;  1JCU A;  2V7Z A;  3BF1 A;  4RWT A;  4H0Y B;  1HKG A;  3R9P A;  3AJE A;  3HI0 A;  5AQW A;  3MGZ A;  3O9S A;  4CI6 A;  4WF9 L;  2DPN A;  4PKG A;  1NGJ A;  3CJ9 A;  4BRC A;  4CBX A;  5GIP A;  1YJN N;  5AZJ A;  3AY9 A;  4JHD B;  2QTD A;  3U4L A;  1NWK A;  1BWF O;  3FGU A;  4JKG B;  4A2B A;  4BRD A;  2HF3 A;  2BUP A;  3BF3 A;  3Q7C A;  4I6M B;  3VMF B;  4P8E A;  3OHR A;  1TKU A;  1V4T A;  4QS8 A;  4BR7 A;  3CD6 N;  4BY9 C;  3D2F A;  2QWM A;  1GLL O;  3WXL A;  4BG9 A;  5I9E B;  1VQ5 N;  3VEO A;  3FFK B;  3E1Y A;  4IEI A;  4H5W A;  2VWB A;  3DXM B;  4BRE A;  2P9U B;  1BUP A;  4A5B A;  3VGL A;  2QWN A;  3M1F A;  4JHD A;  3H07 A;  4FWN A;  1G58 A;  2RHK A;  3CJC A;  3I33 A;  4JKG A;  5JLH A;  3FZL A;  5ELZ A;  3VEV A;  1WUA A;  4BRH A;  3E9L A;  3IUC A;  1NGE A;  3AAQ A;  4I6M A;  1KAY A;  3OBW A;  2CGJ A;  2E8A A;  3O8M A;  4BC4 A;  3EE9 A;  3A5N C;  3MK5 A;  2VGN A;  4WQ4 A;  2HBL A;  2E20 A;  4IOC L;  1G99 A;  3MCA B;  3HM8 A;  3QIC A;  4MDB A;  4BQZ A;  3H6E A;  4P6C A;  2FLO A;  1RDU A;  4NO7 A;  3DXM A;  2P9N B;  4BR5 A;  4ISG A;  2P9U A;  2YJE A;  3A5M C;  4K41 A;  3TTC A;  4CZL A;  4EIA A;  3MX2 A;  1Q86 O;  3NMU A;  2Q36 A;  4GNI A;  4M7X A;  3WQU A;  2A5X A;  4WFB L;  3O1B A;  3VF2 A;  3ZX0 A;  1Q82 O;  3OA9 A;  3EE8 A;  4IWV A;  3VF4 A;  2F7T A;  3LDO A;  4ISE A;  1NGC A;  3KWG A;  1XUP O;  3CJ1 A;  1TUY A;  5AR0 A;  3MDQ A;  4BRG A;  4L3Q A;  3FR0 A;  3KZB A;  1YJW N;  2P9N A;  3UKU B;  4OO1 J;  1E4F T;  1GLJ O;  2P9K B;  2IIR A;  5BRD A;  4C23 A;  2CGL A;  1K4P A;  3F2K A;  4KH4 A;  2WUS A;  3C6A A;  3EL2 A;  3QFP A;  2HF4 A;  4H0X B;  3WUH A;  2QWR A;  2NNW A;  1QQN A;  4ILJ A;  1SZ2 A;  3GE1 A;  5AFU A;  5H1S Q;  2RIS A;  4OPH A;  4XEI A;  3L4Q A;  3P38 A;  1S72 N;  5AQY A;  3FZH A;  4JKF A;  4YDU A;  3T69 A;  5JVH L;  1JCF A;  3CCV N;  3IDH A;  3O9T A;  4IJA A;  3WEE B;  3SAF A;  4IZ9 A;  3CIP A;  4BRI A;  1N8R O;  4EFH A;  1NGI A;  3UKU A;  3DAW A;  5AQK A;  4JKA A;  1SAZ A;  3LM2 A;  3HOT A;  3TSP A;  1VQ6 N;  1XEZ A;  3U9Z A;  2NRR A;  1HPM A;  2D1K A;  3ENO A;  1KK9 A;  4PL8 A;  3EN9 A;  3LDQ A;  4CZH A;  3SBG A;  1BG3 A;  4WYB A;  5CR4 A;  3VEX A;  4K42 A;  4E1J A;  3AGR A;  1NMD A;  4FWP A;  3SAG A;  1BA1 A;  3KHY A;  3Q7B A;  4KH6 A;  1GLF O;  4IXC A;  3WXK A;  1ATR A;  3PLA A;  2ASO A;  4CD3 A;  4H5V A;  2E2P A;  4MLE A;  4O5F A;  1NLV A;  1MDU B;  2NRH A;  3VEN A;  1YAG A;  4HWI A;  3W3D A;  2NZT A;  1ZBS A;  3K9J A;  5FPN A;  4CJ7 A;  3MWT A;  4FO0 A;  1TYQ B;  2QXL A;  3HOS A;  5GAG P;  1ATS A;  5EX5 A;  3IFR A;  5C15 A;  1VQK N;  3I55 N;  4NLB A;  3IMX A;  4FWK A;  3JS6 A;  4A59 A;  3R8E A;  1BOT O;  5AQQ A;  4JKH A;  4CZF A;  2HOE A;  4NLC A;  3NVK A;  5C2F A;  2W41 A;  1HKB A;  2YHX A;  2AP1 A;  3S41 A;  3LQU A;  5AZJ B;  4HVZ A;  2RIU A;  4G9Z A;  2ITM A;  3AGK A;  2YCH A;  3L7V A;  1BO5 O;  5AQZ A;  4I14 A;  5AQU A;  2P9I B;  1TYQ A;  5C2D A;  4BVP A;  1P90 A;  5M1P A;  4BRF A;  5CE3 A;  4A62 A;  2D0O A;  2LN3 A;  1X9J A;  5FPM A;  5KQ8 A;  4H03 B;  5GAH P;  5M1Q A;  2KLA A;  2Q0U A;  4UY8 O;  4O8U A;  3CCJ N;  2E2Q A;  3VEZ A;  2QA4 N;  3LDP A;  1HLU A;  5BRH A;  1IG8 A;  2IVO A;  5BPN A;  5F0X A;  4K43 A;  4FBQ A;  5BN8 A;  3WXM B;  2NRT A;  1ILY A;  2QWO A;  4U7B A;  2YHY A;  4AM7 A;  4BRQ A;  1E4G T;  3F9M A;  1KD1 O;  2CH6 A;  2P9I A;  5MLC Q;  2OTL N;  1K9M O;  1NGG A;  3SBT A;  2E1Z A;  4A57 A;  4FWL A;  4JK9 A;  2BTF A;  2A41 A;  3TU5 A;  3LS6 A;  3MN9 A;  3CJ7 A;  1TUU A;  1ESV A;  4F9O A;  2F9W A;  4CZM A;  2IVN A;  4FPA A;  1GLB G;  2A42 A;  2E1Y A;  3VOV A;  3CXC M;  5AQG A;  2E2O A;  3TPQ A;  3WQT A;  2P9P B;  3GG4 A;  3P31 A;  3B8A X;  2GEM A;  3MX5 A;  3CME N;  3GDQ A;  5ADX A;  1Y64 A;  1T3V A;  4P77 A;  3H3N O;  4YOX A;  4FWQ A;  4FPB A;  1VQP N;  4KBO A;  4B1Y B;  3CCM N;  4MO5 A;  5BRE A;  2ZGZ A;  2OTJ N;  4JEP A;  3J7Z O;  4WQ4 C;  3HSC A;  1X3N A;  3VER A;  2FSJ A;  2FSN A;  5AQP A;  4IO9 L;  5M1F A;  1K4L A;  4QS7 A;  4CBU A;  4JAX A;  5BRF A;  3QB0 A;  2WBN A;  4B9Q A;  3ZIH A;  2QWQ A;  2GWK A;  2P9P A;  1P8Z A;  2QI2 A;  3JXU A;  3BP8 A;  2NRZ A;  3I56 N;  2A6A A;  1Z6R A;  2NLX A;  1YIJ N;  3M6G A;  1T6C A;  3A8Y A;  4IJN A;  3D6R A;  3A0I X;  3DWL A;  5E84 A;  3VET A;  3CCU N;  4H0P A;  1K49 A;  2HMP A;  2CH5 A;  1C0F A;  3DLL L;  1VQO N;  4IDH A;  3CCE N;  3CPE A;  4YKE A;  5AQV A;  1QVF M;  4BG8 A;  1BU6 O;  2HBM A;  3ZET B;  5HL7 L;  5C10 A;  5BR9 A;  4BRA A;  4BRK A;  1Q81 O;  2JWK A;  4FOI A;  4NB4 A;  5F1X A;  2KKZ A;  3FZM A;  4CD1 A;  3H1V X;  1QQM A;  2PFU A;  3F5T A;  3ID8 A;  5AQT A;  2QWL A;  3G25 A;  4BR0 A;  4WFA L;  3VGM A;  1O13 A;  3MN7 A;  4FWS A;  4JN4 A;  3MMV A;  3WXI A;  1DT9 A;  3MK6 A;  3QML A;  3T7Z A;  2WFB A;  1M90 O;  4B1W B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...